RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780523|ref|YP_003064936.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter asiaticus str. psy62] (357 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 30.2 bits (68), Expect = 0.42 Identities = 17/96 (17%), Positives = 26/96 (27%), Gaps = 30/96 (31%) Query: 44 QLGARVTSILEW-EQEKNHIAERL--HSNSLVTKRLSTSQAHL----SSMQKIVQDMVGP 96 QL R I +W E E + + + L + S + Q G Sbjct: 32 QLVTREAQIKDWVENELEALKLEAEEIPSEDQNEFLLERTREIHNEAESQLRAAQQQWG- 90 Query: 97 LVILLEGKTDNNKF--------PINAGM---LRDSY 121 N F P+ + +DSY Sbjct: 91 -----------NDFYKRDPRIAPLRGALATYSKDSY 115 >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A (L:127-208) Length = 82 Score = 26.6 bits (59), Expect = 4.8 Identities = 11/60 (18%), Positives = 22/60 (36%) Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312 +S+ + R L + + S G+I + A +G S + + + F I Sbjct: 16 RAGGISRRIEGDDRTELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAI 75 >2qne_A Putative methyltransferase; ZP_00558420.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Desulfitobacterium hafniense Y51} (A:114-181,A:366-471) Length = 174 Score = 26.5 bits (59), Expect = 5.0 Identities = 9/39 (23%), Positives = 14/39 (35%), Gaps = 4/39 (10%) Query: 111 PINAGMLR----DSYESFVTFANMTDEGQYLFSGINSSE 145 AG+L+ SYE F+ + + G E Sbjct: 66 CFXAGILQYFXAXSYEKFIXDDEIAGXLLHYXKGYTFDE 104 >2zbi_A Flagellin homolog; flagellum, structural protein; 2.00A {Sphingomonas SP} (A:1-113,A:232-292) Length = 174 Score = 26.0 bits (57), Expect = 7.2 Identities = 12/77 (15%), Positives = 20/77 (25%), Gaps = 1/77 (1%) Query: 75 RLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDE- 133 T++ L + +Q + V G + A T Sbjct: 20 LAQTAEGALGEISNNLQRIRELAVQASNGTNTQTDRDALQAEVTQLQSEIQRVAEQTSFN 79 Query: 134 GQYLFSGINSSEKPLNG 150 GQ L G + + G Sbjct: 80 GQKLLDGSFNGVQFQIG 96 >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural genomics, protein structure initiative; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} (A:256-500) Length = 245 Score = 25.9 bits (57), Expect = 7.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Query: 74 KRLSTSQAHLSSMQKIVQDMVGPLVILLEG 103 ++L+ QA L+ + + + LV + EG Sbjct: 23 EQLAAEQARLAGLIRDKRFRQHSLVAVFEG 52 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.314 0.129 0.348 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,316,633 Number of extensions: 95790 Number of successful extensions: 189 Number of sequences better than 10.0: 1 Number of HSP's gapped: 189 Number of HSP's successfully gapped: 6 Length of query: 357 Length of database: 4,956,049 Length adjustment: 89 Effective length of query: 268 Effective length of database: 1,947,404 Effective search space: 521904272 Effective search space used: 521904272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 55 (25.1 bits)