RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780523|ref|YP_003064936.1| flagellar hook-associated
protein FlgL [Candidatus Liberibacter asiaticus str. psy62]
         (357 letters)



>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine
           N-methyltransferase, PNMTase {Human (Homo sapiens)
           [TaxId: 9606]}
          Length = 263

 Score = 26.3 bits (57), Expect = 3.7
 Identities = 4/24 (16%), Positives = 7/24 (29%)

Query: 202 DKFSDDEYWANNWSNASDHNIKYR 225
            +F    Y  NN++          
Sbjct: 11  QRFEPRAYLRNNYAPPRGDLCNPN 34


>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain
           {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
          Length = 628

 Score = 26.1 bits (57), Expect = 5.2
 Identities = 8/26 (30%), Positives = 12/26 (46%), Gaps = 1/26 (3%)

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDD 207
           H   + MN + +  FIK    K  D+
Sbjct: 182 HHS-ACMNQKHLLRFIKSKLRKEPDE 206


>d1to6a_ c.141.1.1 (A:) Glycerate kinase GlxK {Neisseria
           meningitidis, (serogroup A) [TaxId: 487]}
          Length = 371

 Score = 25.7 bits (56), Expect = 6.4
 Identities = 19/94 (20%), Positives = 32/94 (34%), Gaps = 19/94 (20%)

Query: 36  GQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKR-----------LSTSQAHLS 84
           G +  +G Q G   T     +Q      E++   +L  K             + +QA + 
Sbjct: 201 GATYTFGKQKGLDSTMFEVVDQAIQDFYEKVSPATLKLKGAGAGGGIAGGLCAFAQASIV 260

Query: 85  SMQKIVQDMVG--------PLVILLEGKTDNNKF 110
           S      D++          LVI+ EG+ D    
Sbjct: 261 SGIDTCLDLIDFDKKVSDVDLVIVGEGRLDRQSL 294


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.314    0.129    0.348 

Gapped
Lambda     K      H
   0.267   0.0481    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,162,027
Number of extensions: 50163
Number of successful extensions: 90
Number of sequences better than 10.0: 1
Number of HSP's gapped: 90
Number of HSP's successfully gapped: 8
Length of query: 357
Length of database: 2,407,596
Length adjustment: 86
Effective length of query: 271
Effective length of database: 1,226,816
Effective search space: 332467136
Effective search space used: 332467136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (24.8 bits)