HHsearch alignment for GI: 254780524 and conserved domain: COG1256

>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion].
Probab=100.00  E-value=0  Score=419.59  Aligned_cols=477  Identities=23%  Similarity=0.344  Sum_probs=368.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEE----------CCCCEEEEEEEEEHHHHHHHHHHHH
Q ss_conf             913588999999999999986787442025789981267999860----------4660699899872068878887754
Q gi|254780524|r    1 MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRSENKNMFDKVLHAH   70 (480)
Q Consensus         1 Msl~~sl~~~~SGL~a~q~~ldvisnNIANvnT~Gyk~~~~~f~~----------~~~g~~~~~~~~~~~~~~~~~~~~~   70 (480)
T Consensus         1 ms~~s~lnta~sgl~a~q~~l~vtg~NIsNant~gYsRQrv~~~~~~~~~~~~~~~G~Gv~V~sI~R~~d~fl~~q~~~a   80 (552)
T COG1256           1 MSLFSLLNTALSGLNAAQAALDVTGHNISNANTPGYSRQRVIQTTNIPYLGGGLNVGTGVNVVSIQRLRDEFLTNQYRNA   80 (552)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEHHHHCCCCCCCCCCCCCCCEEEEEEEEHHHHHHHHHHHHH
T ss_conf             95267799999999999999987561335689998630210432356643576666676488863116879999999988


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             44556788787899888651267777764011366777668764138675300112210122222210002245656654
Q gi|254780524|r   71 SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA  150 (480)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  150 (480)
T Consensus        81 ~s~~s~~~t~~~~L~~le~ll~~~~-~~sl~~~L~~ff~s~q~la~~P~~~a~r~~vl~~a~~l~~~in~~~~~L~~l~~  159 (552)
T COG1256          81 NSQSSYLDTRASQLSQLESLLSEPS-ESSLSTLLNDFFNSLQELASNPSDTAARQAVLSKAQTLVNQINNTYEQLTDLRK  159 (552)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7666689999999999999847976-353789999999999999859564789999999999999999899999999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCCEEEEECCCCEEEECC
Q ss_conf             32000111278788754343210112223456676521001210000101002012478733771147870697061034
Q gi|254780524|r  151 DADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET  230 (480)
Q Consensus       151 ~~~~~~~~~v~~~n~~~~~~~~~n~~~~~~~~~~~~~~~~~d~~~~~~~~~s~~~~~~~~~~~~~~~~v~~~~g~~l~~~  230 (480)
T Consensus       160 ~i~~~I~~~V~~vNsLl~qIa~lN~qI~~~~~~g~~~NdLlDqRD~Lv~eLs~~i~i~V~~~~~~~~~~~~~~G~~lv~g  239 (552)
T COG1256         160 DINAEIAATVDEVNSLLKQIADLNKQIRKVKAAGNDPNDLLDQRDQLVDELSQLIGISVSKREDGDYNLTTGNGTTLVEG  239 (552)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEECCCCCEEEEECCCEEECCC
T ss_conf             88689999999999999999999999997304799930677779999999974625599984799767995688321146


Q ss_pred             CCCEEEEEECCCCCCCCCCCEEEECCCCC-CCCCCCCCCCCCCCCCHHHC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             44125763045666766432167336556-65677666765311101110-23313677878876554310012345577
Q gi|254780524|r  231 VPRDINFEKMNSYTVTSESNPIFIDGVVV-SSNQGSAVPKGKIKALLQIR-DSVVPIFQNQLDEMARVLIGSFSEKDPIA  308 (480)
Q Consensus       231 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~g~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (480)
T Consensus       240 ~~~~~-~~~~~~~~d~~~~~v~~~~~~~~~~~~~~~~~~~G~L~gll~~r~~~~~~~~~~-l~~~a~~~~D~~n~~~~~~  317 (552)
T COG1256         240 SEAKV-FAPLPGSDDETRGNVIYVDGDDEKAGNITNTLSGGKLGGLLDLRSDELAPTLNT-LGQLALSFLDEFNKGHGAG  317 (552)
T ss_pred             CCCEE-EEECCCCCCCCCCEEEEEECCCHHHCCCCCCCCCCCHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHHHHHHHH
T ss_conf             51005-663345368876358996078412123200246554788998751310688987-8889999999998766654


Q ss_pred             CCCCCCCCCCCCCCCCCCCC--------------------------------CCCCCCCCCCCCCCC-------CCCCCC
Q ss_conf             77776543211223456666--------------------------------543322222233333-------466621
Q gi|254780524|r  309 GNSENVPGLFIADGIKDLDN--------------------------------KLCQGISETICVNPQ-------YRSNPS  349 (480)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~~--------------------------------~~~~~~~~~~~~~~~-------~~~~~~  349 (480)
T Consensus       318 ~~~~~~~g~~~f~~~~~~~~~~~~~~~~~~~~g~~~is~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~G~~~  397 (552)
T COG1256         318 LDLNGAEGADFFNIEGLPVILTNDKSNGNISSGGFTVSDANKVGATTIPVTGDVVPGIATRLSDNVTFQISPDAANGNPT  397 (552)
T ss_pred             HHCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             40265203331144467410013223455556604772365456666554576653200113556433247000268741


Q ss_pred             CCCCCCCCCC-CCCCC--CCCCCCCHHHH---------------------HHHHHHHCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             0002456666-55556--66544310245---------------------676642011112333345677652899998
Q gi|254780524|r  350 FLRDGGSVSK-KFLWN--VKNLAGYPDLI---------------------NHYCDSFNKNFIFDPVAGINTNVTLLEYAR  405 (480)
Q Consensus       350 ~~~~~~~~~~-~~~~~--~~~~~~~~~~~---------------------~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  405 (480)
T Consensus       398 ~~~dgg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~D~~n~~~~~~~~~~~~~~~~~~T~~d~y~  477 (552)
T COG1256         398 LTFDGGANFAGGYVVNDAFTGKAASSSLLNLAVLATPSTKVAFAAPDFTIFDNANALALLNLQNNKKLVGGKSTFSDYYA  477 (552)
T ss_pred             EEECCCHHCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHH
T ss_conf             12045301256543455445776532124431134665434435655667741338887402234445778657999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             777887664211123223456799999998876628888999999999999999999999999999999987409
Q gi|254780524|r  406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK  480 (480)
Q Consensus       406 ~~~~~~~t~~sg~~~~~~~~~~~~g~i~~~~lE~SNVDL~eE~tnLI~~QraYqANakvItT~Demlq~Lin~~R  480 (480)
T Consensus       478 ~l~~~i~~~~~~a~~~~~~~~~~l~~~~~~~~S~SGVnlDEE~anLi~~Qq~Y~AsAKvI~tvd~m~dtLln~~~  552 (552)
T COG1256         478 GLVGWIGIKASTASSESDAKEALLNQLTSERQSISGVNLDEEMANLIQFQQAYQASAKVIQTVDEMLDTLLNIVG  552 (552)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             888999998887411214799999999999860137787799999999999999999999999999999986429