HHsearch alignment for GI: 254780524 and conserved domain: PRK06802

>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed.
Probab=98.88  E-value=1.3e-09  Score=76.28  Aligned_cols=45  Identities=20%  Similarity=0.263  Sum_probs=41.4

Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             876628888999999999999999999999999999999987409
Q gi|254780524|r  436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK  480 (480)
Q Consensus       436 ~lE~SNVDL~eE~tnLI~~QraYqANakvItT~Demlq~Lin~~R  480 (480)
T Consensus        96 yV~~PnVn~~~EMvdm~~AsRsYeANv~~~~~aK~m~~~aL~IGk  140 (141)
T PRK06802         96 YVFYPDVNVVSEMADMMSASRSFETNVEVLNSVKSMQQSLLKLGE  140 (141)
T ss_pred             CEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             884689898999999999999999999999999999999998637