HHsearch alignment for GI: 254780524 and conserved domain: PRK08871

>PRK08871 flgK flagellar hook-associated protein FlgK; Validated.
Probab=100.00  E-value=0  Score=394.13  Aligned_cols=471  Identities=14%  Similarity=0.166  Sum_probs=339.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEE----------CCCCEEEEEEEEEHHHHHHHHHHHH
Q ss_conf             913588999999999999986787442025789981267999860----------4660699899872068878887754
Q gi|254780524|r    1 MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRSENKNMFDKVLHAH   70 (480)
Q Consensus         1 Msl~~sl~~~~SGL~a~q~~ldvisnNIANvnT~Gyk~~~~~f~~----------~~~g~~~~~~~~~~~~~~~~~~~~~   70 (480)
T Consensus         1 m~-s~ll~ig~sgL~a~Q~al~vtg~NIANanT~GYsRq~v~~~~~~~~~~~~~~~G~GV~v~~I~R~~D~fl~~q~~~~   79 (626)
T PRK08871          1 MA-SDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQGTNDPRQFGGSTYGMGVHVENVRRSWDQFAVNELNLS   79 (626)
T ss_pred             CC-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEEEEEEECHHHHHHHHHHHH
T ss_conf             95-67899999999999999998747665169988051056540457623478720367898379981527999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             44556788787899888651267777764011366777668764138675300112210122222210002245656654
Q gi|254780524|r   71 SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA  150 (480)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  150 (480)
T Consensus        80 ~s~~~~~~~~~~~l~~le~~~~~~-~~~gl~~~l~~ff~a~~~la~~P~~~~~R~~~l~~a~~L~~~~n~~~~~l~~~~~  158 (626)
T PRK08871         80 TTNLANKTDTEANLDMLSSMLSSV-ASKKIPENLNEWFDAVKTLADSPNDLGARKVVLEKAKLISQTLNDFHETVRQQKD  158 (626)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCC-CCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             888889999999999999983887-7652789999999999998539875778999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCC-EEEEECCCCEEEEC
Q ss_conf             32000111278788754343210112223456676521001210000101002012478733771-14787069706103
Q gi|254780524|r  151 DADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNN-DMVVYTSDGTTLFE  229 (480)
Q Consensus       151 ~~~~~~~~~v~~~n~~~~~~~~~n~~~~~~~~~~~~~~~~~d~~~~~~~~~s~~~~~~~~~~~~~-~~~v~~~~g~~l~~  229 (480)
T Consensus       159 ~~~~~i~~~V~~iN~l~~~Ia~lN~~I~~~~---~~~ndL~DqRD~ll~eLS~~~~v~v~~~~~g~~~~v~~~~G~~Lv~  235 (626)
T PRK08871        159 VTNKKLDMGIERINQIALEIRDIHRLMMRTP---GPHNDLMDQHEKLIKELSQYTKVTVTPRKNAEGFNVHIGNGHTLVS  235 (626)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCCCCHHHHHHHHHHHHHHHCCEEEEECCCCCEEEEEECCCEEEEE
T ss_conf             9999999999999999999999999998548---9985268899999999975149699991699658999579716542


Q ss_pred             CCCC-EEEEEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4441-257630456667664321673365566567766676531110111023313677878876554310012345577
Q gi|254780524|r  230 TVPR-DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIA  308 (480)
Q Consensus       230 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (480)
T Consensus       236 g~~~~~l~~~~~~~-~~~~-~~~~~~~g~~~-~~~~~~~~gG~l~gll~~rd~~l~~~~~~l~~la~~~~~~~N~~~~~G  312 (626)
T PRK08871        236 GTEASQLKMIDGYP-DPHQ-RRLAMVEGKGL-KAIKADDIGGKLGALLDMRDEHIPQVMDELGRLATGFSSEVNRLQSQG  312 (626)
T ss_pred             CCCEEEEEEECCCC-CCCC-EEEEEECCCCC-EECCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             67403688634888-8762-17999538861-204446778635688871454227899998789999999889998616


Q ss_pred             CCCCCCCCCCCCCCCCCCC-----------CCCC----------------------------------CCCC-----C--
Q ss_conf             7777654321122345666-----------6543----------------------------------3222-----2--
Q gi|254780524|r  309 GNSENVPGLFIADGIKDLD-----------NKLC----------------------------------QGIS-----E--  336 (480)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~-----------~~~~----------------------------------~~~~-----~--  336 (480)
T Consensus       313 ~d~~g~~g~~~f~~~~~~~~~~~~~~~~~~~~~~~~v~i~d~~~~~~g~~~~~~~g~~~~v~~~~g~~~~~~~~~~~~~~  392 (626)
T PRK08871        313 LDLRGNVGGNLFTDVNSEVIAKSRAVTAPGSKADVAVFIDDISQLKGGEYALRYDGSQYTVTKPSGETVSLDPDGNPSAF  392 (626)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCEEEEECCCCCCCCCCEEEEECCCCEEEECCCCCEEEEECCCCCCCE
T ss_conf             57678646432245664211233101268874322577324443567641899617623897279955763036787632


Q ss_pred             CCC-------CCCCCC-------------------CCCCCCCCCCCCCCCCCCCCC--------C------C----CC--
Q ss_conf             223-------333346-------------------662100024566665555666--------5------4----43--
Q gi|254780524|r  337 TIC-------VNPQYR-------------------SNPSFLRDGGSVSKKFLWNVK--------N------L----AG--  370 (480)
Q Consensus       337 ~~~-------~~~~~~-------------------~~~~~~~~~~~~~~~~~~~~~--------~------~----~~--  370 (480)
T Consensus       393 ~~~g~~~~~~~~~~~g~~~~~~pt~~~~~~~~~~~~d~~~i~~~s~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  472 (626)
T PRK08871        393 YLDGMRVEVRNPPSAGERILLRPTRNGAAQIKLETNDAKKIAAQSYEASTTFAQGNAKFKILQAGDLREFEVIVSPTGDQ  472 (626)
T ss_pred             EECCEEEEECCCCCCCCEEEEECCCCCCHHHHEECCCHHHHHHCCCCCCCCCCCCCCCEEECCCCCCCCCEEEECCCCCE
T ss_conf             31343786036767786378713666301110114686664201643333334676422320467754422454378750


Q ss_pred             ----CHHH--H---------------------------------------HHHHHHHCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             ----1024--5---------------------------------------676642011112333345677652899998
Q gi|254780524|r  371 ----YPDL--I---------------------------------------NHYCDSFNKNFIFDPVAGINTNVTLLEYAR  405 (480)
Q Consensus       371 ----~~~~--~---------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  405 (480)
T Consensus       473 ~~~~d~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~gDn~na~~l~~l~~~~~~~~~~~T~~d~y~  552 (626)
T PRK08871        473 FAVTDMKGNILLDPQPYPPKGPVTVGGTTFELTEGALANDKFTANLVPSEGDNGNLRKMQQLQTRKVMDDGRSTIIDLYH  552 (626)
T ss_pred             EEEECCCCCEECCCCCCCCCCCEEECCEEEEECCCCCCCCCEEECCCCCCCCCHHHHHHHHCCCCCCCCCCCEEHHHHHH
T ss_conf             47632677521267656888850213416873366556761221146577872999998850100001788606999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77788766421112322345679999999887662888899999999999999999999999999999998740
Q gi|254780524|r  406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV  479 (480)
Q Consensus       406 ~~~~~~~t~~sg~~~~~~~~~~~~g~i~~~~lE~SNVDL~eE~tnLI~~QraYqANakvItT~Demlq~Lin~~  479 (480)
T Consensus       553 ~lvs~iG~~~~~a~~~~~~~~~~~~~~~~~~~svSGVnlDEEl~nLikyQqaY~AaArvItt~demldtLlnik  626 (626)
T PRK08871        553 NLNTEVGLKKATATRLAEVARLEKEAAQSRVASISGVNLDEEAANMMKFQQAYMASSRIMQAANDTFNTILQLR  626 (626)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999999999999999999999986011503999999999999999999999999999999987759