HHsearch alignment for GI: 254780524 and conserved domain: PRK12636

>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional.
Probab=100.00  E-value=1.6e-36  Score=242.28  Aligned_cols=69  Identities=19%  Similarity=0.281  Sum_probs=60.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             664211123223456799999998876628888999999999999999999999999999999987409
Q gi|254780524|r  412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK  480 (480)
Q Consensus       412 ~t~~sg~~~~~~~~~~~~g~i~~~~lE~SNVDL~eE~tnLI~~QraYqANakvItT~Demlq~Lin~~R  480 (480)
T Consensus       195 ~~~~~g~~~~~~~~~~~~~~v~qG~LE~SNVn~~~Emv~mI~~qRaye~n~K~i~~~De~~~~~~nl~R  263 (263)
T PRK12636        195 ETLNSGAPQVVVPGEGGTGKIQSGALEMSNVDLSEEFTEMIVAQRGFQANTRIITTSDEILQELVNLKR  263 (263)
T ss_pred             ECCCCCCCCCCCCCCCCCCEEECCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             136677755467787876416038476134759999999999999999998899999999999997459