HHsearch alignment for GI: 254780524 and conserved domain: TIGR02492

>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway . The amino acid sequences of the hook protein and of the three hook-associated proteins of Salmonella typhimurium have been deduced from the DNA sequences of their structural genes (flgE, flgK, flgL and fliD respectively). These sequences have been compared with each other and with those for the filament protein (flagellin) and four rod proteins. The hook protein was found to be most similar to the distal rod protein (FlgG) and the proximal hook-associated protein (HAP1), which are thought to be attached to the proximal and distal ends of the hook, the similarities being most pronounced near the N- and C-termini. It is thought that the axial proteins may adopt amphipathic alpha-helical conformations at their N- and C-termini. These regions of the filament and hook are believed to be responsible for quaternary interactions between subunits. Interaction between N- and C-terminal alpha-helices may be important in the formation of the axial structures of the flagellum. Although consensus sequences have been noted, no consensus extends to the entire set of axial proteins. Thus the basis for recognition of a protein for export by the flagellum-specific pathway remains to be identified.; GO: 0005198 structural molecule activity, 0009296 flagellum biogenesis, 0009424 flagellin-based flagellum hook.
Probab=100.00  E-value=0  Score=409.83  Aligned_cols=452  Identities=22%  Similarity=0.304  Sum_probs=363.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEE----------------CCCCEEEEEEEEEHHHHHHHHHH
Q ss_conf             88999999999999986787442025789981267999860----------------46606998998720688788877
Q gi|254780524|r    5 AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------------SPENVTVVTQRSENKNMFDKVLH   68 (480)
Q Consensus         5 ~sl~~~~SGL~a~q~~ldvisnNIANvnT~Gyk~~~~~f~~----------------~~~g~~~~~~~~~~~~~~~~~~~   68 (480)
T Consensus         1 ~~l~~a~~gL~a~q~al~~~~~NIANant~GY~Rq~a~~~~~~~~~~~~~~~~~~~~~G~GV~v~~i~R~~d~~l~~q~~   80 (495)
T TIGR02492         1 SLLNIAKSGLSASQIALSVTSNNIANANTPGYSRQRAELTASPAGGQGLNATEGGLQIGTGVKVTSIRRIQDQFLDNQLR   80 (495)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEEEHHHHHHHHHHH
T ss_conf             94789999999999999987436224679896046677503334321110001466555646986554415489999998


Q ss_pred             HHHHHH-HHHHHHHHHHHHH-HHHCCCCCCCC-CCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             544455-6788787899888-65126777776-40113667776687641386753001122101222222100022456
Q gi|254780524|r   69 AHSSAI-GQQRLLQSFEALK-EMMSADDHYNN-SPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREV  145 (480)
Q Consensus        69 ~~~~~~-~~~~~~~~~~~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (480)
T Consensus        81 ~~~s~~~~~~~~~~~~l~~~e~~~~~~~~~~~~sl~~~L~~Ff~al~~l~~~P~~~~~r~~~~~~~~~la~~~n~~~~~L  160 (495)
T TIGR02492        81 RANSSAGGYADSRASSLSKIEQIFNDTDESGLGSLSTDLNNFFNALQELAKNPDSEALRQAVLESAQALANQFNQTSSEL  160 (495)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87755678999999999999986168887754462889989999999997087887899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC---CCCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCCEEEEECC
Q ss_conf             566543200011127878875434321011222345---66765210012100001010020124787337711478706
Q gi|254780524|r  146 QKIRADADKEIELEISNLRRFLSELTVVNDAIKFKT---ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS  222 (480)
Q Consensus       146 ~~~~~~~~~~~~~~v~~~n~~~~~~~~~n~~~~~~~---~~~~~~~~~~d~~~~~~~~~s~~~~~~~~~~~~~~~~v~~~  222 (480)
T Consensus       161 ~~~~~~~~~~i~~~V~~iN~l~~~ia~~N~~I~~~~g~~~~g~~andL~DqRD~ll~~Ls~~~~i~~~~~~~G~~~v~~~  240 (495)
T TIGR02492       161 TDLQKNINAEIKSAVTEINSLLKQIASLNKEIQQVEGGKASGQDANDLLDQRDLLLKELSQLIGISVSENEDGTVNVYTG  240 (495)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCCEEEEEC
T ss_conf             99997565578899999999999999876886400278778777677874499999998867260378826885688873


Q ss_pred             CCEEEECC------CCCEEEE-EECCCCCCCCCCCEEEECCC-----CCCCCC-CCCCCCCCCCCCHHHC--------CC
Q ss_conf             97061034------4412576-30456667664321673365-----566567-7666765311101110--------23
Q gi|254780524|r  223 DGTTLFET------VPRDINF-EKMNSYTVTSESNPIFIDGV-----VVSSNQ-GSAVPKGKIKALLQIR--------DS  281 (480)
Q Consensus       223 ~g~~l~~~------~~~~~~~-~~~~~~~~~~~~~~~~~~~~-----~~~~~~-~~~~~~g~~~~~~~~~--------~~  281 (480)
T Consensus       241 ~G~~Lv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~l~gl~~~r~~~S~~~~~~  320 (495)
T TIGR02492       241 SGQVLVDGYDLNKSLAATVTGLSSTSPLTADTAGSKVGLQGVYLPSGSSKVTISSDKLQGGKLGGLLDLRINDSEGKEDG  320 (495)
T ss_pred             CCEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCC
T ss_conf             77212022023433203465454421000112344201002102566521001100002550444543431023666443


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             31367787887655431001234557777776543211223456666543322222233333466621000245666655
Q gi|254780524|r  282 VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKF  361 (480)
Q Consensus       282 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  361 (480)
T Consensus       321 ~~~~~~~~lD~~A~~la~~~n~~~~~G~~~~~~~-~~~~-~~S-~s~~~~~~~~~~~~~~------------------~~  379 (495)
T TIGR02492       321 VLPDLQSQLDQLAKTLANEVNEVHQSGADLTGNA-KDLF-ATS-LSSGDAEEIAAAAKGP------------------GG  379 (495)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCCC-CHH-HHHCCHHHHHHCCCCC------------------CC
T ss_conf             0689999999999999999887763353457764-2001-112-3202235543101355------------------64


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             55666544310245676642011112333345677652899998777887664211123223456799999998876628
Q gi|254780524|r  362 LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVG  441 (480)
Q Consensus       362 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~t~~sg~~~~~~~~~~~~g~i~~~~lE~SN  441 (480)
T Consensus       380 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~s~~g~~~~~a~~~~~~~~~~l~~~~~~~~s~sG  458 (495)
T TIGR02492       380 DVK-AAGDGDNDNALNLINLLFDKLTGLGATTGIGNESLDDFYASLVSQIGSDASQAESALEAQEALLNQLQEARSSISG  458 (495)
T ss_pred             CCC-CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             100-3789874113445565544311332212455443899998877899999999888888899999999998876416


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8889999999999999999999999999999999874
Q gi|254780524|r  442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG  478 (480)
Q Consensus       442 VDL~eE~tnLI~~QraYqANakvItT~Demlq~Lin~  478 (480)
T Consensus       459 Vs~DEE~~~l~~~Q~~Y~A~ak~i~t~d~m~d~LL~~  495 (495)
T TIGR02492       459 VSLDEEMANLIQYQKAYQASAKVISTVDEMLDSLLNL  495 (495)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             6799999999999988999999999999999999639