HHsearch results for GI: 254780524 and protein with PDBid: 3a69_A

>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}
Probab=100.00  E-value=0  Score=321.85  Aligned_cols=115  Identities=14%  Similarity=0.036  Sum_probs=88.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEC------CCCEEEEEEEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999867874420257899812679998604------660699899872068878887754445567887
Q gi|254780524|r    6 VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRL   79 (480)
Q Consensus         6 sl~~~~SGL~a~q~~ldvisnNIANvnT~Gyk~~~~~f~~~------~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (480)
                      |||+|+|||+|||++|+||||||||+||+||||+|++|+++      +.||.+..++|+   +.++.+..+...++.++.
T Consensus         1 s~~~a~sGl~A~q~al~vts~NIANaNT~GYsRq~v~f~~~~~~~~~G~GV~v~~v~r~---~~qg~~~~t~~~~d~ai~   77 (402)
T 3a69_A            1 SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQD---FTDGTTTNTGRGLDVAIS   77 (402)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHC-------------------------------------------------CEECCCS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHCCCCCCCCEEEEEEEEE---CCCCCEEECCCCCHHEEC
T ss_conf             97899999999997357888889877764206570207776466877674477678984---145645764760030142


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             87899888651267777764011366777668764138675300112210
Q gi|254780524|r   80 LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVID  129 (480)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (480)
                      +.+||...      ......+++|.+.|..+..+.+.++.+..+.++...
T Consensus        78 ~~g~f~~~------~~~g~~~~tr~g~~~~~~~g~lvn~~g~~l~g~~~~  121 (402)
T 3a69_A           78 QNGFFRLV------DSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPAT  121 (402)
T ss_dssp             SSCEEEEE------CTTCCEEEESCCEEEECTTSCEECTTCCEEEEEECB
T ss_pred             CCCEEEEE------CCCCCEEEEECCCCCCCCCCCEECCCCCEEECCCCC
T ss_conf             78617886------279864364156534278887863789644123145