BLAST/PSIBLAST alignment of GI: 254780524 and GI: 241113583 at iteration 1
>gi|241113583|ref|YP_002973418.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 486
>gi|240861791|gb|ACS59457.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 486
 Score =  319 bits (818), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 178/489 (36%), Positives = 277/489 (56%), Gaps = 18/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I NN  QQ + I  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNSVQSIFNNTGQQSSVISTNIANVGNSDYVRREASVTTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L  ++    QQ L+   E+LK ++  +D Y  SP+ Y++  + +L+++  + S
Sbjct: 61  TALLAQYLQTNAKDSAQQTLVTGLESLKSLVGGND-YETSPSTYLTAFQQALQTFGTSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A+++  + NT++  VQ IRA+AD EI  ++S L   LS+    N+A+K 
Sbjct: 120 STTAAQSAVTAAQDLANSLNTASDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+ LL++IS I+G+++ VR+NNDM +YTSDGT LFET+PR + F  
Sbjct: 180 ATATGTDTSSALDEREKLLKQISSIVGVTSTVRDNNDMALYTSDGTVLFETIPRTVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ QLDE+A+ L+
Sbjct: 240 TATYVAGTEGNSIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQAQLDEIAKSLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI------ADGIKDLDNKLCQGISETICVN----PQYRSNP 348
             FSE D     S + PGLF+      A G     +    GI+ TI VN         + 
Sbjct: 300 QIFSETD----GSTSAPGLFVWTTASGATGATPAASDDTTGIASTISVNLAVVTSEGGDA 355

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + LRD GS+S     N    +G+ D ++    +  +   F   AG++T+ +L +YA  SI
Sbjct: 356 TKLRD-GSISGITDLNTAGDSGFSDNLDALYQALTEQRSFSSDAGLSTSQSLTDYASASI 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   
Sbjct: 415 GWLEQYRSDATSASETTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKILNVI 474

Query: 469 DKMLQTLLE 477
           D+M Q+LL+
Sbjct: 475 DEMFQSLLD 483