BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780524|ref|YP_003064937.1| flagellar hook-associated
protein FlgK [Candidatus Liberibacter asiaticus str. psy62]
         (480 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040201|gb|ACT56997.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 480

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/480 (100%), Positives = 480/480 (100%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK
Sbjct: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE
Sbjct: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK
Sbjct: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM
Sbjct: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS
Sbjct: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
           FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK
Sbjct: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
           FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD
Sbjct: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
Sbjct: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480


>gi|315122285|ref|YP_004062774.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495687|gb|ADR52286.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 481

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 397/481 (82%), Gaps = 1/481 (0%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL AVFNKAQNI +NAS+QF +IV+NIEN+ NKNYVR+D +T  + +    V QRSEN+
Sbjct: 1   MSLSAVFNKAQNIFSNASEQFFTIVKNIENSGNKNYVRQDIITVNTGDMTVAVKQRSENQ 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           NMF+K+L A SSAIGQQRLL+SFE+LK++M A++ YNNSP+HY++KLRDSL  YS N S 
Sbjct: 61  NMFEKLLDAKSSAIGQQRLLESFESLKDIMGAENKYNNSPSHYMAKLRDSLSVYSNNPST 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           DI GK +I +A  +V N NTS++E+QKIRA ADKEI++E+S LR FLSELTVVND IKFK
Sbjct: 121 DIFGKQIISDANALVYNLNTSSKEIQKIRAGADKEIDIEVSKLRGFLSELTVVNDQIKFK 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +KHD H+ LD+RD LLQ ISE IGISTI+RNNND+++YTSDGTTLFETVPR+INFEKM
Sbjct: 181 TVAKHDTHELLDKRDALLQNISEEIGISTIIRNNNDIIIYTSDGTTLFETVPRNINFEKM 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + Y+ TSES  + IDGV VS  +Q    PKG+IKALL IRD+V+P+FQNQLDE++R LI 
Sbjct: 241 DLYSATSESKSVVIDGVKVSIPDQTHTAPKGRIKALLHIRDNVIPMFQNQLDEISRSLIS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            FSEKDP+AG S++V GLFIADG+KD  NKL +G+SE I VNPQY+SNP FLRDGGSVSK
Sbjct: 301 GFSEKDPVAGRSQDVLGLFIADGLKDPGNKLYKGMSEIIRVNPQYQSNPFFLRDGGSVSK 360

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             LWNVK  A Y  LINHYCDSFN  F FD   GI TNV+LLEYA+NSIGWLEKNRS SH
Sbjct: 361 NHLWNVKGFAEYSGLINHYCDSFNAMFSFDSATGIGTNVSLLEYAKNSIGWLEKNRSTSH 420

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           D  MK+QVVFNHISESYSNT GVNLQ+ELSFLIKVEQSYNISNKL+M  ++ML TLLEG+
Sbjct: 421 DSRMKNQVVFNHISESYSNTTGVNLQDELSFLIKVEQSYNISNKLMMSINRMLNTLLEGI 480

Query: 480 K 480
           K
Sbjct: 481 K 481


>gi|222147590|ref|YP_002548547.1| flagellar hook-associated protein FlgK [Agrobacterium vitis S4]
 gi|221734578|gb|ACM35541.1| flagellar-associated protein [Agrobacterium vitis S4]
          Length = 484

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 187/484 (38%), Positives = 279/484 (57%), Gaps = 9/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-TISPENVTVVTQRSEN 59
           MSL +  N A     N+S Q   + +NI N+  + YV+RD  T + S     VVT RSE+
Sbjct: 1   MSLSSTMNTATTSLGNSSTQSQVLSKNIANSQTEGYVKRDAATISTSTGGAQVVTTRSED 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  ++L   S A GQ  L    + LK ++  +D Y +SP+ YI+KLRD+++SY+   S
Sbjct: 61  AVLQKQMLSGQSQAEGQDTLNTGLDQLKALLGGND-YESSPSTYINKLRDAMQSYAAQPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           E  L +T +  A++V  + N +A  +  +RA AD  I+ ++S L   LS+   VN ++  
Sbjct: 120 ELSLAETAVSAAQDVATSINNTAEGISNVRAQADDAIKDDVSKLNDLLSQFETVNQSVVK 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+ +D +D LDQRD L+  IS+I+G+S++ R+NNDM +YT+DGT LF+  PR + F+ 
Sbjct: 180 ATATGNDPNDALDQRDKLVSDISKIVGVSSVKRDNNDMALYTNDGTVLFDKQPRTVTFDS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y  ++E N ++IDGV V +  G     +G I A LQIRDS+ P  Q QLDE +R LI
Sbjct: 240 TGAYGASTEGNSVYIDGVPVKAGTGGNTTAEGSIAANLQIRDSIAPQMQQQLDETSRSLI 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             FSE +P   +++ +PGLF   +G    D  L  GISE+  VN  Y      +P+ LRD
Sbjct: 300 KMFSETEPSTKDND-MPGLFTWEEGTTPEDGTLVSGISESFKVNSAYVTAEDGDPTLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + WN      Y +L++ +   F     FD  AG+     +L+YA NS+GWLE 
Sbjct: 359 GGANGSNYTWNTTEGVSYSELLDDFVTGFEDKMDFDSSAGLGDTSNVLDYASNSVGWLES 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            RS +   +     +    +E+Y N  GVNL EELS ++ +EQSY  S KL+   D+ML+
Sbjct: 419 YRSTADSANETKSALSQRATEAYQNKTGVNLDEELSKMLDIEQSYKASTKLMNAVDEMLK 478

Query: 474 TLLE 477
           +LLE
Sbjct: 479 SLLE 482


>gi|222084886|ref|YP_002543415.1| flagellar hook-associated protein [Agrobacterium radiobacter K84]
 gi|221722334|gb|ACM25490.1| flagellar hook-associated protein [Agrobacterium radiobacter K84]
          Length = 491

 Score =  327 bits (837), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 171/490 (34%), Positives = 272/490 (55%), Gaps = 15/490 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N AQ I NN+  Q + +  NI NA N +Y RR  M T       VV     N+
Sbjct: 1   MSLTTALNNAQAIFNNSGTQSSVVSNNIANAGNTDYSRRQAMLTTDMSGAQVVKIARANE 60

Query: 61  NMFDKV-LHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
               K  L + SS   QQ LL+++ +L+      +    +P  Y+S L+ ++++Y+ + S
Sbjct: 61  PALQKTFLSSTSSDAAQQSLLKAYTSLQSATLGGNDNEVAPATYLSNLQTAMQTYASSPS 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ ++ A+ +    N +   VQ +R DADK+I  ++  L   L++    NDA+K 
Sbjct: 121 SSTAAQSAVNAAQSLATALNNATTAVQSVRTDADKQIASDVDTLNGLLNQFQTANDAVKS 180

Query: 180 KTASKHDAH----DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            TA+         D LDQRD +L++IS+I+G++T+ R+NND+ +YT+ G TLFET+PR +
Sbjct: 181 ATAASSPTSTTLSDALDQRDSILKQISQIVGVTTVTRDNNDVALYTTGGATLFETIPRSV 240

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            F    SYT +   N ++IDGV +++ QG S   +G ++A LQ+RD V P +Q QLDE+A
Sbjct: 241 TFTPTTSYTASISGNNVYIDGVALTAGQGASTTAQGSLQASLQVRDDVAPTYQKQLDEIA 300

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQY------RSN 347
           R L+ +F+E +    +S   PGLF   G    D+  +  G++ +I VNP          +
Sbjct: 301 RGLVTTFAETNQT--DSTTAPGLFTWSGGTVPDSATVVTGMAGSIAVNPALLTTSTQTGD 358

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
           P+ LRDGG     ++ N    +GY D ++ Y    +    FDP AG + + +L++YA +S
Sbjct: 359 PTLLRDGGINGSDYVVNTTGASGYSDQLDAYITGMSTKMDFDPTAGSDASASLMDYASSS 418

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           IGWLE  RS +      +    +  S +YSN  GVNL EEL+ ++ +EQSY    K++  
Sbjct: 419 IGWLEGQRSTATTAAENTSAALSRSSTAYSNETGVNLDEELTLMMDIEQSYKAGTKILNA 478

Query: 468 TDKMLQTLLE 477
            ++MLQ++L+
Sbjct: 479 VNEMLQSVLD 488


>gi|163758033|ref|ZP_02165121.1| hypothetical protein HPDFL43_00370 [Hoeflea phototrophica DFL-43]
 gi|162284322|gb|EDQ34605.1| hypothetical protein HPDFL43_00370 [Hoeflea phototrophica DFL-43]
          Length = 487

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 183/488 (37%), Positives = 278/488 (56%), Gaps = 9/488 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL    N AQ   +N S Q   + RNI NA N +Y RR+   + +     VV+ QR+++
Sbjct: 1   MSLTTAINTAQTSLSNTSTQTNIVSRNIANASNPDYNRRNAALSTNVYGAQVVSIQRAQD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +F + + + SS+ GQQ LL     LK +   +D Y  SP   +  LRD+L +++    
Sbjct: 61  QALFQQSIKSASSSSGQQSLLTGLTTLKGIFGGND-YEQSPAALLGTLRDTLSTFAAQPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           E+ L ++ I +A+ +       +  VQ++R DAD+EI+ E+ NL   LS     N+ +  
Sbjct: 120 ENTLAQSTIADAQILAAGLRDGSAAVQRVRLDADQEIQREVDNLNELLSRFETANNNVYQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T ++ D    LD RD LL++IS+IIG++ I R+ NDM +YTSDGTTLFETV R + F+ 
Sbjct: 180 GTQARRDVSAHLDDRDSLLKQISQIIGVTPITRSGNDMALYTSDGTTLFETVARPVTFDS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              ++ T + N +++DGV + + QG S+  KG I+ LLQIRD + P  Q QLDE+AR L+
Sbjct: 240 SAGFSATIQGNGVYVDGVPLPAGQGSSSTAKGTIQGLLQIRDDIAPKLQTQLDEIARALV 299

Query: 299 GSFSEKDPIAGNS-ENVPGLFI-ADGIKDLDNKLCQGISETICVN----PQYRSNPSFLR 352
            SF+E D  A  +  + PGLF  + G     + L  GIS TI VN    P    +P  LR
Sbjct: 300 VSFAETDQSATPTLPDEPGLFTWSGGTVPAGSTLVPGISATITVNPALVPSLGGDPKLLR 359

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DGG     +  N    A +   ++ +  + +    FD  AG++T+ +LL++A +SIGWLE
Sbjct: 360 DGGINGAAYNANPAGAASFSAQLDSFVVAIDNPTGFDATAGLSTSTSLLDFAADSIGWLE 419

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            NRS++       +       E+YSN  GV++ EE+S L+++EQSY  S +LI   D+ML
Sbjct: 420 LNRSEADSAAQTREAFMFRAEEAYSNDTGVSIDEEMSMLLELEQSYKASARLISAVDEML 479

Query: 473 QTLLEGVK 480
           Q L+  V+
Sbjct: 480 QALMSVVR 487


>gi|86356331|ref|YP_468223.1| flagellar hook-associated protein FlgK [Rhizobium etli CFN 42]
 gi|86280433|gb|ABC89496.1| flagellar hook-associated protein [Rhizobium etli CFN 42]
          Length = 495

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 184/494 (37%), Positives = 279/494 (56%), Gaps = 19/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQNI NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L + S    QQ LL   E LK +M  +D Y  SP+ Y+   +  L+++  +  
Sbjct: 61  DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGND-YETSPSTYLGVFQQKLQAFRTSPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA+ADKEI   +  L   LSE    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQDVRANADKEIATAVDTLNTLLSEFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+ +L++IS+I+G+S   R+NNDMV+ T DGT LFET+PR + F+ 
Sbjct: 180 ATATGADTSGALDEREKVLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFKS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + YT T+  N ++IDGV +   +GS    +G +++LLQIRD + P FQ QLDE AR L+
Sbjct: 240 QDIYTATTVGNSVYIDGVALPLGKGSTTTGQGSLQSLLQIRDEIAPNFQKQLDETARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             F E++  AG    VPGLF  + G  D       G++ TI V+ +       +P  LRD
Sbjct: 300 SLFKEQN-TAGPPAYVPGLFTWSGGTVDTGATAVAGMASTITVSTRVITSQGGDPMRLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEY 403
           GG  +   + N   ++GY   ++    +   +  FDP A          GI++NV+++EY
Sbjct: 359 GGVNAAGVVLNTSGVSGYTAELDRLYTAMTSDMDFDPAAGAPVGFDATTGIDSNVSIMEY 418

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K
Sbjct: 419 ATNSLGWLEQYRSNATTAAENTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATK 478

Query: 464 LIMFTDKMLQTLLE 477
           ++   D+ML++LL+
Sbjct: 479 ILNAVDEMLKSLLD 492


>gi|241203125|ref|YP_002974221.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857015|gb|ACS54682.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 495

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 180/494 (36%), Positives = 279/494 (56%), Gaps = 19/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQNI NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L   S    QQ LL   E LK ++  +D Y  SP+ Y+   +  L+++     
Sbjct: 61  EALLRQYLKTSSQDSAQQALLGGLEDLKSIVGGND-YETSPSTYLGVFQQKLQAFRTTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   L++    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKLNTLLNDFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TAS  DA   LD+R+  L++IS+I+G++T  R+NNDMV+ TSDGT LFET+PR + F+ 
Sbjct: 180 ATASGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTSDGTILFETIPRKVTFKS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + YT T   N +++DGV +    GS    +G +++LLQ+RD + P FQ QLDE+AR L+
Sbjct: 240 QDVYTATITGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRDEIAPNFQKQLDEVARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             F E++  AG +  VPGLF  + G  D       G++ TI V+ +       +P  LRD
Sbjct: 300 SLFKEQNTAAGPAY-VPGLFTWSGGTVDTGATAVAGMAATITVSSRVITSQGGDPMRLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEY 403
           GG  +   + N    +GY   ++    +   +  FDP A          GI++NV+++E+
Sbjct: 359 GGVNATGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGTPVGFDATTGIDSNVSIMEF 418

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K
Sbjct: 419 ATNSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATK 478

Query: 464 LIMFTDKMLQTLLE 477
           ++   D+ML++LL+
Sbjct: 479 ILNAVDEMLKSLLD 492


>gi|325291963|ref|YP_004277827.1| flagellar hook-associated protein FlgK [Agrobacterium sp. H13-3]
 gi|325059816|gb|ADY63507.1| flagellar hook-associated protein FlgK [Agrobacterium sp. H13-3]
          Length = 492

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 177/495 (35%), Positives = 278/495 (56%), Gaps = 18/495 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM--TTISPENVTVVTQRSE 58
           MSL +  N AQ+I NN  +Q     +NI N  N NYV+R  +  TT+S  ++ V   R++
Sbjct: 1   MSLTSAMNTAQSIFNNTGKQTDVTSKNIANVGNANYVKRTAILGTTMSGASI-VANGRAQ 59

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           N+++  + + + S A GQ+ +L   E +K +   +D Y +SP  Y+ +L  SL+ Y+   
Sbjct: 60  NESLLRQTISSASLASGQKTVLTGLEEMKSLFGGND-YESSPATYMKELLKSLDGYASKP 118

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           S+  L  T + +A +V  + N ++ E+Q +R  ADKE+ L++  L   L++    N+ +K
Sbjct: 119 SDSALAATAVTSAVDVANSLNKASSELQAMRLRADKEMSLQVDKLNGLLAKFEEANNEVK 178

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
            +TA   +  D LDQR+ LL+ IS IIGI+ + R NND+ +YT+DG TLFE VPR + F+
Sbjct: 179 AQTAIGGNPSDALDQRETLLKDISSIIGINVVNRENNDVALYTADGATLFEVVPRKVTFK 238

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
               Y  T   N I++DGV + ++ GS    +G ++ L+Q+RD + P  Q+QLDE+AR L
Sbjct: 239 AQPGYDATVTGNAIYVDGVAIKASSGSNTTAEGSLQGLMQVRDDLAPTMQSQLDEIARGL 298

Query: 298 IGSFSEKDPIAGNS--ENVPGLFI----ADGIKDLDNKLCQGISETICVNPQY----RSN 347
           I  F+EK P +  S    +PGLF     A         +  G++ +I VNP        N
Sbjct: 299 ITMFAEK-PASPTSTLPKMPGLFTYGSPAATTIPASGVVSPGLAASITVNPALIISKGGN 357

Query: 348 PSFLRDGGSVSKKFLWN--VKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
           P  LRDGG     ++ N       G+  LI+ Y  +F+    F     I+TN ++L+Y  
Sbjct: 358 PELLRDGGINGTAYVINSTTSGGTGFSALIDSYVTAFDAPMNFAASTRIDTNTSILKYGT 417

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS +   +     ++   + SYSN   V+L EELS L+ +EQSY  + KL+
Sbjct: 418 NSVGWLEQERSGATSANEAKSALYERSATSYSNNTAVSLDEELSLLMDIEQSYKAATKLV 477

Query: 466 MFTDKMLQTLLEGVK 480
              D ML++L++ V+
Sbjct: 478 TTIDDMLKSLMDMVR 492


>gi|209547947|ref|YP_002279864.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533703|gb|ACI53638.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 495

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 183/494 (37%), Positives = 276/494 (55%), Gaps = 19/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQNI NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L   S    QQ LL   E LK +M  +D Y  SP+ Y+   +  L+++     
Sbjct: 61  DALLRQYLKTSSQDSAQQALLGGLEDLKSIMGGND-YETSPSTYLGVFQQKLQAFRTTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   LS+    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQDVRATADKQIATDVDKLNTLLSDFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TAS  DA   LD+R+  L++IS+I+G++   R+NNDMV+ T+DGT LFET+PR + F+ 
Sbjct: 180 ATASGADASGALDEREKALKQISQIVGVNATTRDNNDMVLSTTDGTILFETIPRKVTFKS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + Y  T   N ++IDGV ++   GS    +G +++LLQ+RD + P FQ QLDE+AR L+
Sbjct: 240 QDVYNATITGNSVYIDGVALARGSGSTTTAQGSLQSLLQVRDEIAPNFQKQLDEVARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             F E++  AG    VPGLF  + G  D       G++ TI V+ +       +P  LRD
Sbjct: 300 SLFKEQN-TAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTITVSSRVITSQGGDPMRLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEY 403
           GG      + N   L+GY   ++    +   +  FDP A          GI++NV+++EY
Sbjct: 359 GGINVNGVVLNPTGLSGYTTELDRLYTALGSDIDFDPAAGPAVGFDATTGIDSNVSIMEY 418

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A NS+GWLE+ RS++      S    +   E+YSN  GVNL EEL+ L+ +EQSY  + K
Sbjct: 419 ATNSLGWLEQYRSNATTAAENSSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATK 478

Query: 464 LIMFTDKMLQTLLE 477
           ++   D+ML++LL+
Sbjct: 479 ILNAVDEMLKSLLD 492


>gi|241113583|ref|YP_002973418.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861791|gb|ACS59457.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 486

 Score =  319 bits (818), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 178/489 (36%), Positives = 277/489 (56%), Gaps = 18/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I NN  QQ + I  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNSVQSIFNNTGQQSSVISTNIANVGNSDYVRREASVTTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L  ++    QQ L+   E+LK ++  +D Y  SP+ Y++  + +L+++  + S
Sbjct: 61  TALLAQYLQTNAKDSAQQTLVTGLESLKSLVGGND-YETSPSTYLTAFQQALQTFGTSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A+++  + NT++  VQ IRA+AD EI  ++S L   LS+    N+A+K 
Sbjct: 120 STTAAQSAVTAAQDLANSLNTASDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+ LL++IS I+G+++ VR+NNDM +YTSDGT LFET+PR + F  
Sbjct: 180 ATATGTDTSSALDEREKLLKQISSIVGVTSTVRDNNDMALYTSDGTVLFETIPRTVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ QLDE+A+ L+
Sbjct: 240 TATYVAGTEGNSIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQAQLDEIAKSLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI------ADGIKDLDNKLCQGISETICVN----PQYRSNP 348
             FSE D     S + PGLF+      A G     +    GI+ TI VN         + 
Sbjct: 300 QIFSETD----GSTSAPGLFVWTTASGATGATPAASDDTTGIASTISVNLAVVTSEGGDA 355

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + LRD GS+S     N    +G+ D ++    +  +   F   AG++T+ +L +YA  SI
Sbjct: 356 TKLRD-GSISGITDLNTAGDSGFSDNLDALYQALTEQRSFSSDAGLSTSQSLTDYASASI 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   
Sbjct: 415 GWLEQYRSDATSASETTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKILNVI 474

Query: 469 DKMLQTLLE 477
           D+M Q+LL+
Sbjct: 475 DEMFQSLLD 483


>gi|116250501|ref|YP_766339.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255149|emb|CAK06223.1| hook associated protein i homolog (agr_c_1014p) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 495

 Score =  319 bits (817), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 179/494 (36%), Positives = 280/494 (56%), Gaps = 19/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L   S    QQ LL   E LK ++  +D Y  SP+ Y+   +  L+++     
Sbjct: 61  EALLRQYLKTSSQDSAQQTLLSGLEDLKSIVGGND-YETSPSTYLGVFQQKLQAFRTTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   LS+    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKLNTLLSDFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T+S  DA   LD+R+  L++IS+I+G++T  R+NNDMV+ TSDGT LFET+PR++ F+ 
Sbjct: 180 ATSSGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTSDGTILFETIPREVTFKS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + YT T   N +++DGV +    GS    +G +++LLQ+RD + P FQ QLDE+AR L+
Sbjct: 240 QDVYTATIAGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRDEIAPNFQKQLDEVARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             F E++ +AG +  VPGLF  + G  D       G++ TI V+ +       +P  LRD
Sbjct: 300 SLFKEQNTVAGPAY-VPGLFTWSGGTVDTGATAVAGMAATITVSSRVITSQGGDPMRLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEY 403
           GG      + N    +GY   ++    +   +  FDP A          GI++NV+++E+
Sbjct: 359 GGINLTGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGTPVGFDATTGIDSNVSIMEF 418

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K
Sbjct: 419 ATNSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATK 478

Query: 464 LIMFTDKMLQTLLE 477
           ++   D+ML++LL+
Sbjct: 479 ILNAVDEMLKSLLD 492


>gi|15887920|ref|NP_353601.1| flagellar hook-associated protein FlgK [Agrobacterium tumefaciens
           str. C58]
 gi|15155516|gb|AAK86386.1| flagellar hook associated protein [Agrobacterium tumefaciens str.
           C58]
          Length = 492

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 177/494 (35%), Positives = 280/494 (56%), Gaps = 16/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQ-RSEN 59
           MSL +  N AQ+I NN  +Q     +NI N  N NYV+R  +   +    ++V+  R++N
Sbjct: 1   MSLTSAMNTAQSIFNNTGKQTDVTSKNIANVGNANYVKRTAILGTTMAGASIVSNGRAQN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           +++  + + + S A GQ  +L   E +K +   + +Y +SP +Y+ +L  SL+ Y+   S
Sbjct: 61  ESLLRQTISSSSLASGQSSVLSGLEEIKSIFGGN-NYESSPANYMKELLKSLDGYAAKPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +  L  T + +A +V  + N ++ E+Q +R  ADKE+ L++  L   L++    N+ +K 
Sbjct: 120 DAALAATAVTSASDVASSLNNASSELQGMRLRADKEMSLQVDKLNGLLAKFEEANNEVKA 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +TA   DA D LDQR+ LL+ IS I+GI+ + R NND+ +YT+DG TLFE VPR + F+ 
Sbjct: 180 QTAIGGDASDALDQRETLLKDISSIVGINVVNRPNNDVALYTTDGATLFEIVPRSVTFKT 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              Y  T+  N I+IDGV + +  G+     G ++ L+Q+RD + P  Q+QLDE+AR LI
Sbjct: 240 QPGYDATTTGNAIYIDGVALKAGTGTNTTAAGSLQGLMQVRDDLAPTMQSQLDEIARGLI 299

Query: 299 GSFSEK--DPIAGNSENVPGLFI----ADGIKDLDNKLCQGISETICVNPQY----RSNP 348
             F+EK  DP +G   N+PGLF     A      D  +  G++ +I VNP        NP
Sbjct: 300 TMFAEKPADPTSG-LPNMPGLFTYGSPAATTIPPDGVVSPGLAASITVNPALIISKGGNP 358

Query: 349 SFLRDGGSVSKKFLWNVKNLA--GYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
             LRDGG     ++ N       G+  LI  Y  +F+    F     I+TN ++L+Y  N
Sbjct: 359 ELLRDGGINGTDYVINTATSGGTGFSALIRSYVTAFDAPMNFAASTRIDTNTSILKYGTN 418

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
           S+GWLE+ RS +   +     ++   ++SYSN   V+L EELS L+ +EQSY  + KL+ 
Sbjct: 419 SMGWLEQERSGATSANEAKGALYERSAKSYSNNTAVSLDEELSLLMDIEQSYKAATKLVT 478

Query: 467 FTDKMLQTLLEGVK 480
             D+ML++L++ V+
Sbjct: 479 TVDEMLKSLMDMVR 492


>gi|116248739|ref|YP_764580.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253389|emb|CAK11777.1| putative flagellar hook-associated protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 486

 Score =  316 bits (810), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 176/489 (35%), Positives = 277/489 (56%), Gaps = 18/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I N   QQ + I  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNNVQSIFNTTGQQSSVISTNIANVGNSDYVRREASVTTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L  ++    QQ L+   E+LK ++  +D Y  SP+ Y++  + +L+++  + S
Sbjct: 61  TALLAQYLQTNAKDSAQQTLVTGLESLKSLVGGND-YETSPSTYLTAFQQALQTFGTSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A+++  + NT++  VQ IRA+AD EI  ++S L   LS+    N+A+K 
Sbjct: 120 STTAAQSAVTAAQDLANSLNTASDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T++  D    LD+R+ LL++IS I+G+++ VR+NNDM +YTSDGT LFET+PR + F  
Sbjct: 180 ATSTGTDTSSALDEREKLLKQISSIVGVTSTVRDNNDMALYTSDGTVLFETIPRTVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ QLDE+A+ L+
Sbjct: 240 TATYVAGTEGNSIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQAQLDEIAKSLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI------ADGIKDLDNKLCQGISETICVN----PQYRSNP 348
             FSE D     S + PGLF+      A G     +    GI+ TI VN         + 
Sbjct: 300 QIFSETD----GSTSAPGLFVWTTASGATGATPAASDDATGIASTISVNLAVVTSEGGDA 355

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + LRD GS+S     N    +G+ D ++   ++  +   F   AG++T+ +L +YA  SI
Sbjct: 356 TKLRD-GSISGITDLNTSGDSGFSDNLDALYEALTEQRSFSSDAGLSTSQSLTDYASASI 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   
Sbjct: 415 GWLEQYRSDATSASETTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKILNVI 474

Query: 469 DKMLQTLLE 477
           D+M Q+LL+
Sbjct: 475 DEMFQSLLD 483


>gi|209547529|ref|YP_002279447.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538773|gb|ACI58707.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 486

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 179/489 (36%), Positives = 281/489 (57%), Gaps = 18/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I NN  QQ + +  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSGLNSVQSIFNNTGQQSSVVSTNIANVGNSDYVRREASITTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L ++S    QQ L+   E+LK +M  +D Y  SP+ Y+S  + +L++++ + S
Sbjct: 61  TALLAQYLQSNSKDSAQQTLVTGLESLKSLMGGND-YETSPSTYLSAFQQALQTFATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A ++  + NT++  VQ IRADAD EI  ++S+L   LS+    N+A+K 
Sbjct: 120 STTAAQSAVTAARDLANSLNTASDGVQSIRADADAEIATQVSSLNTLLSQFETANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+ LL++IS I+G++T VR+NNDM +YTSDGT LFETVPR + +  
Sbjct: 180 ATATGADTSSALDEREKLLKQISSIVGVTTAVRDNNDMALYTSDGTVLFETVPRTVTYVP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y   +E N ++IDGV + + +GS     G ++ALLQ+RD + P FQ QLDE+A+ L+
Sbjct: 240 TTTYVAGTEGNSVYIDGVALDAGEGSTTSASGGLQALLQLRDDIAPTFQAQLDEIAKSLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI------ADGIKDLDNKLCQGISETICVN----PQYRSNP 348
            +FSE D     S + PGLF+        G    D+    GI+ +I VN         + 
Sbjct: 300 QAFSETD----GSTSAPGLFVWTTASGTSGGTPSDSDDITGIASSISVNLAVVTSEGGDA 355

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + LRD G++S     N    +G+ D ++    +  K   F   AG++T  +L++YA +SI
Sbjct: 356 TKLRD-GTISGITDLNSAGDSGFSDNLDALYTALTKQRSFSSDAGLSTTQSLMDYASSSI 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   
Sbjct: 415 GWLEQYRSDATSASENTTAALSRSDEAYSNEAGVNLDEELTLLLDIEQSYKAATKILNVI 474

Query: 469 DKMLQTLLE 477
           D+M ++LL+
Sbjct: 475 DEMFKSLLD 483


>gi|327192295|gb|EGE59260.1| flagellar hook-associated protein FlgK [Rhizobium etli CNPAF512]
          Length = 486

 Score =  314 bits (804), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 175/489 (35%), Positives = 281/489 (57%), Gaps = 18/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I N   QQ + I  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNSVQSIFNTTGQQSSVISTNIANVGNSDYVRREASITTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L +++    QQ L+   E+LK ++  +D Y  SP+ Y+S  + +L++++ + S
Sbjct: 61  TALLAQYLQSNAKDSAQQTLVTGLESLKSLVGGND-YETSPSTYLSAFQQALQTFATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A+++  + NT++  VQ IR +AD EI  ++S+L   LS+    N+A+K 
Sbjct: 120 STTSAQSAVTAAQDLANSLNTASDGVQSIRTEADAEIATQVSSLNTLLSQFETANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+ LL++IS I+G++++VR+NNDM +YTSDGT LFETVPR + F  
Sbjct: 180 ATATGADTSSALDEREKLLKQISSIVGVTSVVRDNNDMALYTSDGTVLFETVPRTVTFVP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ+QLD++A+ L+
Sbjct: 240 TTTYVAGTEGNAIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQDQLDQIAKALV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI---ADGIKD---LDNKLCQGISETICVN----PQYRSNP 348
             FSE D     S + PGLF+   A G       ++    GI+ TI VN         + 
Sbjct: 300 QVFSETD----GSTSAPGLFVWTTASGTAGETPSESDDITGIASTISVNLAVVTSEGGDA 355

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + LRD G++S     N    +G+ D ++    +  +   F   AG++++ +L +YA  SI
Sbjct: 356 TKLRD-GTISGITDLNTSGDSGFSDNLDALYTALTEQRTFSADAGLSSSQSLTDYASASI 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   
Sbjct: 415 GWLEQYRSDATSASETTAAALSRSDEAYSNEAGVNLDEELTLLLDIEQSYKAATKILNVI 474

Query: 469 DKMLQTLLE 477
           D+M Q+LL+
Sbjct: 475 DEMFQSLLD 483


>gi|327193060|gb|EGE59972.1| flagellar hook-associated protein [Rhizobium etli CNPAF512]
          Length = 495

 Score =  305 bits (782), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 179/494 (36%), Positives = 274/494 (55%), Gaps = 19/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGSQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L + S    QQ LL   E LK +M  +D Y  SP+ Y+   +  L+++  +  
Sbjct: 61  DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGND-YETSPSTYLGVFQQKLQAFRTSPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA ADK+I   +  L   LS+    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQDVRAGADKQIATAVDTLNTLLSQFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+  L++IS+I+G+S   R+NNDMV+ T DGT LFET+PR + F+ 
Sbjct: 180 ATATGADPSSALDEREKTLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFQA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + Y  T   N +++DGV +    GS    +G +++LLQ+RD + P FQ QLDE+AR L+
Sbjct: 240 QDVYNATITGNSVYVDGVALPRGSGSTTTAQGSLQSLLQVRDEIAPNFQKQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             F E++  AG    VPGLF  + G  D       G++ TI V+ +       +P  LRD
Sbjct: 300 SLFKEQN-TAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTISVSSRVITSQGGDPMRLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEY 403
           GG      + N   L+GY   ++    +   +  FDP A          GI++NV+++EY
Sbjct: 359 GGVNVNGVVNNPTGLSGYTTDLDRLYTALGSDIDFDPAAGPAVGFDATTGIDSNVSIMEY 418

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K
Sbjct: 419 ATNSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATK 478

Query: 464 LIMFTDKMLQTLLE 477
           ++   D+ML++LL+
Sbjct: 479 ILNAVDEMLKSLLD 492


>gi|13472593|ref|NP_104160.1| flagellar hook-associated protein FlgK [Mesorhizobium loti
           MAFF303099]
 gi|14023339|dbj|BAB49946.1| flagellar hook-associated protein 1; FlgK [Mesorhizobium loti
           MAFF303099]
          Length = 484

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 261/487 (53%), Gaps = 12/487 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           MSL +  + AQ+   + ++Q + + RN+ +A N +Y RR   +T+ +P   +V  QR  N
Sbjct: 1   MSLSSALSIAQSALMSTARQTSVVTRNVSDASNPDYARRIAVVTSTAPGARSVDIQRVAN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +F + L A S+  GQ  L    + L   ++  D+ + SP+  I+ L+ +L+ Y+ + S
Sbjct: 61  DLLFRQNLGALSAYSGQNALYSGMDQLDVSVNGVDNAS-SPSTAIANLQQALQLYATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +VID A++VV++ N  ++ +Q  R   D +I+  + +L   L +    N A+  
Sbjct: 120 NQNLGSSVIDAAKQVVRSLNEGSKAIQDFRTQTDGQIDTAVKDLNSLLGQFQDANQAVIS 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T S  D  D LDQRD LL+KI++ I IST  R +NDMV+ T DGTTLFET+PR ++F  
Sbjct: 180 GTRSGTDVSDALDQRDALLKKIADYIPISTFTRGDNDMVITTGDGTTLFETIPRTVSFTP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              Y   +  N I+ID V VS+  G      GK+  LLQ+RD V    Q+QLDE AR LI
Sbjct: 240 AAGYAAGAPGNTIYIDNVPVSAGSGGNTTASGKLAGLLQLRDGVASTMQSQLDETARGLI 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLD--NKLCQGISETICVN----PQYRSNPSFLR 352
            +F+E  P      N  GLF   G   +     L  G++ TI +N    P    NP+ LR
Sbjct: 300 TAFAETAPAM---PNAAGLFTWSGAPAVPAAGTLVNGLAGTISINAAMDPSAGGNPTLLR 356

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DGG+    ++ N      Y  L+  Y D  +K   FDP AGI+   ++ +YA NSIGWL+
Sbjct: 357 DGGANGAAYVANTTGGPSYSSLLIAYGDRLDKPMTFDPAAGISATSSVSDYAANSIGWLQ 416

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
             R  +       + +    SE+ SN  GVN+ +E+S ++ +E +Y  S +++   D ML
Sbjct: 417 SMRQQASTAADAKEALAQRSSEALSNATGVNVDQEMSLMLDLEHTYQASARMMKTVDDML 476

Query: 473 QTLLEGV 479
             LL  V
Sbjct: 477 TALLNAV 483


>gi|319781664|ref|YP_004141140.1| flagellar hook-associated protein FlgK [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167552|gb|ADV11090.1| flagellar hook-associated protein FlgK [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 484

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 260/487 (53%), Gaps = 12/487 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-TTISPENVTVVTQRSEN 59
           MSL    + AQ+   N ++Q + + RN+ +A N +Y RR  + T+ +P   +V  QR+ N
Sbjct: 1   MSLSTALSIAQSALMNTARQTSVVSRNVADASNPDYSRRQAVVTSTAPGARSVDIQRAAN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +F + L A S+  GQ  L    + L   ++  D+ + SP+  I+ L+ +L+ Y+ + S
Sbjct: 61  ELLFRQNLAALSAWSGQNALYNGMDQLGVAVNGVDNAS-SPSTAIANLQQALQLYATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +VID A++V+++ N  ++ VQ  R   D +I   + +L   L +    N A+  
Sbjct: 120 NQNLGASVIDAAKQVMRSLNEGSKAVQDFRTQTDGQIATAVDDLNSLLGQFQDANTAVMS 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T S  D  D LDQRD LL+KIS  + +ST  R +NDMV+ T DGTTLFET+PR + F  
Sbjct: 180 GTRSGTDVSDALDQRDALLKKISNYVPVSTFTRGDNDMVITTGDGTTLFETIPRTVTFAA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              YT  +  N ++ID V +S+  G      G +  LLQ+RD V    Q+QLDE AR LI
Sbjct: 240 SAGYTAGAAGNAVYIDNVPISAGAGGNTSASGTLAGLLQLRDGVASTMQSQLDETARGLI 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLD--NKLCQGISETICVN----PQYRSNPSFLR 352
            +F+E  P   +  N  GLF   G   +     L  G++ +I VN    P    NP  LR
Sbjct: 300 TAFAETAP---SMANAAGLFTWSGAPAVPAAGTLVNGLAASISVNAAMDPSTGGNPMLLR 356

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DGG+    ++ N    A Y  L+  Y D  ++   FDP AG++   ++ +YA +SIGW E
Sbjct: 357 DGGANGAAYVANTGGGASYSTLLVAYGDRLDQPMTFDPAAGVSATSSVSDYAASSIGWFE 416

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
             R  +       + + +  +E+ SN  GVN+ +E+S L+ +E +Y  S +++   D M+
Sbjct: 417 GVRQQASTASDAKEALASRSAEALSNATGVNVDQEMSLLLDLEHTYQASARMMKTVDDMM 476

Query: 473 QTLLEGV 479
             LL  V
Sbjct: 477 TALLNAV 483


>gi|190890383|ref|YP_001976925.1| flagellar hook-associated protein [Rhizobium etli CIAT 652]
 gi|190695662|gb|ACE89747.1| flagellar hook-associated protein [Rhizobium etli CIAT 652]
          Length = 495

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 178/494 (36%), Positives = 274/494 (55%), Gaps = 19/494 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGSQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L + S    QQ LL   E LK +M  +D Y  SP+ Y+   +  L+++  +  
Sbjct: 61  DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGND-YETSPSTYLGVFQQKLQAFRTSPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA ADK+I   +  L   LS+    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQDVRAGADKQIATAVDTLNTLLSQFENANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+  L++IS+I+G+S   R+NNDMV+ T DGT LFET+PR + F+ 
Sbjct: 180 ATATGADPSSALDEREKTLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFQA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + Y  +   N +++DGV +    GS    +G +++LLQ+RD + P FQ QLDE+AR L+
Sbjct: 240 QDVYNASITGNSVYVDGVALPRGSGSTTTAQGSLQSLLQVRDEIAPNFQKQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRD 353
             F E++  AG    VPGLF  + G  D       G++ TI V+ +       +P  LRD
Sbjct: 300 SLFKEQN-TAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTISVSSRVITSQGGDPMRLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEY 403
           GG      + N   L+GY   ++    +   +  FDP A          GI++NV+++EY
Sbjct: 359 GGVNVNGVVNNPTGLSGYTTDLDRLYTALGSDIDFDPAAGPAVGFDATTGIDSNVSIMEY 418

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K
Sbjct: 419 ATNSLGWLEQYRSNATTAAENTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATK 478

Query: 464 LIMFTDKMLQTLLE 477
           ++   D+ML++LL+
Sbjct: 479 ILNAVDEMLKSLLD 492


>gi|15964433|ref|NP_384786.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           1021]
 gi|307311575|ref|ZP_07591216.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           BL225C]
 gi|15073610|emb|CAC45252.1| Putative flagellar hook-associated protein [Sinorhizobium meliloti
           1021]
 gi|306899592|gb|EFN30221.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           BL225C]
          Length = 472

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 171/483 (35%), Positives = 277/483 (57%), Gaps = 14/483 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    +V+  R++N
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQIVSIYRAQN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L   S +  Q  LL   E +K  +  +D Y +SP+ Y+S  R+SL++++    
Sbjct: 61  EALLKQNLIGISQSSAQSSLLSGLEIMKSALGGND-YESSPSTYLSAFRNSLQTFASTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              +  TV+ +A ++  + + ++  VQ +R D+DK+I  E++NL R L++    N+A+K 
Sbjct: 120 NATIAATVVSDASDLANSISKTSAAVQDLRLDSDKKIAEEVANLNRLLAQFETANNAVKQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  DA   LD RD +L+++SE++GIST+ R NND V+YTS GT LFET+PR++ F  
Sbjct: 180 ATAAGTDATAALDDRDKILKQVSELVGISTVTRANNDTVIYTSGGTVLFETLPREVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            ++Y  T   N IFIDGV +++  G+    +GK+  LLQ+RD + P FQ+QLDEMAR L+
Sbjct: 240 KSAYDATVTGNGIFIDGVPLAAGSGADTSAQGKLAGLLQLRDDIAPTFQSQLDEMARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
             F E          +PGLF  + G       +  G++ ++ VNP  ++NP  LRDGG  
Sbjct: 300 TLFKEG--------GLPGLFTWSGGTVPAAGAVQPGLAASLSVNPAAKANPFLLRDGG-- 349

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
               + N    AGY  L++ +  + + +  FD   G++   +++E+A +SIGW E+ RS 
Sbjct: 350 FNGVVSNPDGNAGYTVLLDGFVTAMDGDMAFDGATGLDATSSIMEFAASSIGWFEQIRSG 409

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +         +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE
Sbjct: 410 ASTADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLE 469

Query: 478 GVK 480
            V+
Sbjct: 470 AVR 472


>gi|150395504|ref|YP_001325971.1| flagellar hook-associated protein FlgK [Sinorhizobium medicae
           WSM419]
 gi|150027019|gb|ABR59136.1| flagellar hook-associated protein FlgK [Sinorhizobium medicae
           WSM419]
          Length = 472

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 170/483 (35%), Positives = 278/483 (57%), Gaps = 14/483 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    +V+  R++N
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQIVSIYRAQN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L + S +  Q  LL   E +K  +  +D Y ++P+ Y+S  R+SL++++    
Sbjct: 61  EALLKQNLISISQSSAQSSLLSGLEIMKSALGGND-YESAPSTYLSAFRNSLQTFASTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              +  TV+ +A ++  + + ++  VQ +R D DK+I  +++NL R L++    N+A++ 
Sbjct: 120 NATIAATVVSDASDLANSISRTSAAVQDLRLDTDKKIAEDVANLNRLLAQFETANNAVRQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  DA   LD RD +L+++SE++GIST+ R NND V+YT+ GT LFET+PR++ F  
Sbjct: 180 ATAAGTDATAALDDRDRILKQVSELVGISTVTRANNDTVIYTAGGTVLFETLPREVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            ++Y  T   N IFIDGV +++  G+    +GK+  LLQ+RD + P FQ QLDEMAR L+
Sbjct: 240 KSAYDATVTGNGIFIDGVPLAAGNGADTNAQGKLAGLLQLRDDIAPTFQTQLDEMARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
             F E          +PGLF  + G       +  GI+  + VNP  +SNP  LRDGG  
Sbjct: 300 SLFQEG--------GLPGLFTWSGGNVPAAGAVEAGIAAYLSVNPAAKSNPFLLRDGG-- 349

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
               + N  N AG+ DL++ +  + + +  FD  AG++   +++E+A +S+GW E+ RS 
Sbjct: 350 FNGIVSNPGNNAGFTDLLDSFVAAMDGDMAFDSAAGLDGTSSIMEFAASSVGWFEQIRSG 409

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +         +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE
Sbjct: 410 ASTADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLE 469

Query: 478 GVK 480
            V+
Sbjct: 470 AVR 472


>gi|10998529|gb|AAG25959.1|AF300968_1 FlgK [Sinorhizobium meliloti]
          Length = 472

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 171/483 (35%), Positives = 277/483 (57%), Gaps = 14/483 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    VV+  R++N
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQVVSIYRAQN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L   S +  Q  LL   E +K  +  +D Y +SP+ Y+S  R+SL++++    
Sbjct: 61  EALLKQNLIGISQSSAQSSLLSGLEIMKSALGGND-YESSPSTYLSAFRNSLQTFASTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              +  TV+ +A ++  + + ++  VQ +R D+DK+I  E++NL R L++    N+A++ 
Sbjct: 120 NTTIAATVVSDASDLANSISKTSAAVQDLRLDSDKKIAEEVANLNRLLAQFETANNAVRQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  DA   LD RD +L+++SE++GIST+ R NND V+YTS GT LFET+PR++ F  
Sbjct: 180 ATAAGTDATAALDDRDKILKQVSELVGISTVTRANNDTVIYTSGGTVLFETLPREVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            ++Y  T   N IFIDGV +++  G+    +GK+  LLQ+RD + P FQ+QLDEMAR L+
Sbjct: 240 KSAYDATVTGNGIFIDGVPLAAGSGADTSAQGKLAGLLQLRDDIAPTFQSQLDEMARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
             F E          +PGLF  + G       +  G++ ++ VNP  ++NP  LRDGG  
Sbjct: 300 TLFKEG--------GLPGLFTWSGGTVPAAGAVQPGLAASLSVNPAAKANPFLLRDGG-- 349

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
               + N    AGY  L++ +  + + +  FD   G++   +++E+A +SIGW E+ RS 
Sbjct: 350 FNGVVSNPDGNAGYTVLLDGFVTAMDGDMAFDGATGLDATSSIMEFAASSIGWFEQIRSG 409

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +         +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE
Sbjct: 410 ASTADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLE 469

Query: 478 GVK 480
            V+
Sbjct: 470 AVR 472


>gi|115523194|ref|YP_780105.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
 gi|115517141|gb|ABJ05125.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
          Length = 490

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 260/490 (53%), Gaps = 10/490 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT--QRSE 58
           M+L    N A++       Q +++ RNI  AD   Y R++ +    P +   V+  QR+ 
Sbjct: 1   MTLTVALNSARSSLMATGTQASAVSRNIAGADQDGYSRKNALLATMPGSGIYVSGIQRAT 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  +F+ VL A S++  Q  +    + +      D   + SPT  ++KL+ +L+ Y+   
Sbjct: 61  SAGLFNNVLKAVSTSAQQDTIFNGLQKIAAATVDDPELDQSPTAQLAKLKTALQQYATAP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
               L +  +  A+ V  + N + + VQ +RADAD ++   ++ + + L++   VN  I 
Sbjct: 121 DNVTLAQAAVTAAKGVAASLNDATKTVQAVRADADSDLSTSVTTINQLLAQFETVNTTIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +K D  D+LD RD +L K+S+ +G++   R NNDMVVYT  G TLFE   R + F 
Sbjct: 181 KGTMAKADVTDYLDLRDSILSKLSQEVGVTVATRANNDMVVYTDSGVTLFERSARSVTFV 240

Query: 239 KMNSYTVTSESNPIFIDGV-VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             N Y+  +  N ++IDGV V+ ++    V  GKI  L  +RD     +QNQLDE+AR L
Sbjct: 241 PTNGYSAATVGNAVYIDGVPVIGASAVMPVHSGKIAGLAALRDDATVTYQNQLDEIARGL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDL--DNKLCQGISETICVNP----QYRSNPSFL 351
           I +F+E D  A +  +V GLF   G   +     +  G++ TI V+         NPS L
Sbjct: 301 IETFAESDQTASSLPDVAGLFTYPGAPAIPASGTISAGLAGTIAVSASVDQSVGGNPSLL 360

Query: 352 RDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDGG S    +++N    AG+ + +    D    +  FDP A    +  L+++A +S+ W
Sbjct: 361 RDGGISGGAAYVYNTTGAAGFSNRLQQLVDGVATSRPFDPAALAKPDANLIDFAGSSVSW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           LE  R  + +    SQ +    +E+ SN  GVN+++E+SF+++VE++++ S+KLI   D 
Sbjct: 421 LESQRKTASEQSTYSQTLLERSAEALSNVNGVNMEDEMSFMLQVERTFSASSKLIATVDA 480

Query: 471 MLQTLLEGVK 480
           ML+ LL  V+
Sbjct: 481 MLKELLAAVR 490


>gi|307318930|ref|ZP_07598361.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           AK83]
 gi|306895344|gb|EFN26099.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           AK83]
          Length = 472

 Score =  293 bits (749), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 171/483 (35%), Positives = 276/483 (57%), Gaps = 14/483 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    VV+  R++N
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQVVSIYRAQN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L   S +  Q  LL   E +K  +  +D Y +SP+ Y+S  R+SL++++    
Sbjct: 61  EALLKQNLIGISQSSAQSSLLSGLEIMKSALGGND-YESSPSTYLSAFRNSLQTFASTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              +  TV+ +A ++  + + ++  VQ +R D+DK+I  E++NL R L++    N+A++ 
Sbjct: 120 NATIAATVVSDASDLANSISKTSAAVQDLRLDSDKKIAEEVANLNRLLAQFETANNAVRQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  DA   LD RD +L+++SE++GIST+ R NND V+YTS GT LFET+PR++ F  
Sbjct: 180 ATAAGTDATAALDDRDKILKQVSELVGISTVTRANNDTVIYTSGGTVLFETLPREVTFAP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            ++Y  T   N IFIDGV ++   G+    +GK+  LLQ+RD + P FQ+QLDEMAR L+
Sbjct: 240 KSAYDATVTGNGIFIDGVPLAPGSGADTNAQGKLAGLLQLRDDIAPTFQSQLDEMARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
             F E          +PGLF  + G       +  G++ ++ VNP  ++NP  LRDGG  
Sbjct: 300 TLFKEG--------GLPGLFTWSGGTVPAAGAVQPGLAASLSVNPAAKANPFLLRDGG-- 349

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
               + N    AGY  L++ +  + + +  FD   G++   +++E+A +SIGW E+ RS 
Sbjct: 350 FNGVVSNPDGNAGYTVLLDGFVTAMDGDMAFDGATGLDATSSIMEFAASSIGWFEQIRSG 409

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +         +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE
Sbjct: 410 ASTADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLE 469

Query: 478 GVK 480
            V+
Sbjct: 470 AVR 472


>gi|260466602|ref|ZP_05812790.1| flagellar hook-associated protein FlgK [Mesorhizobium opportunistum
           WSM2075]
 gi|259029608|gb|EEW30896.1| flagellar hook-associated protein FlgK [Mesorhizobium opportunistum
           WSM2075]
          Length = 470

 Score =  289 bits (739), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 253/472 (53%), Gaps = 12/472 (2%)

Query: 16  NASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAI 74
           N ++Q + + RNI +A N +Y RR   +T+ +P    V  QR+ N  +F + L A S+  
Sbjct: 2   NTARQTSVVSRNIADASNPDYTRRISVITSTAPGARFVDVQRAANDLLFRQNLGALSAYS 61

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
           GQ  L    + L   ++  D+ + SP+  I+ L+ +L+ Y+ + S   LG +VID A++V
Sbjct: 62  GQNALYSGMDQLDVSVNGVDNAS-SPSAAIANLQQALQLYATSPSNQNLGSSVIDAAKQV 120

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
           V++ N  ++ +Q  R   D +I+  + +L   L +    N A+   T S  D  D LDQR
Sbjct: 121 VRSLNEGSKAIQDFRTQTDGQIDTAVKDLNSLLGQFQDANQAVMSGTRSGTDVSDALDQR 180

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFI 254
           D LL+KIS  + IST  R +NDMV+ T DGTTLFET+PR ++F     Y   +  N ++I
Sbjct: 181 DALLKKISNYVPISTFTRGDNDMVITTGDGTTLFETIPRTVSFTPAAGYAAGAAGNTVYI 240

Query: 255 DGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSEN 313
           D V +S+  G      G +  LLQ+RD V    Q+QLDE AR LI +F+E  P   +  N
Sbjct: 241 DNVPISAGTGGNTTASGTLAGLLQLRDGVASTMQSQLDETARGLITAFAETAP---SMPN 297

Query: 314 VPGLFIADGIKDLD--NKLCQGISETICVN----PQYRSNPSFLRDGGSVSKKFLWNVKN 367
             GLF   G   +     L  G++ TI +N    P    NP+ LRDGG+    ++ N   
Sbjct: 298 AAGLFTWSGAPAVPAAGTLVNGLAGTISINAAMDPSVGGNPTLLRDGGANGLAYVANTTG 357

Query: 368 LAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQV 427
            A Y +L+  Y D  +K   FD  AGI+   ++ +YA NSIGWL+  R  +       + 
Sbjct: 358 GASYSNLLIAYGDQLDKPMTFDSAAGISATSSVSDYAANSIGWLQSVRQQASTAADAKEA 417

Query: 428 VFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +    +++ SN  GVN+ +E+S ++ +E +Y  S +++   D M+  LL  V
Sbjct: 418 LAQRSADALSNATGVNIDQEMSLMLDLEHTYQASARMMKTVDDMMTALLSAV 469


>gi|227820876|ref|YP_002824846.1| flagellar hook-associated protein FlgK [Sinorhizobium fredii
           NGR234]
 gi|227339875|gb|ACP24093.1| predicted flagellar hook-associated protein FlgK [Sinorhizobium
           fredii NGR234]
          Length = 476

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 176/486 (36%), Positives = 277/486 (56%), Gaps = 16/486 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +    AQ+  +  + Q A++ +N+ NA N +Y RR  M   + +   +V+  R++N
Sbjct: 1   MSLSSAIAIAQSAFSTTASQTATVSKNVANASNADYSRRMAMLGTTADGAQIVSIYRAQN 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +  + L + S +  Q  LL   E LK  +  +D Y  +P+ Y+S  RDSL++++    
Sbjct: 61  EALLKQNLTSISQSSAQSSLLSGLELLKSALGGND-YETAPSTYLSAFRDSLQTFASTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              +  TV+ +A ++  + + +A  VQ +R D DK+I  E+ NL   L+     N+A+K 
Sbjct: 120 NSTIAATVVADASDLANSISKTATAVQDLRLDTDKQIAEEVDNLNALLASFETANNAVKQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  DA   LD+RD LL+++SE++GIST+ R +ND V+YTSDGT LFET  R + F  
Sbjct: 180 ATATGADATAALDERDKLLKQLSELVGISTVTRADNDTVIYTSDGTVLFETQARQVTFTA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            +++  ++  N IFIDGV +S+  G+    +GK+ +LLQ+RD + P FQ+QLDEMAR L+
Sbjct: 240 TSAFDASTTGNAIFIDGVSLSAGAGADTTAEGKLASLLQLRDDIAPTFQSQLDEMARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG--- 354
             F E        +  PGLF   DG    D  +  GI+ T+ VN   ++NP  LRDG   
Sbjct: 300 SLFQE--------DGAPGLFTWEDGTLPADGTVEPGIAATLSVNAAAQTNPFLLRDGGFN 351

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
           G VS        N +GY DL++ +  + + +  FD  AG+++  +++E+A +SIGW E+ 
Sbjct: 352 GLVSNPGGATDPN-SGYTDLLDGFITAMDGDMDFDAAAGLDSTSSIMEFAASSIGWFEQI 410

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
           RS +         +     E+  N  GV++ EELS L+ +EQSY  S KLI   D M+ +
Sbjct: 411 RSAASTADDNKTALLARTEEALGNVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMAS 470

Query: 475 LLEGVK 480
           LLE V+
Sbjct: 471 LLEAVR 476


>gi|110632639|ref|YP_672847.1| flagellar hook-associated protein FlgK [Mesorhizobium sp. BNC1]
 gi|110283623|gb|ABG61682.1| flagellar hook-associated protein FlgK [Chelativorans sp. BNC1]
          Length = 487

 Score =  285 bits (730), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 170/487 (34%), Positives = 267/487 (54%), Gaps = 13/487 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT--MTTISPENVTVVTQRSE 58
           MSL +  N AQ+   N S+Q + + RNI  A N +Y RR    ++T S   +  + +R+ 
Sbjct: 1   MSLTSALNIAQSALFNTSRQTSIVSRNISEASNPDYARRAASLVSTNSGAQIGDI-RRAT 59

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           ++ +F + L A SS  GQ  L +  + L+  ++  D+ + SP   +SKLR++L++Y+   
Sbjct: 60  DEVLFRQNLAAQSSWNGQSFLSRGLDRLQINVNGVDNAS-SPATALSKLREALQTYAATP 118

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           S   L +  ++ A ++V + N+    +Q  R D D+EI   + +L R L+E   VN  I 
Sbjct: 119 SNRTLAENAVEAARQMVLSLNSGTAAIQSFRTDIDQEISASVDDLNRLLAEFETVNTQIV 178

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +  D  D LD+RD LL++IS  + +STI R NNDMV+ T+ G TLFETVPR ++F 
Sbjct: 179 SGTRTGRDVSDMLDRRDALLKQISAYLPVSTITRANNDMVLTTTGGVTLFETVPRPVSFT 238

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSA--VPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
             N+Y   +  N +++DGV +S   G       G + A LQ+RD +    Q QLDE+AR 
Sbjct: 239 ANNAYAAGTLGNAVYVDGVPLSPGAGGGNTTASGSLAANLQLRDEIAVQMQRQLDEIARG 298

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDL--DNKLCQGISETICVNPQYRS----NPSF 350
           L+  F+E DP +G   +  GLF   G   L  D  L  G++  I VNP   S    +P  
Sbjct: 299 LVSVFAESDP-SGTLSDAAGLFTWPGGPALPADGILVDGLAGRISVNPAMDSRAGGDPEL 357

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           LRDGG+    +L N    A Y  L+N + +      +FDP  G+ ++ +L  ++  +IGW
Sbjct: 358 LRDGGANGTAYLHNTTGAASYSGLLNSFVERLETPQLFDPATGLGSSQSLFSFSVETIGW 417

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           LE  R  S       + + +H + + +NT GVN+ EE++ L+++E SY  S +L+   D+
Sbjct: 418 LEGLRQQSASGMAAKEALASHTATALANTTGVNIDEEMALLLELEHSYQASARLMSVIDE 477

Query: 471 MLQTLLE 477
           ML  L+E
Sbjct: 478 MLANLME 484


>gi|90422625|ref|YP_530995.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisB18]
 gi|90104639|gb|ABD86676.1| Flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
          Length = 490

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 155/489 (31%), Positives = 260/489 (53%), Gaps = 10/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV--TQRSE 58
           M+L    N A++    A  Q A++ RNI  A    Y R++ +    P +   V   QR+ 
Sbjct: 1   MTLTVALNSARSSLMAAGAQAAAVSRNIAGAKQDGYSRKNVLLATMPGSGVFVEGIQRAA 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  +F+ VL A S++  Q  L    + +      D   + SP   ++KLR +L+  +   
Sbjct: 61  SAGLFNNVLKAASTSAMQDTLYNGLQKIAAATIDDPELDQSPAAQLAKLRTALQQSATAP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
               L +  +  A+ V  + N + + VQ +R DAD E+E  ++ + + L++   VN +I 
Sbjct: 121 DNVTLAQAAVTAAKGVAASLNDATKTVQGVRLDADAELETSVATINQLLAQFETVNTSIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +  D  D+LD RD +L K+S+ +GI+   R NNDMV+YT  G T+FE   R ++F+
Sbjct: 181 KGTITGADTTDYLDLRDSILSKLSQEVGITVSTRANNDMVIYTDSGVTMFEKTARSVSFD 240

Query: 239 KMNSYTVTSESNPIFIDGV-VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           +   ++ T+  N ++IDGV V+ ++    V  GK+  L  +RD     +QNQLDE+AR L
Sbjct: 241 QTYGFSPTTTGNAVYIDGVPVIGASAVMPVQSGKLAGLAALRDDTTVSYQNQLDEIARGL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNK--LCQGISETICVNP----QYRSNPSFL 351
           + +F+E+D    +  +VPGLF   G   +     +  G++ TI V+         +P+ L
Sbjct: 301 VEAFAERDQSGASLPDVPGLFTYPGAPAIPGSGVIAVGLAGTITVSASVDQSVGGDPTRL 360

Query: 352 RDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDGG S +  + +N    AGY   +    D   ++  FDP A    N  L+++A +S+ W
Sbjct: 361 RDGGISGNPAYTYNTTGHAGYFARLQQMADGLTQSRAFDPAALAKPNTGLIDFAGSSVSW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           LE  R  + D    SQ +    +++ SN  GVN+ +E++F+++VE++Y+ S+KLI   D+
Sbjct: 421 LESQRKGASDESTYSQTLLERSADALSNVNGVNMDDEMTFMLQVERTYSASSKLISAVDQ 480

Query: 471 MLQTLLEGV 479
           ML+ LL  V
Sbjct: 481 MLKDLLAAV 489


>gi|254720774|ref|ZP_05182585.1| flagellar hook-associated protein FlgK [Brucella sp. 83/13]
 gi|265985832|ref|ZP_06098567.1| flagellar hook-associated protein FlgK [Brucella sp. 83/13]
 gi|306840135|ref|ZP_07472920.1| flagellar hook-associated protein FlgK [Brucella sp. NF 2653]
 gi|264664424|gb|EEZ34685.1| flagellar hook-associated protein FlgK [Brucella sp. 83/13]
 gi|306404780|gb|EFM61074.1| flagellar hook-associated protein FlgK [Brucella sp. NF 2653]
          Length = 484

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 263/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLAGGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T+      + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 STVLTLGVAGKAVMVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIGVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +N +  AG+ D +    ++F++  +FD  AGI++  +L  Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNAQGAAGFSDRLRALNEAFSEPMVFDAAAGISSGSSLTGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|86360903|ref|YP_472790.1| flagellar hook-associated protein FlgK [Rhizobium etli CFN 42]
 gi|86285005|gb|ABC94063.1| flagellar hook-associated protein [Rhizobium etli CFN 42]
          Length = 453

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 145/416 (34%), Positives = 233/416 (56%), Gaps = 18/416 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I NN  QQ + +  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNSVQSIFNNTGQQSSVVSTNIANVGNSDYVRREASITTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L +++    QQ L+   E+L+ +M  +D Y  SP+ Y++  +++L++Y+ + S
Sbjct: 61  TALLAQYLQSNAKDSAQQTLVTGLESLQSLMGGND-YETSPSTYLAAFQEALQTYATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A+++  + NT+   VQ IRA+AD EI  ++S L   LS+    N+A+K 
Sbjct: 120 NTTAAQSAVTAAQDLANSLNTATDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T++  D    LD R+ LL++IS I+G++++VR+NNDM +YTSDGT LFET+PR + F  
Sbjct: 180 ATSTGADTSTALDAREKLLKQISSIVGVTSVVRDNNDMALYTSDGTVLFETMPRTVTFAS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ+QLD++A+ L+
Sbjct: 240 TATYVAGTEGNAIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQDQLDQIAKALV 299

Query: 299 GSFSEKDPIAGNSENVPGLFI------ADGIKDLDNKLCQGISETICVNPQY----RSNP 348
             FSE D     S + PGLF         G    D     GI+ TI VNP        + 
Sbjct: 300 QVFSETD----GSTSAPGLFTWTTASGTTGETPSDTDDVTGIASTISVNPAVVTSEGGDA 355

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           + LRD G++S     N    +G+ D ++    +  +   F   AG++T  +L +YA
Sbjct: 356 TKLRD-GTISGITNLNTSGDSGFSDNLDALYQALTEQRSFSADAGLSTTQSLRDYA 410


>gi|23500853|ref|NP_700293.1| flagellar hook-associated protein FlgK [Brucella suis 1330]
 gi|161621181|ref|YP_001595067.1| flagellar hook-associated protein FlgK [Brucella canis ATCC 23365]
 gi|254699261|ref|ZP_05161089.1| flagellar hook-associated protein FlgK [Brucella suis bv. 5 str.
           513]
 gi|254702382|ref|ZP_05164210.1| flagellar hook-associated protein FlgK [Brucella suis bv. 3 str.
           686]
 gi|254711817|ref|ZP_05173628.1| flagellar hook-associated protein FlgK [Brucella ceti M644/93/1]
 gi|254714886|ref|ZP_05176697.1| flagellar hook-associated protein FlgK [Brucella ceti M13/05/1]
 gi|256015897|ref|YP_003105906.1| flagellar hook-associated protein [Brucella microti CCM 4915]
 gi|256059805|ref|ZP_05450000.1| flagellar hook-associated protein FlgK [Brucella neotomae 5K33]
 gi|260568715|ref|ZP_05839184.1| flagellar hook-associated protein [Brucella suis bv. 4 str. 40]
 gi|261216576|ref|ZP_05930857.1| flagellar hook-associated protein FlgK [Brucella ceti M13/05/1]
 gi|261319446|ref|ZP_05958643.1| flagellar hook-associated protein FlgK [Brucella ceti M644/93/1]
 gi|261323785|ref|ZP_05962982.1| FlgK [Brucella neotomae 5K33]
 gi|261749701|ref|ZP_05993410.1| flagellar hook-associated protein [Brucella suis bv. 5 str. 513]
 gi|261752945|ref|ZP_05996654.1| flagellar hook-associated protein [Brucella suis bv. 3 str. 686]
 gi|294852967|ref|ZP_06793639.1| flagellar hook-associated protein FlgK [Brucella sp. NVSL 07-0026]
 gi|23464517|gb|AAN34298.1| flagellar hook-associated protein FlgK, putative [Brucella suis
           1330]
 gi|161337992|gb|ABX64296.1| flagellar hook-associated protein FlgK [Brucella canis ATCC 23365]
 gi|255998557|gb|ACU50244.1| flagellar hook-associated protein [Brucella microti CCM 4915]
 gi|260155380|gb|EEW90461.1| flagellar hook-associated protein [Brucella suis bv. 4 str. 40]
 gi|260921665|gb|EEX88233.1| flagellar hook-associated protein FlgK [Brucella ceti M13/05/1]
 gi|261292136|gb|EEX95632.1| flagellar hook-associated protein FlgK [Brucella ceti M644/93/1]
 gi|261299765|gb|EEY03262.1| FlgK [Brucella neotomae 5K33]
 gi|261739454|gb|EEY27380.1| flagellar hook-associated protein [Brucella suis bv. 5 str. 513]
 gi|261742698|gb|EEY30624.1| flagellar hook-associated protein [Brucella suis bv. 3 str. 686]
 gi|294818622|gb|EFG35622.1| flagellar hook-associated protein FlgK [Brucella sp. NVSL 07-0026]
          Length = 484

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 265/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|306841277|ref|ZP_07473988.1| flagellar hook-associated protein FlgK [Brucella sp. BO2]
 gi|306288679|gb|EFM60010.1| flagellar hook-associated protein FlgK [Brucella sp. BO2]
          Length = 484

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 264/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLAGGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 STVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIGVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L  Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLTGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|254695092|ref|ZP_05156920.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215443|ref|ZP_05929724.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917050|gb|EEX83911.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 3 str.
           Tulya]
          Length = 484

 Score =  266 bits (679), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 264/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y  + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYVASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|17988504|ref|NP_541137.1| flagellar hook-associated protein FlgK [Brucella melitensis bv. 1
           str. 16M]
 gi|225686884|ref|YP_002734856.1| flagellar hook-associated protein FlgK [Brucella melitensis ATCC
           23457]
 gi|256042865|ref|ZP_05445811.1| flagellar hook-associated protein FlgK [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256261979|ref|ZP_05464511.1| flagellar hook-associated protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260564102|ref|ZP_05834587.1| flagellar hook-associated protein [Brucella melitensis bv. 1 str.
           16M]
 gi|265989300|ref|ZP_06101857.1| FlgK [Brucella melitensis bv. 1 str. Rev.1]
 gi|17984296|gb|AAL53401.1| flagellar hook-associated protein 1 [Brucella melitensis bv. 1 str.
           16M]
 gi|225642989|gb|ACO02902.1| flagellar hook-associated protein FlgK [Brucella melitensis ATCC
           23457]
 gi|260151745|gb|EEW86838.1| flagellar hook-associated protein [Brucella melitensis bv. 1 str.
           16M]
 gi|262999969|gb|EEZ12659.1| FlgK [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091463|gb|EEZ15999.1| flagellar hook-associated protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326411302|gb|ADZ68366.1| flagellar hook-associated protein FlgK [Brucella melitensis M28]
 gi|326554591|gb|ADZ89230.1| flagellar hook-associated protein FlgK [Brucella melitensis M5-90]
          Length = 484

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 264/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y  + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYVASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDCTRQVQSLRNDADREIADSVANINDLLAKFEKANQNVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|163845456|ref|YP_001623111.1| flagellar hook-associated protein FlgK [Brucella suis ATCC 23445]
 gi|163676179|gb|ABY40289.1| flagellar hook-associated protein FlgK [Brucella suis ATCC 23445]
          Length = 484

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 264/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + +  NI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSPNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|306845418|ref|ZP_07477992.1| flagellar hook-associated protein FlgK [Brucella sp. BO1]
 gi|306274161|gb|EFM55977.1| flagellar hook-associated protein FlgK [Brucella sp. BO1]
          Length = 484

 Score =  263 bits (672), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 155/486 (31%), Positives = 263/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSILAGGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFERANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  ++LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSEYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 STVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIGVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +N +  AG+ D +    ++F++  +FD  AGI+++ +L  Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNAQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLTGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|254691612|ref|ZP_05154866.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 6 str.
           870]
 gi|256256799|ref|ZP_05462335.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 9 str.
           C68]
 gi|260757243|ref|ZP_05869591.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 6 str.
           870]
 gi|260883047|ref|ZP_05894661.1| FlgK [Brucella abortus bv. 9 str. C68]
 gi|297250152|ref|ZP_06933853.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 5 str.
           B3196]
 gi|260677351|gb|EEX64172.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 6 str.
           870]
 gi|260872575|gb|EEX79644.1| FlgK [Brucella abortus bv. 9 str. C68]
 gi|297174021|gb|EFH33385.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 5 str.
           B3196]
          Length = 484

 Score =  263 bits (671), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 263/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y  + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYVASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++   IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLLGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|62317956|ref|YP_223809.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 1 str.
           9-941]
 gi|83269933|ref|YP_419224.1| flagellar hook-associated protein FlgK [Brucella melitensis biovar
           Abortus 2308]
 gi|189023207|ref|YP_001932948.1| flagellar hook-associated protein FlgK [Brucella abortus S19]
 gi|254698189|ref|ZP_05160017.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731633|ref|ZP_05190211.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 4 str.
           292]
 gi|260544141|ref|ZP_05819962.1| flagellar hook-associated protein [Brucella abortus NCTC 8038]
 gi|260759392|ref|ZP_05871740.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 4 str.
           292]
 gi|260762636|ref|ZP_05874968.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 2 str.
           86/8/59]
 gi|12330681|gb|AAG52878.1| FlgK [Brucella abortus]
 gi|62198149|gb|AAX76448.1| hypothetical FlgK, flagellar hook-associated protein FlgK [Brucella
           abortus bv. 1 str. 9-941]
 gi|82940207|emb|CAJ13263.1| flagellar hook-associated protein FlgK, putative KO: K02396
           flagellar hook-associated protein 1 FlgK [Brucella
           melitensis biovar Abortus 2308]
 gi|189021781|gb|ACD74502.1| flagellar hook-associated protein [Brucella abortus S19]
 gi|260097412|gb|EEW81286.1| flagellar hook-associated protein [Brucella abortus NCTC 8038]
 gi|260669710|gb|EEX56650.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 4 str.
           292]
 gi|260673057|gb|EEX59878.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 484

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 262/486 (53%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y  + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYVASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++   IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLLGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S+ ++     ML 
Sbjct: 419 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSWVLTTVSAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|237817501|ref|ZP_04596492.1| flagellar hook-associated protein FlgK [Brucella abortus str. 2308
           A]
 gi|237787336|gb|EEP61553.1| flagellar hook-associated protein FlgK [Brucella abortus str. 2308
           A]
          Length = 492

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 262/486 (53%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 9   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 68

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y  + S
Sbjct: 69  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYVASPS 127

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 128 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 187

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++   IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 188 GTRMGRDVSDYLDQRDALLKQLLGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 247

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 248 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 307

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 308 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 366

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 367 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 426

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S+ ++     ML 
Sbjct: 427 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSWVLTTVSAMLD 486

Query: 474 TLLEGV 479
            LL  V
Sbjct: 487 DLLNAV 492


>gi|239834426|ref|ZP_04682754.1| flagellar hook-associated protein FlgK [Ochrobactrum intermedium
           LMG 3301]
 gi|239822489|gb|EEQ94058.1| flagellar hook-associated protein FlgK [Ochrobactrum intermedium
           LMG 3301]
          Length = 484

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 146/486 (30%), Positives = 262/486 (53%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + +  NI  A++ +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSSNIARANDPDYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +F++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EALFNRFIQSNSTASSSSILAGGLDRLSSLYSAD-NYSGSPSALIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   +++Q +R DAD+EI   ++N+   L++   VN  I  
Sbjct: 120 NSALGDSVVSTAQSLANALNAGTKQIQSLRNDADREIADSVANINDLLAKFEKVNQEIVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T +  D  D++DQRD +L+++S  IGI+T++R +NDMV++  +G TLFET  R ++FE+
Sbjct: 180 GTRANRDVSDYMDQRDAILKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVSFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
                       + +DGV ++          G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 STVLAPGISGKAVLVDGVPLNHETFDQPYGTGRLSGLLQLRDQIAPQYQMQLDEIARNLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G   +  GLF   G  D+    +  GI+ +I V+  + ++       LRD
Sbjct: 300 TMFAESDQT-GVGADKTGLFSWAGSPDVPGAGMSAGIAGSIKVSSAFVASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +N++  AG+ + +    ++F++   FDP  G++ + +L++Y+ +SI WLE 
Sbjct: 359 GGANGPDYKYNIEGAAGFSERLRALNEAFSEPMAFDPATGLSASSSLIDYSASSISWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V      + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFSYNATVATQADAALSNANGVDMDTEMALLLDLEHSYQASSRVLTTISAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|328545490|ref|YP_004305599.1| flagellar hook-associated protein K [polymorphum gilvum
           SL003B-26A1]
 gi|326415231|gb|ADZ72294.1| Flagellar hook-associated protein K [Polymorphum gilvum
           SL003B-26A1]
          Length = 496

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/498 (31%), Positives = 264/498 (53%), Gaps = 20/498 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM--TTISPENVTVVTQ--- 55
           MSL      AQ+       + A++ RNI  A +  Y R+  +  T +S    T   +   
Sbjct: 1   MSLSVALQVAQSALAARQTETATVSRNIAGAQDPGYTRKSVVLSTVVSASGQTGGVRVDG 60

Query: 56  --RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R+ +  +++ ++ A S A  QQ +++  + L + +S D     SP   + KL  S+++
Sbjct: 61  IARTTDSALYNSLVRATSVATSQQAIVEGLDKLNQTVS-DTELELSPAAALGKLEISIQN 119

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
           Y+ +    IL +T++D A+++    N     VQ +RA+AD ++   +  +   LS+L  +
Sbjct: 120 YASDPGNAILAQTMLDAAKDMATTLNEYTALVQNVRAEADADMASSVKTINNLLSQLESL 179

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I   T    D  D LD RD +L  +SE IGIST+ R++  +VVYT  G TLFET  R
Sbjct: 180 NTIIVKGTQGGADVSDALDARDRVLLSLSEEIGISTLTRSDGGVVVYTDGGVTLFETTAR 239

Query: 234 DINFEKMNSYTVTSESNPIFIDGV-VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
            ++F   N+Y+  +  N ++IDGV V  +N    +  G++  L ++RD +   +Q+QLDE
Sbjct: 240 TVSFTPTNTYSAATVGNAVYIDGVPVTGANAIMPISSGRLHGLSELRDDIAVTYQSQLDE 299

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD--NKLCQGISETI----CVNPQYRS 346
           +AR LI +F+E D   G   +  GLF   G   +   + L  G++  I     V+P    
Sbjct: 300 IARGLIEAFAESDQSGGGGPDQAGLFTYAGAPAVPAASTLVAGLAGDIRISASVDPDQGG 359

Query: 347 NPSFLRDGG---SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
           N   LRDGG    ++  + +N  +LAGY D +  + ++FN+  +FD    ++   TL  +
Sbjct: 360 NLDLLRDGGISDPLNPDYDYNPGDLAGYSDRLQQFLNAFNQPRVFDGGVELDPTDTLKGF 419

Query: 404 ARNSIGWLEKNR-SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           A +S  WL++ R + + +L +++ V+    +ES SN  GVNL EE++ L+ +E++Y  + 
Sbjct: 420 ASSSASWLQRERQTATSNLEVQA-VIVTRTAESLSNATGVNLDEEMTRLLDIERAYAAAA 478

Query: 463 KLIMFTDKMLQTLLEGVK 480
           KLI   D+ML+ LL   +
Sbjct: 479 KLIAAVDRMLEDLLTAAR 496


>gi|296445195|ref|ZP_06887155.1| flagellar hook-associated protein FlgK [Methylosinus trichosporium
           OB3b]
 gi|296257369|gb|EFH04436.1| flagellar hook-associated protein FlgK [Methylosinus trichosporium
           OB3b]
          Length = 495

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 154/480 (32%), Positives = 244/480 (50%), Gaps = 20/480 (4%)

Query: 18  SQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV--TQRSENKNMFDKVLHAHSSAIG 75
           S Q + + RNI  A    Y  + ++ + +      V    R+ +  +F   L A S    
Sbjct: 18  SSQISLVSRNIAGASTTGYAAKTSLLSTNASGGVDVNGVARATSLALFQNALQATSGQAA 77

Query: 76  QQRLLQSFEALKEMMS------ADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVID 129
              L    + L ++         D   + SP   ++ L  +L+SYS + S+    ++V+ 
Sbjct: 78  SSALSSGLDQLDQLYGLSTSTATDTSSSRSPAALVAALSSALQSYSASPSDLTTAQSVLT 137

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
            A+ + Q+ N  +  VQ +RA AD +I   + ++   L +    N AI   T +  D   
Sbjct: 138 AAQSLAQSLNDGSTAVQNMRAQADGDIATAVDDINSLLGQFQKANAAIVSGTQTGRDVSA 197

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSES 249
             DQRD LL K+S  IG+ TI R NNDMV+YT  G TLFET  R+++F     Y+ ++  
Sbjct: 198 LEDQRDELLNKLSADIGVRTITRANNDMVIYTDSGATLFETTARNVSFTATAGYSASTVG 257

Query: 250 NPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPI 307
           + +++DGV V+    +A+P   GK++ L Q+RD V P FQNQLDE+AR LI SF+E D  
Sbjct: 258 SSVYVDGVPVTGAD-AAMPIQSGKLQGLTQLRDVVAPQFQNQLDELARGLIVSFAETDQT 316

Query: 308 AGNSENVPGLFIADGIKDLDN-KLCQGISETICVN----PQYRSNPSFLRDGG---SVSK 359
            G + + PGLF      D+ +  +  G++  I VN    P    +   LRDGG     + 
Sbjct: 317 GGGA-SAPGLFTYSDATDVPSVGIIPGLAGQITVNANADPTKGGSLDRLRDGGISDPGNS 375

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
            F +N    AGY D IN    + +    FD  AG+ TN ++ +YA +SIGWLE  R  + 
Sbjct: 376 AFDYNATGDAGYTDRINQLITALSTPQDFDTTAGVGTNQSVADYASSSIGWLEAQRQQAS 435

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                 + + +  S++ SN  GVNL +++S ++ +E +Y+ S KL+   D M + L + +
Sbjct: 436 SSASYQETLVSQTSQALSNATGVNLDDQMSQMLDLENAYSASAKLLAAVDAMYKALFQAL 495


>gi|27381968|ref|NP_773497.1| flagellar hook-associated protein FlgK [Bradyrhizobium japonicum
           USDA 110]
 gi|27355138|dbj|BAC52122.1| flgK [Bradyrhizobium japonicum USDA 110]
          Length = 491

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 151/494 (30%), Positives = 258/494 (52%), Gaps = 20/494 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVT-QRSE 58
           MSL A  + A+     +  Q ++I RNI  A    Y R+   +  +    V V + QR+ 
Sbjct: 1   MSLTAALDSARASLMASGIQSSTISRNIAGASAAGYSRKIAVLDNLPGAGVYVASIQRAA 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSA---DDHYNNSPTHYISKLRDSLESYS 115
           +  +++ VL A SS+  Q  +   ++ L+++ SA   D   + SPT  ++ L+ +L+ Y+
Sbjct: 61  SSGLYNNVLTATSSSAKQGAI---YDGLQKIASATVDDTELDQSPTAQLNALKKALQQYA 117

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                  L +  I +A+++    N +   VQ +R  AD ++   ++N+ + L++   VN+
Sbjct: 118 NAPDNTTLAQAAITSAKDMATALNQATNTVQSVREGADADMATSVANINQLLTQFDKVNN 177

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
           A+   T +  D  D+LDQRD ++ K+S+ +G+S  +R N D  +YT  G  LF+   R +
Sbjct: 178 AVVRGTIAGDDVTDYLDQRDSIVSKLSQEVGVSMSIRANGDAALYTDSGVVLFDKTARTV 237

Query: 236 NFEKMNSYTVTSESNPIFIDGV-VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           +F   N YT  +  N ++IDGV V  +N    +  GK+  L Q+RD     +Q+QLDE+A
Sbjct: 238 SFTATNIYTAGTTGNAVYIDGVPVTGANSVMPLKSGKLAGLAQLRDQDSVTYQSQLDEIA 297

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNK------LCQGISETICVNPQYRSNP 348
           R LI +F E D  A    +VPGLF   G   +         L   IS    V+P    NP
Sbjct: 298 RGLINTFRESDQTAAALPDVPGLFTYPGAPAIPASATVSVGLAGLISVAASVDPAQGGNP 357

Query: 349 SFLRDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
           + LRDG  S +  + +N    AGY   +       + +  FD       + +L+++A +S
Sbjct: 358 NLLRDGAISGNVAYRYNTAGNAGYSARLQQLIGGMDASQPFDVTTQGKPSGSLIDFASSS 417

Query: 408 IGWLEKNR--SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
             W+E  R  +DS+  + K+  + +  + + SN  GVN+ +E+S +++VE++Y+ S+K+I
Sbjct: 418 TSWIENQRKTADSNVTYQKT--LLDRSTAALSNVSGVNMDDEMSLMLQVERTYSASSKII 475

Query: 466 MFTDKMLQTLLEGV 479
              D+MLQ+LL  V
Sbjct: 476 STVDQMLQSLLAAV 489


>gi|153011507|ref|YP_001372721.1| flagellar hook-associated protein FlgK [Ochrobactrum anthropi ATCC
           49188]
 gi|151563395|gb|ABS16892.1| flagellar hook-associated protein FlgK [Ochrobactrum anthropi ATCC
           49188]
          Length = 484

 Score =  246 bits (627), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 263/486 (54%), Gaps = 9/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A++ +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNIAGANDPDYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + +F+K + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++++ + S
Sbjct: 61  EALFNKFIQSNSTASSSSILAGGLDRLSSLYSAD-NYSGSPSALIGDLRDALQTFAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   ++VQ +R DAD+EI   ++N+   L++   +N  I  
Sbjct: 120 NSALGDSVVSTAQSLANALNAGTKQVQSLRNDADREIADSVANINDLLAKFEKINQEIVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T +  D  D++DQRD +L+++S  IGI+T++R +NDMV++  +G TLFET  R ++FE+
Sbjct: 180 GTRANRDVSDYMDQRDSILKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVSFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
                       + +DGV ++          G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 STVLAPGIAGKAVLVDGVPLNHETFDQPYGTGRLSGLLQLRDQIAPQYQMQLDEIARNLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G   +  GLF   G  D+    +  GI+ TI V+  + ++       LRD
Sbjct: 300 TMFAESDQT-GVGADKTGLFSWAGSPDVPGAGVSAGIAGTIKVSSAFVTSEGGSSLLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +N +  AG+ D +    ++F++   F+ VAG+ TN +L +Y+ +SI WLE 
Sbjct: 359 GGANGADYKYNSEGGAGFSDRLRALNEAFSEPMTFNSVAGLATNSSLTDYSSSSISWLEG 418

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  + +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 419 KRQKANSEFSYNATIASQADAALSNANGVDMDTEMALLLDLEHSYQASSRVLTTISAMLD 478

Query: 474 TLLEGV 479
            LL  V
Sbjct: 479 DLLNAV 484


>gi|158422272|ref|YP_001523564.1| flagellar hook-associated protein FlgK [Azorhizobium caulinodans
           ORS 571]
 gi|158329161|dbj|BAF86646.1| FlgK protein [Azorhizobium caulinodans ORS 571]
          Length = 485

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 149/488 (30%), Positives = 244/488 (50%), Gaps = 11/488 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MTTISPENVTVVTQRSEN 59
           MSL + F+ A+N   N + Q ++  +NIENA N +Y R++  + +    N +VV  R+ +
Sbjct: 1   MSLTSAFSTARNSLLNTATQLSTSAKNIENASNTSYSRKNANLVSGDAGNTSVVVARAGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +F K+L A S++     LL     L+  +  D   + S    +S  + +L SY+    
Sbjct: 61  AALFLKMLDATSNSSKYAALLTGLTTLQSTI-GDTETDTSVAARLSTFQTALSSYANAPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
            D LG+  I  AE +    N+S R VQ +RA+AD  I   +S +   LS+  + NDA+  
Sbjct: 120 NDTLGQAAITAAENLATALNSSTRTVQSVRAEADANIANSVSKVNDLLSQFKIANDAVIA 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D LD RD +L K+SE +G++T++  NNDM +YT  G TLF+  PR + F  
Sbjct: 180 GTVKGDDISDALDARDAVLSKLSEEMGVTTVLGQNNDMKLYTDGGATLFDQSPRSVTFVP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             ++  T+  N +++DGV V +   S +P   G I    ++RD     +Q+QLDE+AR L
Sbjct: 240 SATFDGTTVGNAVYVDGVAV-TGASSVMPLKSGAIAGYAEMRDVTTVTYQDQLDEVARGL 298

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGI-KDLDNKLCQGISETICVNPQY----RSNPSFLR 352
           I +F E D   G      GLF  +GI   +   L + ++ TI VN         + S LR
Sbjct: 299 ISAFQETDQSGGGGAAKSGLFT-NGIDTTVAGGLTRNLAATITVNTAAVVSKGGSVSTLR 357

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DGG     + +N  N A +   +     +      F     + + V+L  +A +S+ WLE
Sbjct: 358 DGGMNGAAYAYNTTNAASFGTRLAALQTAIKAQQTFSSTTQLTSGVSLQTFASSSVSWLE 417

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
             R+ + +     + + +  S + SN  GVN  +E +  +++E+SY  S+K++     M 
Sbjct: 418 GLRTSTTNKSETQKTLLSQASTAVSNASGVNTDQEYATQLQLEKSYQASSKILSAVQSMY 477

Query: 473 QTLLEGVK 480
             L   ++
Sbjct: 478 DALFSAIR 485


>gi|148558589|ref|YP_001258003.1| flagellar hook-associated protein FlgK [Brucella ovis ATCC 25840]
 gi|148369874|gb|ABQ62746.1| flagellar hook-associated protein FlgK [Brucella ovis ATCC 25840]
          Length = 464

 Score =  239 bits (610), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 153/486 (31%), Positives = 256/486 (52%), Gaps = 29/486 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A              Q +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVA--------------QSLRNDADREIADSVANINDLLAKFEKANQDVVG 165

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 166 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 225

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD      Q QLDE+AR L+
Sbjct: 226 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRD------QMQLDEIARGLV 279

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 280 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGADLSAGIAGTIEVSVPFIASEGGSALLLRD 338

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE 
Sbjct: 339 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEG 398

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML 
Sbjct: 399 KRQKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLD 458

Query: 474 TLLEGV 479
            LL  V
Sbjct: 459 DLLNAV 464


>gi|265993604|ref|ZP_06106161.1| FlgK [Brucella melitensis bv. 3 str. Ether]
 gi|262764474|gb|EEZ10506.1| FlgK [Brucella melitensis bv. 3 str. Ether]
          Length = 418

 Score =  234 bits (596), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 140/419 (33%), Positives = 231/419 (55%), Gaps = 9/419 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y  + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGRDRLSALYSAD-NYSGSPSGLIGDLRDALQTYVASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDCTRQVQSLRNDADREIADSVANINDLLAKFEKANQNVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL++ S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQRSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           GG+    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE
Sbjct: 359 GGANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLE 417


>gi|218461125|ref|ZP_03501216.1| flagellar hook-associated protein FlgK [Rhizobium etli Kim 5]
          Length = 313

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 184/319 (57%), Gaps = 8/319 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVQINRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L   S    QQ LL   E LK +M  +D Y  SP+ Y+   ++ L+++     
Sbjct: 61  DALLRQYLKTSSQDSAQQTLLGGLEDLKSIMGGND-YETSPSTYLGVFQEKLQAFRTTPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA+ADKEI   +  L   LS+    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQDVRANADKEIATAVDKLNTLLSQFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TAS  DA   LD+R+ +L++ISEI+G+S   R+NNDMV+ T DGT LFETVPR + F+ 
Sbjct: 180 ATASGTDASGALDEREKVLKQISEIVGVSATTRDNNDMVLSTPDGTILFETVPRKVTFKS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + YT +   N ++IDGV +   +GS    +G +++LLQIRD + P FQ QLDE+AR L+
Sbjct: 240 QDVYTASIVGNSVYIDGVALPLGKGSTTTGQGSLQSLLQIRDEIAPNFQKQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGL 317
             F E+     N+   PGL
Sbjct: 300 SLFKEQ-----NTAAPPGL 313


>gi|312115279|ref|YP_004012875.1| flagellar hook-associated protein FlgK [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220408|gb|ADP71776.1| flagellar hook-associated protein FlgK [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 489

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 128/384 (33%), Positives = 204/384 (53%), Gaps = 8/384 (2%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           IS L D L +Y+ +          +  A ++    N ++  VQ++RADAD  I   +S +
Sbjct: 106 ISALSDDLSTYAASPESTAAASAAVQAASDLSDALNAASDVVQQVRADADSAISDSVSTI 165

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              L++   VN+ I   T +  D  D LDQRD +LQ +S  IGIST+ R+NNDM +YT  
Sbjct: 166 NDLLAQFQTVNETIVKGTVTGADTTDALDQRDAILQSLSAEIGISTVTRSNNDMAIYTDS 225

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSV 282
           G TLF+   R ++FE  N++  +++ N +++DGV V+++  S  +  GK+  L+++RD +
Sbjct: 226 GVTLFDKAARSVSFEATNAFAASTQGNAVYVDGVPVTASGASYEIKSGKLAGLVEVRDDL 285

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIA-GNSENVPGLFIADG--IKDLDNKLCQGISETIC 339
              +Q+QLDE+AR LI +F E D  A G      GLF   G  +      + +G++  I 
Sbjct: 286 AVTYQDQLDEIARGLITAFQETDQSASGTGSAQAGLFTDSGSLVVPTSGTVSEGLAARIS 345

Query: 340 VNPQYRSNPSFLRDGG---SVSKKFLWNVK-NLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
           +     + P+ LRDGG   + +  +++N     +GY D ++   DS +    FD  AG  
Sbjct: 346 LASSVIATPTLLRDGGISTNGAAPYVYNPSPGQSGYTDRLDGLVDSLSSKMTFDTSAGAG 405

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           T+++L +YA  S  WL      +      S  V +  + + SN  GVNL  ELS ++ +E
Sbjct: 406 TSISLSDYAAASASWLGVKSQSASSTAAYSATVKSTAATALSNATGVNLDSELSKMLALE 465

Query: 456 QSYNISNKLIMFTDKMLQTLLEGV 479
           QSY  S KL+   D+M   LL  +
Sbjct: 466 QSYAASAKLVSAVDQMFSDLLNAI 489


>gi|304392492|ref|ZP_07374432.1| flagellar hook-associated protein FlgK [Ahrensia sp. R2A130]
 gi|303295122|gb|EFL89482.1| flagellar hook-associated protein FlgK [Ahrensia sp. R2A130]
          Length = 481

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 132/487 (27%), Positives = 254/487 (52%), Gaps = 13/487 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT--VVTQRSE 58
           MSL      AQN   N S+  +++ RNI  +D+ NYVRR+ ++ I+  N     +T R++
Sbjct: 1   MSLTQALGSAQNSLLNISRGTSTVARNISRSDDANYVRRE-LSNIAGANRAPQTITSRAQ 59

Query: 59  -NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +  +    + A S + GQ+ +    + +   ++  D   +SP   +++L++SL+ ++  
Sbjct: 60  LDAQLTRTQIDALSRSAGQEVIAGQLDRMAIAINGIDG-ESSPLAGLTRLQNSLQVWAAR 118

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S++ LG   +D+A  +V+  N + + V + R   D+  + ++++L   L        AI
Sbjct: 119 PSDETLGGAAVDSARTLVRGLNRAQQAVGEARLSIDRLAQDDVASLNGLLQRFKATERAI 178

Query: 178 KF---KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
                 + +   A D +D+RD L+++I++I+ +++I R++   ++ TS+G T+F+   R 
Sbjct: 179 AGNDDTSLTAEKAMDAMDERDNLIRQIAQIVPVTSIARSDRSTMLVTSNGATIFDDTART 238

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLDEM 293
           ++     S  V S+ + + +DGV + + QGS    +G +   LQ+RD  +   + QLD +
Sbjct: 239 VSL----SLPVGSQQSRVLVDGVPLPAAQGSDTDARGSLSGYLQLRDGALADQERQLDAI 294

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A  LI  F+E D   G +    GLF   G   +      G + +I ++P + +NP+ LRD
Sbjct: 295 AGQLISQFAETDLSGGGAPPAVGLFTWSGAPAVPGATAIGTARSIAIDPAFEANPNLLRD 354

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+     + N    A + DL+N   D+            I+  +T+ ++A  SIGWL+ 
Sbjct: 355 GGANGASTVANTSGGASFSDLLNQRIDALETPAAIGSATQISGTLTISQFASQSIGWLDG 414

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            RS +     +   +   +SE+ SN  GVN+ EE++ L+++E++Y  S +++   D++  
Sbjct: 415 ARSTASRAADEKSALATRLSENLSNEGGVNIDEEMTRLLQLERAYEASARIVSTVDRLFD 474

Query: 474 TLLEGVK 480
           TLL  ++
Sbjct: 475 TLLASIR 481


>gi|254473300|ref|ZP_05086697.1| flagellar hook-associated protein FlgK [Pseudovibrio sp. JE062]
 gi|211957416|gb|EEA92619.1| flagellar hook-associated protein FlgK [Pseudovibrio sp. JE062]
          Length = 479

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 237/488 (48%), Gaps = 17/488 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-TISPENVTVV----TQ 55
           MSL +    AQ+     S + A   RN+ N +N  Y R++ +   I  +  +VV      
Sbjct: 1   MSLTSAMLTAQSSIAARSAEMAIASRNVANVNNPGYSRQEAVVQNIVSDTGSVVYVSHAS 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           R  N+  F   L   S+AI         + L    S    +  S    I  L +++ SY 
Sbjct: 61  RMVNQAAFKATLKTGSAAIASGSYANMLDQLNP--SGQVPFGTSIASGIGTLGEAIVSYG 118

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            + S  +LG++V+++A  +V +   S+  +++ R +AD  +   + N+   LS+L  VN 
Sbjct: 119 NDPSNQVLGQSVVNSATALVDDIKQSSESLKETRLEADAAMGRAVDNINNILSDLEEVNG 178

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I   + +  D +  +DQRD +L+ +SE IGI+ + + NN + VYT  G TLFE V R++
Sbjct: 179 KIVTGSNAGQDVNSLMDQRDEMLRVLSEEIGITVLDQENNGVAVYTDSGVTLFEKVAREV 238

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEM 293
           +FE   S         I +DG+ V +  G+ +P   G I    +IRD  +   Q QLDE 
Sbjct: 239 SFETSLSLGSGEVGKNILVDGIAV-AGPGATMPVSGGAIAGYAKIRDDTLVTMQTQLDEA 297

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLF-IADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           A  L+ +F E  P  G +    GLF  A G  DL  +L   + +   VNP    +   LR
Sbjct: 298 AEALVDAFQETQP--GGTAPQDGLFTFAAGTGDLIGRLK--VHD--AVNPAAGGDVKLLR 351

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DGG     +  N  + AGY DL+  Y  + N+   FDP +G+N   TL ++A N++ W  
Sbjct: 352 DGGINGAAYKHNTGDNAGYSDLLKSYEAALNQERTFDPTSGVNPTSTLKDFASNTVSWFS 411

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
             R  + +        F+  ++  SN  GVN+  E+  L+ +E +Y+ S +L+   D+M 
Sbjct: 412 AERKIATETSTLDASAFSSNAQMLSNKTGVNIDTEMQRLLTIETAYSASARLMTAVDRMF 471

Query: 473 QTLLEGVK 480
           Q LL  V+
Sbjct: 472 QELLSAVR 479


>gi|90418364|ref|ZP_01226276.1| putative flagellar hook-associated protein FlgK [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90338036|gb|EAS51687.1| putative flagellar hook-associated protein FlgK [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 499

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 146/501 (29%), Positives = 253/501 (50%), Gaps = 30/501 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVT-QRSE 58
           MSLL+ F+ A    ++ + Q A + RNI NAD+    R+    T+     V +++  +S 
Sbjct: 1   MSLLSAFSNATASLSSVASQSALVSRNIANADSPYATRKYAGLTVGQTGGVRIMSIAQSG 60

Query: 59  NKNMFDKVLHAHSSAIGQQRL-LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
           ++ +F + L   +SA+G   +  QS   ++E++  D     SP   +S L+ +L  ++ +
Sbjct: 61  DQALF-RSLITTNSALGSASVSAQSLNRIREVI-GDVDSPTSPAATLSSLKAALSQFAVS 118

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  +  ++ A ++  + N +   VQ  R DAD +++L   ++ R L E   +N  I
Sbjct: 119 PENGQTAEAAVNAARDMALSLNRATSAVQSARKDADDQLDLAAKDMNRLLGEFGTLNAKI 178

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              +AS  D  D +D+RD +++ +S  +G++  VR  NDM +YT  G T+F+   R + F
Sbjct: 179 MAGSASGSDVTDAVDRRDQIVRTLSGYVGLNVQVRAGNDMALYTDSGITMFDKTARSVEF 238

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVP----KGKIKALLQIRDSVVPIFQNQLDEM 293
               +Y  T   N   IDGVVV+   G++ P     G +  L+ +RD     FQ QLD +
Sbjct: 239 TPQPAYDATVAGNSFKIDGVVVA---GASSPMPIKGGSVYGLITLRDETAATFQGQLDGI 295

Query: 294 ARVLIGSFSEKDP-IAGNSENVP----GLFIADGIKDLDNKL--CQGISETI----CVNP 342
           A  L+ +F+E D   AG+   +P    GLF   G   +   +   +G++ TI     V+P
Sbjct: 296 AYALVQAFAETDQRAAGDPGYLPGSYAGLFTDGGSNAIPASMAGAKGLAGTIQIAAGVDP 355

Query: 343 -QYRSNPSFLRDGG------SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
            +    P+ LRDGG      +  + F +N    +G+   +N     F+    FD   G  
Sbjct: 356 TKPGGEPARLRDGGIAFAGTANEQYFSYNANGSSGFTGRLNDLIAGFSMPRSFDAAFGAG 415

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           ++ TL EY  +SIGW E  R+ ++D      V+ +   E+ S+  G+N+ +E++ L+ +E
Sbjct: 416 SSATLTEYTASSIGWFEGRRATANDASSYQTVLLSRTQETLSDATGINIDDEMTRLLDLE 475

Query: 456 QSYNISNKLIMFTDKMLQTLL 476
           +SY  S+KLI    +M+ +LL
Sbjct: 476 RSYQASSKLISTVGQMIDSLL 496


>gi|300024587|ref|YP_003757198.1| flagellar hook-associated protein FlgK [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526408|gb|ADJ24877.1| flagellar hook-associated protein FlgK [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 487

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 140/491 (28%), Positives = 248/491 (50%), Gaps = 21/491 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT---QRS 57
           MSL    + A++     S+Q + + RNI    + +  R+   T +S   V V      R+
Sbjct: 1   MSLTLSTDTARSSLQATSEQISVVSRNIARVHDADATRK-IATLVSGPGVGVSVPRIDRT 59

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            ++ +F+  L A+S++  Q  +  +   L+  +  D    +SP   I+KL  +L++YS N
Sbjct: 60  SDQLLFNTYLTANSASQAQTSITSALGQLQSTVD-DTDQEHSPAALIAKLSATLQTYSGN 118

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                +  +V+  A+ V    N+++  V ++R  AD +I   ++N+   LS+   +N+ +
Sbjct: 119 PQNPAVAASVVSAAKNVSNALNSASATVTQVRQQADADIATSVANINDLLSQFENLNNQV 178

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              +++  D  D LD RD +L+++S  +GI T+ R N DM +YT  G TLF+  PR + F
Sbjct: 179 IRGSSNGRDVTDVLDARDAVLKQLSTEVGIRTVSRANGDMAIYTDSGVTLFDRAPRAVTF 238

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSA----VPKGKIKALLQIRDSVVPIFQNQLDEM 293
           E+  +    +    ++ DGV ++   G++    +  GK+  L+ +RD +   +Q+QLDEM
Sbjct: 239 EQTQNLAAGAPGGAVYADGVPIA---GTSHILEIQSGKLAGLMSVRDDIAVTYQSQLDEM 295

Query: 294 ARVLIGSFSEKDPIAGNSENVP---GLFIADGIKDLDNKLCQGISETICVN----PQYRS 346
           AR LI +F+E D  A  +  +P   GLF   G   +      G++ +I +N    P    
Sbjct: 296 ARGLINAFAETDQSA--TPTLPAATGLFTYSGGPAIPASAMAGLASSIKINASVDPGQGG 353

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           N   +RDGG     + +N  N   + D I     S N    FD    +  + ++++YA+N
Sbjct: 354 NAELIRDGGISGASYKYNSANAPAFTDRIQSLISSLNTGQTFDASTQLPASSSVMDYAKN 413

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
           S+ WLE  R  +         V    + S S   GVNL EE++ L+ +E+++  S++LI 
Sbjct: 414 SVSWLEALRQSATAEADYRSTVAQRATTSLSQATGVNLDEEMTNLLDLERTFQASSRLIN 473

Query: 467 FTDKMLQTLLE 477
             ++ML TL++
Sbjct: 474 TVNEMLSTLIQ 484


>gi|323137000|ref|ZP_08072080.1| flagellar hook-associated protein FlgK [Methylocystis sp. ATCC
           49242]
 gi|322397761|gb|EFY00283.1| flagellar hook-associated protein FlgK [Methylocystis sp. ATCC
           49242]
          Length = 490

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 152/478 (31%), Positives = 237/478 (49%), Gaps = 20/478 (4%)

Query: 18  SQQFASIVRNIENAD----NKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSA 73
           S Q + + RNI NA     N  Y +  T    S E + V   R  N  +F  +L A ++ 
Sbjct: 18  SSQISVVSRNISNAGRPGVNAKYSQIATAPNGSAEFLGV--GRMANVALFRSMLSATAA- 74

Query: 74  IGQQRLLQSFEALKEMMSA----DDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVID 129
             Q    Q  +AL ++  A    +   + SP   I++L  +L++YS     +   +  + 
Sbjct: 75  --QGSAAQISDALDQIDRALNLSNPAQSRSPASMITRLTTALQNYSAAPDNETAAELALA 132

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
            A +VV + N + +  Q IR  AD++I   + ++   L++ + +N  I   TA+  D  D
Sbjct: 133 AARDVVASLNDATKTNQGIRRQADEDIASSVKDVNDILAKFSALNREIVEGTAAGADITD 192

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSES 249
            LDQRD LL ++S  IG++T+ R NNDMV+YT  G TLFET PR + F+   + T   E 
Sbjct: 193 QLDQRDALLTQLSNEIGVTTVTRPNNDMVIYTDSGVTLFETTPRSVTFQPTPTLTAGVEG 252

Query: 250 NPIFIDGV-VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIA 308
             ++IDGV V  ++   A+  G I    Q+RD   P FQ QLDE+AR L+ +F+E D   
Sbjct: 253 AAVYIDGVQVTGADSPLALKSGAINGFAQVRDVTAPQFQKQLDEIARGLVAAFAETDQTG 312

Query: 309 GNSENVPGLFIADGIKDLDNK-LCQGISETICVN----PQYRSNPSFLRDGG-SVSKKFL 362
           G    +PGLF   G        L  G++  I +N    P      S LRDGG S +  ++
Sbjct: 313 GGGAPLPGLFTYPGAPGAPGSMLIPGLAGQITINANVDPDKGGVVSRLRDGGISGNPDYV 372

Query: 363 WNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLH 422
           +N    A Y + +    ++ +    FDP AG+  + +L   A  SIGWL   R+ +    
Sbjct: 373 YNKSGGAAYSERLLQLVNAPSTQQGFDPGAGLGASGSLNAIAAGSIGWLGAQRAQAEKNV 432

Query: 423 MKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
                +    +++ SN  GVNL +++S ++ +E SY  S KL+   + M  TL   V+
Sbjct: 433 TYQDAMVAQTTQALSNATGVNLDDQMSQMLALENSYQASAKLLETINAMFDTLFAAVR 490


>gi|217976241|ref|YP_002360388.1| flagellar hook-associated protein FlgK [Methylocella silvestris
           BL2]
 gi|217501617|gb|ACK49026.1| flagellar hook-associated protein FlgK [Methylocella silvestris
           BL2]
          Length = 496

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 151/498 (30%), Positives = 242/498 (48%), Gaps = 21/498 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENA-DNKNYVRR--DTMTTISPENVTVVTQRS 57
           MSL      AQ+   + + + A++ RNI  A D   Y R+  + ++T S   VT ++ R+
Sbjct: 1   MSLANAAAIAQSGLASVTTEIATLSRNISGANDTSVYSRKIANVVSTASGSQVTSIS-RA 59

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMS-------AD-DHYNNSPTHYISKLRD 109
            ++ +F+ VL+A S+   +  +    EAL   +        AD      SP   IS+L D
Sbjct: 60  SSQAVFENVLNATSAIAAEDAVSTGLEALATTVGDVASAAGADATSTATSPAALISRLSD 119

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L+ YS + S+      V+  A  + +  N  +  +Q+ RA AD +I   +S++   L++
Sbjct: 120 ALQYYSGSPSDMTAAANVVSAANALARGLNQGSAAIQQARATADSDIAAAVSDINSQLAQ 179

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
              VN+ I   TA   D+ D  DQRD +L++IS  IGIST+   N DM +YT  G TLF+
Sbjct: 180 FQEVNEKIIAATAVGKDSTDLQDQRDTILKQISANIGISTVTAGNGDMSLYTDSGVTLFQ 239

Query: 230 TV-PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQ 287
               R ++F    +Y   +    +++DGV ++    + A+  GKI  L  IRD+V   +Q
Sbjct: 240 GGRARTVSFTPTTTYVTATVGQAVYVDGVAITGATATMAIASGKIAGLATIRDAVAVTYQ 299

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFI---ADGIKDLDNKLCQGISETICVNPQY 344
            QLD +A  LI +F E D  A    ++PGLF    A  I      L   I     V+P  
Sbjct: 300 AQLDGVASALITAFRESDQ-AAVGPDLPGLFTTASATAIPSSAAGLASAIIVNAAVDPSQ 358

Query: 345 RSNPSFLRDGGSV---SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLL 401
             + + LRDGG        + +N    A +   I+   D+ +    F     + T+ ++ 
Sbjct: 359 GGDLTLLRDGGIADPSGTDYTYNTSGAASFAGRISELIDNLSATQSFSSSGSLTTSASVG 418

Query: 402 EYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
            YA  S+ WLE  RS +         + +  S + SN  GVN+ +E+S ++ +EQSY  S
Sbjct: 419 GYAAASVSWLEAQRSAASSRSSYQGALLSTASTALSNATGVNINDEMSKMLDLEQSYAAS 478

Query: 462 NKLIMFTDKMLQTLLEGV 479
            KL+   + M   LL G+
Sbjct: 479 AKLLSSINDMFNALLSGI 496


>gi|182680456|ref|YP_001834602.1| flagellar hook-associated protein FlgK [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636339|gb|ACB97113.1| flagellar hook-associated protein FlgK [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 493

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 244/495 (49%), Gaps = 19/495 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV----VTQR 56
           MSL +     Q+  +  S + +   RNI  A++     R ++  +S  N  V    VT R
Sbjct: 1   MSLTSAMGVTQSALSAFSAETSVTSRNIAGANSTGLYSRKSIDVVSSNNSGVEVLSVT-R 59

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
           ++N+ +F  +L + + +  Q  L    +AL + +  D   + SP   +S L++SL++ + 
Sbjct: 60  AQNQALFGDLLGSTAVSAKQDALSSGLDALYQTI-GDTTDSISPAALLSNLQNSLQTLAA 118

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           + S+ +  + V+  A+ +    N ++  VQ +R  AD  +   +S +   L +   +N  
Sbjct: 119 SPSDMVQAQDVVGKAQALTDGLNNASSTVQSVRQQADGNMASSVSTINSLLGQFQTLNTQ 178

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I     S  D  D LD RD +LQ++S  +GI+T   ++N M ++T  G TLF+   R + 
Sbjct: 179 IVSGGKSGADVTDLLDSRDNILQQLSHQVGITTTSNSDNSMSIFTDSGVTLFQDKARTVT 238

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMA 294
           F    +Y   +  N + +DGV + + + S +P   GK+  L  +RD+V   +Q QLD +A
Sbjct: 239 FVPTTTYVAGTIGNSVMVDGVPI-TGKSSPMPIQSGKLAGLADLRDNVTTTYQAQLDGIA 297

Query: 295 RVLIGSFSEKDPIAGN--SENVPGLFIADGIKDLDNKL-CQGISETICVN----PQYRSN 347
             LI +F+E D       + + PGLF   G   L + L   G++  I VN    P+   N
Sbjct: 298 GTLINAFAESDQSGATPPAASQPGLFTYSGAPALPSSLNMTGLAAGIRVNSNVDPKQGGN 357

Query: 348 PSFLRDGG---SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            + LRDGG     S  + +N    A Y   +N    +F++   F   A ++T+ +L +++
Sbjct: 358 LTLLRDGGISDPASTTYTYNTTGAASYVGRLNGMLAAFDQTQSFSNAANLSTSSSLTDFS 417

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
             S  WL   R  +       + V + ++ + SN  GV+L  E+S ++ +EQSY+ S KL
Sbjct: 418 TASAAWLNGQRQSASTASDYQKTVVSSVTSALSNATGVSLDTEMSKMLDLEQSYSASAKL 477

Query: 465 IMFTDKMLQTLLEGV 479
           +   + M Q+LL  V
Sbjct: 478 MSTINTMFQSLLTAV 492


>gi|121601813|ref|YP_989382.1| flagellar hook-associated protein FlgK [Bartonella bacilliformis
           KC583]
 gi|120613990|gb|ABM44591.1| flagellar hook-associated protein FlgK [Bartonella bacilliformis
           KC583]
          Length = 456

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 241/483 (49%), Gaps = 30/483 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           M+L +  N A+N     + QF  + +NI  A + NY RR +     P   V V  +R ++
Sbjct: 1   MALSSALNTARNSLKATTSQFDVVAKNIAGARDPNYTRRTSYLESGPRGAVHVAVRRDDS 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             + D  L   S A     L      L E+  AD  ++NSP+  +S  + +L++Y+ +  
Sbjct: 61  PFLLDNYLVKSSQAAAAGSLANGLHRLAEIHGAD-GFSNSPSQLLSDFQKALQAYANDPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   G   +D A ++V   N   RE++K+R DAD +I+  + ++   L +   ++  +  
Sbjct: 120 QRAAGDAAVDRARDLVNALNKGNREIEKLRNDADSDIQDSVDHINDLLQKFHDLDQKVVQ 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  +  DA+ ++DQRD +L+++S+ IGI+T+   +    +Y  DG+TL++  PR + FE 
Sbjct: 180 EKNAGRDAYSYMDQRDAVLKQLSQEIGINTVSHQDGSTSIYGMDGSTLYDKSPRKVTFES 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            NS         +F+DGV +           G +  LL++RD + P +Q QLDEMA  L+
Sbjct: 240 SNSLPAGVAGKQVFVDGVPLGHPSFVEPNGGGNLGGLLKVRDEMAPQYQKQLDEMASALM 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F    P+  +S+   G                G+S  I +NP + SN       G   
Sbjct: 300 SIFPGPPPLFLDSDKPEGEI----------GPMVGLSGRIKLNPIFDSNTP-----GGGP 344

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
           + F  ++++L           D+F++   F    G+ T  +L+ + +NS+GWLE  RSD+
Sbjct: 345 EHFGKDIQSL----------VDAFDQKREFGSDTGLATEQSLMSFGKNSMGWLEGVRSDA 394

Query: 419 HDLHMKSQ-VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
            D + K Q  +F   +E+ SN  GVN  +E++ ++++EQ+Y  + ++I    KML  L+ 
Sbjct: 395 -DKNAKYQGTMFARAAEALSNETGVNTDDEMAVMLQLEQAYAATTRIISTVGKMLDDLMI 453

Query: 478 GVK 480
            ++
Sbjct: 454 AIR 456


>gi|170744544|ref|YP_001773199.1| flagellar hook-associated protein FlgK [Methylobacterium sp. 4-46]
 gi|168198818|gb|ACA20765.1| flagellar hook-associated protein FlgK [Methylobacterium sp. 4-46]
          Length = 483

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 132/490 (26%), Positives = 228/490 (46%), Gaps = 18/490 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--NVTVVTQRSE 58
           M L      A++    +S Q A   RN+  A +  Y R+  + T+ P    VTV   R+ 
Sbjct: 1   MGLSLALATARSSLLASSTQIAVSSRNVAGASSAGYSRK--IATLVPGTGGVTVSITRAS 58

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  ++ +++ A S   G Q+LL+  ++L++ +   D  + +          +    + N 
Sbjct: 59  DAALYARMISATSDLAGSQQLLRGLQSLQQTVG--DPQSTTSAAARLSALAAALQSAANR 116

Query: 119 SED-ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            +D  L +  +D A ++  + N +A  V + +ADAD  +   ++ +   LS+  + N A+
Sbjct: 117 PDDATLARAALDKARDLAASLNQAAGAVARTQADADAAMGESVTRISDLLSQFDLANKAV 176

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              TA   D  D LD RD ++ K+SE +G++ + R   D+ +YT  G  L++ +PR ++F
Sbjct: 177 MRGTALGADVTDALDSRDQIIAKLSEELGVTVVPREGGDVALYTDSGVPLYDRIPRKVSF 236

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMAR 295
               +Y   +  N + IDGV V+    S +P   G +  L Q+RD   P +  QLDE+A 
Sbjct: 237 AATPTYQSGTTGNAVIIDGVAVTGPN-SPMPLRSGTLAGLSQLRDVAAPAYAAQLDEIAS 295

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNK---LCQGISETICVNPQYRSNPSFLR 352
            LI +F E     G   ++ GLF       L +    L   I+    V+PQ   +P+ LR
Sbjct: 296 ALIATFRETSSSGG--ADLAGLFRNGSTSALPSSKAGLAAAITLNAAVDPQRGGDPALLR 353

Query: 353 DGGSVSKKFLWN---VKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
           DGG     +  N     +   Y   +     + +         G   ++ L EYA  S G
Sbjct: 354 DGGMNGAAYRSNPAAAGSGTAYAGRLTALVAALSAKQSLGSAPGPTGSMALAEYAGASAG 413

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
           WLE  R  +     +   +    S++ SN  GVN  +E +  +++E+SY  S KL+   D
Sbjct: 414 WLESQRKVASSTVDQQTTLLGRASDALSNVTGVNTDDETALTLQLERSYQASAKLVTLID 473

Query: 470 KMLQTLLEGV 479
           ++ +TL+  V
Sbjct: 474 ELFKTLMNAV 483


>gi|170748124|ref|YP_001754384.1| flagellar hook-associated protein FlgK [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654646|gb|ACB23701.1| flagellar hook-associated protein FlgK [Methylobacterium
           radiotolerans JCM 2831]
          Length = 485

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 142/489 (29%), Positives = 236/489 (48%), Gaps = 13/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR--DTMTTISPENVTVVTQRSE 58
           M L    N A+      + Q   + RN+  A + +Y R+    +TT  P  V VV  R+ 
Sbjct: 1   MGLSVALNAARGSLQANAIQTDVVSRNVAGAYDPSYSRKIASVITTDGP--VRVVINRAS 58

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  +FD+++ + S   G Q +L    +L++ +  D     S    +  L  +L   +   
Sbjct: 59  STALFDRMMGSTSELAGYQAVLDGLTSLEDTVG-DTDAGRSIAAKVGALNIALGDAAGEP 117

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           ++  L K  +  A ++ +  N ++ ++Q  R +AD EI   ++ +   L +    N A+ 
Sbjct: 118 NDINLAKAAVAAARDLARALNQASSKIQATRLNADHEIRTSVTTINDLLRKFDAANSAVV 177

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T    D  D LD RD +L ++S+ IGISTIVR NNDM +Y  +G+ LFE  PR + FE
Sbjct: 178 LGTVRGEDISDALDNRDKILAQLSQEIGISTIVRENNDMAIYADNGSPLFERGPRTVTFE 237

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARV 296
              ++   +    +F+DGV V +  GS +P   G+I   + +RD +   +Q QLD +A  
Sbjct: 238 STAAFVPGTAGKAVFVDGVQV-TGHGSVMPLQTGRIVGQMTVRDDLTVTYQKQLDAIAGG 296

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLR 352
           LI + +E D  +     + GL    G   L      G++ TI VN    P+   NP  LR
Sbjct: 297 LIAALAETDSTSLGGTPLAGLLTYPGGPALPAAGTVGLAGTIRVNPAADPEQGGNPFTLR 356

Query: 353 DGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
           DGG +   ++ +N  N A + + +     +      F P + +    TL   A  S  WL
Sbjct: 357 DGGMNAGPQYAYNTTNAAAFAEHLRALRAALGAERTFLPDSELPHAATLQVAAETSASWL 416

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           E  R  +     +   + +  S + SN  GVN  +E++ ++++E+SY  S KLI   + M
Sbjct: 417 EATRQGASKQVDRESALLDSASTALSNATGVNRDDEVATMLQLEKSYAASAKLIATVNAM 476

Query: 472 LQTLLEGVK 480
           LQ+LL+ V+
Sbjct: 477 LQSLLDAVR 485


>gi|118589965|ref|ZP_01547369.1| flagellar hook-associated protein K [Stappia aggregata IAM 12614]
 gi|118437462|gb|EAV44099.1| flagellar hook-associated protein K [Stappia aggregata IAM 12614]
          Length = 454

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 217/416 (52%), Gaps = 13/416 (3%)

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
           Q+ +L     L E  + D     S    +  L+ SL+SY+ + S  I  + V+  ++++V
Sbjct: 41  QEAVLAGLIRLAET-TGDTQNQMSAAAKLGALKLSLQSYASDPSNAIQAQDVLQASKDMV 99

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
           +   + +  VQ +R  AD ++   +  +   L +L  +N  I   T S  D  D  D RD
Sbjct: 100 RTLQSGSELVQDVRTKADADMATSVREINTLLKQLEDLNSVIVRGTQSGADVTDAHDSRD 159

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
            +L K+SE IGI+T+ R+N D+VVYT  G TLFET  R + FE    Y   +  N + +D
Sbjct: 160 QVLLKLSEEIGITTLNRSNGDIVVYTDSGVTLFETKARSVTFEPTIVYGAATTGNSVMVD 219

Query: 256 GVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENV 314
            V V+       +  G+++ L ++RD V   +Q+QLDE+AR LI +F+E D   G + + 
Sbjct: 220 DVPVAGPGALMEIKSGRLQGLAELRDEVAVTYQSQLDEIARGLIEAFAESDQSGGGNPDQ 279

Query: 315 PGLFIADGIKDL--DNKLCQGISETICVN----PQYRSNPSFLRDGG---SVSKKFLWNV 365
            GLF   G   +     L  G++  I VN    P    +   LRDGG    +   + +N 
Sbjct: 280 AGLFTWSGAPAVPASGTLVTGLAAEIAVNANADPDQGGDLDRLRDGGISDPLDPNYNYNP 339

Query: 366 KNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD-SHDLHMK 424
              AG+ D +     +F+K+ +FD    ++   +L  +A +S+ WLE  R   + ++ ++
Sbjct: 340 SGAAGFSDRLQELVSAFDKDTVFDSGVELDATDSLSGFAASSVSWLEAGRKTMTSNVEVQ 399

Query: 425 SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           + V+ +  +E+ +N  GVN+ EE++ L+++E+SY+ + +LI   D ML+ LL   +
Sbjct: 400 T-VILSRTAENLNNKTGVNIDEEMTLLLEIERSYSAATRLISAVDAMLEDLLAAAR 454


>gi|261318809|ref|ZP_05958006.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|265987184|ref|ZP_06099741.1| FlgK [Brucella pinnipedialis M292/94/1]
 gi|261298032|gb|EEY01529.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|264659381|gb|EEZ29642.1| FlgK [Brucella pinnipedialis M292/94/1]
          Length = 382

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 204/377 (54%), Gaps = 9/377 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAG 370
           GG+    + +NV+  AG
Sbjct: 359 GGANGANYKYNVQGAAG 375


>gi|261219812|ref|ZP_05934093.1| FlgK [Brucella ceti B1/94]
 gi|261756172|ref|ZP_05999881.1| flagellar hook-associated protein [Brucella sp. F5/99]
 gi|265996847|ref|ZP_06109404.1| FlgK [Brucella ceti M490/95/1]
 gi|260918396|gb|EEX85049.1| FlgK [Brucella ceti B1/94]
 gi|261736156|gb|EEY24152.1| flagellar hook-associated protein [Brucella sp. F5/99]
 gi|262551144|gb|EEZ07305.1| FlgK [Brucella ceti M490/95/1]
          Length = 382

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 207/377 (54%), Gaps = 9/377 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD-TMTTISPENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR  ++ + S  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGSYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQ 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+
Sbjct: 240 SAVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLV 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK-LCQGISETICVNPQYRSNPS----FLRD 353
             F+E D   G+S +  GLF   G   +    L  GI+ TI V+  + ++       LRD
Sbjct: 300 TVFAESDQT-GSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRD 358

Query: 354 GGSVSKKFLWNVKNLAG 370
           GG+    + +NV+  AG
Sbjct: 359 GGANGANYKYNVQGAAG 375


>gi|114706627|ref|ZP_01439528.1| flagellar hook-associated protein K [Fulvimarina pelagi HTCC2506]
 gi|114538019|gb|EAU41142.1| flagellar hook-associated protein K [Fulvimarina pelagi HTCC2506]
          Length = 469

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 137/492 (27%), Positives = 243/492 (49%), Gaps = 42/492 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR---DTMTTISPENVTVVTQRS 57
           MSLL+VFN A++  +  SQQ A + RN+ NAD+    R+        +   ++  ++Q S
Sbjct: 1   MSLLSVFNNARSSLSVTSQQSALVARNVANADDPTATRKYASQVSERLGAVDIRAISQ-S 59

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +  ++  ++ A +S    + L ++ + +++++  D   + SP+  I+ L+D+L   + +
Sbjct: 60  SDPALYRSLISAQASLGTNETLAEALDRVRDVI-GDVDASTSPSASIAALKDALTDLAAS 118

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                L +T +D A  +  N N +   VQ +RADAD+E++     L   LS+L  +N  +
Sbjct: 119 PENSQLQRTAVDAARSLATNLNNATMSVQTMRADADRELDEGAKRLNELLSQLETLNSKV 178

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              TA+  D  D +DQRD ++ +IS  +G+S  +R NND+V+ T  G  +FET  R + F
Sbjct: 179 VAGTATGADVTDEVDQRDRIVSEISSYVGVSVRLRANNDLVLSTDSGIVMFETRARSVEF 238

Query: 238 EKMNSY-------TVTSESNP--IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
            +  S+       +  + + P    IDGV +      AV  G + A L++RD V   FQN
Sbjct: 239 TRTQSFDPSIRLDSAVAANRPGEFKIDGVSIGGTSSMAVRDGSLVAALKLRDEVGVEFQN 298

Query: 289 QLDEMARVLIG-SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR-- 345
           +LD+    L+  +F+E           PGL+   G   +           I  +  YR  
Sbjct: 299 RLDQTGDTLVNETFAEN--------GAPGLYERTGPATI----------AIAASVDYRIG 340

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNV-TLLEYA 404
            NP+ +RDGG ++    +N    +G+ D +N     F+    F      N  + TL ++ 
Sbjct: 341 GNPALIRDGG-INGSPTFNTAGESGFADRLNALVARFSDQHTF-----ANGELGTLGDFT 394

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
            +S+ W E  R+ +        ++     ++ SN  G+NL +E+S L+++E++Y  S KL
Sbjct: 395 ASSMAWFEGRRATASKDASYQSIMVTRARDTLSNKTGINLDDEMSHLLELERTYQASTKL 454

Query: 465 IMFTDKMLQTLL 476
           +    ++L  LL
Sbjct: 455 VQTVGELLDRLL 466


>gi|218681812|ref|ZP_03529559.1| flagellar hook-associated protein FlgK [Rhizobium etli CIAT 894]
          Length = 286

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 164/286 (57%), Gaps = 3/286 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQ I NN   Q + +  NI NA NK+YVRR  M T S     VV   R++ 
Sbjct: 1   MSLTSALNTAQGIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L + S    QQ LL   + LK +M  +D Y  SP+ Y+   +  L+++     
Sbjct: 61  DALLRQYLKSSSQDSAQQALLSGLDDLKSIMGGND-YETSPSTYLGVFQQKLQAFRTAPG 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
             +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   LS+    N+A+K 
Sbjct: 120 STVAAQGAITAAQDVANSLNNASQSVQDVRAGADKQIATDVDKLNTLLSDFEKANNAVKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TAS  DA   LD+R+  L++IS+I+G++T  R+NNDMV+ T+DGT LFETVPR + F+ 
Sbjct: 180 ATASGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTTDGTILFETVPRKVTFKS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVP 284
            + YT T   N +++DGV +    G+    +G +++LLQ+RD + P
Sbjct: 240 QDVYTATILGNSVYVDGVALPRGSGATTTGQGSLQSLLQVRDEIAP 285


>gi|188579926|ref|YP_001923371.1| flagellar hook-associated protein FlgK [Methylobacterium populi
           BJ001]
 gi|179343424|gb|ACB78836.1| flagellar hook-associated protein FlgK [Methylobacterium populi
           BJ001]
          Length = 489

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 140/503 (27%), Positives = 225/503 (44%), Gaps = 37/503 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           M L    N A+      S Q A   RN+  A++  Y R+  T+   S    TV   R+ +
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSAGGATVTITRAGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             ++ + L A S A     LL     L + +  D    ++P   +S  + +L++ +    
Sbjct: 61  PALYARTLTASSDAARGDALLTGLTKLAQTIG-DTDDTSAPAARLSIFQAALQAAANQPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              L +  ++ A+ +  + N +A  V  +RA+AD  I   +  +   L      N A+  
Sbjct: 120 NTQLARDAVEAAKALAGSLNQAADTVHAVRAEADAGIGDAVGRINDLLGRFDAANRAVVK 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA   DA D LD RD +L  +S+ IG++ + R   DM +YT  G TLFE  PR + F  
Sbjct: 180 ATALGGDATDALDDRDRILTALSQEIGLTAVSREGGDMALYTDGGVTLFERGPRTVAFSP 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP----KGKIKALLQIRDSVVPIFQNQLDEMAR 295
             ++T  +    + IDGV V+   G+A P     G+I  L  +RD     ++ QLD +A 
Sbjct: 240 TATFTAGTVGGSVTIDGVPVT---GTASPMPLTSGRIAGLAALRDGTAVAYEAQLDAVAG 296

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ---GISETICVN----PQYRSNP 348
            LI +F+E D    +     GLF A G   L         G++ ++ +N    P    N 
Sbjct: 297 GLIAAFAESDTSLIDDGPRAGLFTAGGSALLPTASAAGRTGLAASLAINAAVDPNRGGNL 356

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPD-----------LINHYCDSFNKNFIFDPVAGINTN 397
           + LR GG           N + Y D            +     + + +   DP  G+ T 
Sbjct: 357 ALLRSGG----------MNGSDYDDPAAGGDAAYAGRLRGLVTALSSSKPVDPALGLGTA 406

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            +L E A  S GWLE  R D+       + +    +E+ SN  GVN  +E +  +++E+S
Sbjct: 407 SSLPELAAASAGWLEAQRKDAATGAAYQKTLLTRANEALSNVAGVNGDDETALALQLERS 466

Query: 458 YNISNKLIMFTDKMLQTLLEGVK 480
           Y+ S KLI   + +L+TLL+ V+
Sbjct: 467 YSASAKLIAVVNDLLKTLLDAVR 489


>gi|319409168|emb|CBI82812.1| Flagellar hook-associated protein FlgK [Bartonella schoenbuchensis
           R1]
          Length = 456

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/482 (25%), Positives = 236/482 (48%), Gaps = 28/482 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           M   +  N A+N     + Q   + +N+  A + NYVRR +     P+  V ++ +R  +
Sbjct: 1   MGFNSTINTARNSLKATTGQLGIVSQNVVGAQDPNYVRRTSYIESGPKGAVHLMVRRDGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            ++ +  L   S A     +      L  +   D+ ++ +P+  +S  + +L++Y+ +  
Sbjct: 61  IHLLNNYLVKSSQAAVSGSVANGLNRLSNIYGVDE-FSRAPSQLLSDFQKALQTYANDPQ 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   G   +D A ++V + N   RE++K+R DAD +I+  + ++   L +   ++  +  
Sbjct: 120 QRFAGDAAVDRARDLVYSLNEGNREIEKLRNDADSDIQDSVDHINDLLQQFHELDQYVVR 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  +  D   ++DQRD +L+ +S+ IGI+T+  ++  M +Y  DG+TL++  PR++ F+ 
Sbjct: 180 ERNAGRDDSIYMDQRDTVLKALSQEIGINTVYHSDGSMTIYGMDGSTLYDKTPREVTFQS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             S         +F+DGV +           G +  LL+IRD + P +Q QLDEMA  L+
Sbjct: 240 SGSLPAGVAGKQVFVDGVPLGHPSFVEPNGGGNLGGLLRIRDEIAPQYQKQLDEMANALL 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F             P LF+ D   D      +G+S  I +N  + SN       G   
Sbjct: 300 QMFP----------GPPSLFLDDNQPDGVIGPIEGLSGRIRLNSVFDSNTE-----GGGP 344

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
           + F  ++++L           D+F++   F    G+    +++++++NSIGWLE  RSD+
Sbjct: 345 EHFGEDLQSL----------VDAFDQKRTFGTDTGLFPEQSIMDFSKNSIGWLEGLRSDA 394

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                    +F H SE+ SN  GVN  +E+  ++++EQ+Y  + ++I    KML  L+  
Sbjct: 395 DKDAKYHSTMFLHASEALSNGTGVNTDDEMVLMLQLEQTYAATTRIISTVGKMLDDLMIA 454

Query: 479 VK 480
           ++
Sbjct: 455 IR 456


>gi|319406995|emb|CBI80632.1| Flagellar hook-associated protein FlgK [Bartonella sp. 1-1C]
          Length = 456

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 126/482 (26%), Positives = 238/482 (49%), Gaps = 28/482 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           MSL    N A+N     + +  ++ RN+  A + NY RR +     P   V VV +R  +
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNVVKAGDPNYTRRTSYLEAGPGGAVHVVVRRDSD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            ++ +  L   S A     L      L ++  +D  ++NSP+  + + + +L+ Y+ +  
Sbjct: 61  IHLLNNYLVKASEAAAAGSLSNGLNRLSDIYGSD-RFSNSPSKLLGEFQKALQLYANDPQ 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   G   +D A ++ +  N  +RE++K+  D + +I+  +  +   L +   ++  +  
Sbjct: 120 QRSNGDAAVDRARDLAKGLNAGSREIEKLYNDVNSDIQDSVDYINDLLQKFHELDQLVVR 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  ++ D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+ 
Sbjct: 180 ERNARRDDSVYMDQRDAVLKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKMPRTVSFQF 239

Query: 240 MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             S         IFIDGV +  S+       G +  LL++RD ++P +Q QLDEMA  L+
Sbjct: 240 STSLPSGISGKQIFIDGVPLGHSSFIDPNGGGNLGGLLKLRDDIIPQYQRQLDEMANALM 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F             P LF+            +G++  I +NP + S      +GG   
Sbjct: 300 QMFL----------GPPSLFLDGNQPSGQIGALEGLAGRIQLNPIFDSKT----EGGGPE 345

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                       + D +    DSFN+   F    G++   +++++ +NS+GWL+  RS++
Sbjct: 346 H-----------FGDKLQELVDSFNEKQKFGTGTGLDPEQSIMDFGKNSVGWLQGLRSNA 394

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                    +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  
Sbjct: 395 DKEARYKGTMFLHAAEALSNATGVNTDDELALMLQLEQTYGATSRIISTVGKMLDDLLAA 454

Query: 479 VK 480
           V+
Sbjct: 455 VR 456


>gi|319405422|emb|CBI79041.1| Flagellar hook-associated protein FlgK [Bartonella sp. AR 15-3]
          Length = 456

 Score =  193 bits (490), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 130/482 (26%), Positives = 239/482 (49%), Gaps = 28/482 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           MSL    N A+N     + +  ++ RN+  A + NY RR +     P   V VV +R  +
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNVVRAGDPNYTRRTSYLESGPGGAVHVVVRRDGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            ++ +  L   S A     L      L ++  AD  ++NSP+  + + + +L+ Y+ +  
Sbjct: 61  IHLLNNYLVKASEAAASGTLSNGLNRLSDIYGAD-KFSNSPSKLLGEFQKALQLYANDPQ 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   G+  +D A ++ +  N  +RE++K+  D + +IE  ++ +   L +   ++  +  
Sbjct: 120 QRSNGEAAVDRARDLAKGLNAGSREIEKLCNDVNSDIEDSVNYINGLLQKFHELDQLVVR 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  +  D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+ 
Sbjct: 180 ERNANRDDSVYMDQRDAVLKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKIPRTVSFQF 239

Query: 240 MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             S         IFIDGV +  S+       G +  LLQ+ D ++P +Q QLDE+A  LI
Sbjct: 240 STSLPPGISGKQIFIDGVPLGHSSFIDPNGGGNLGGLLQLCDDIIPQYQKQLDEIANALI 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F             P LF+            +G++  I +NP + S        G   
Sbjct: 300 QMFP----------GPPSLFLDGDQPSGQISALEGLAGRIQLNPIFDSKTE-----GGGP 344

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
           + F  N++ L           D+FNK   F    G++T  +++++ +NS+ WLE  RS++
Sbjct: 345 EHFNDNLQEL----------VDAFNKKQKFGTGTGLDTEQSIMDFGKNSVSWLEGLRSNA 394

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                    +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  
Sbjct: 395 DKETRYQGAMFLHAAEALSNATGVNTDDELALMLQLEQTYGATSRIISTVGKMLDDLLAA 454

Query: 479 VK 480
           V+
Sbjct: 455 VR 456


>gi|163850124|ref|YP_001638167.1| flagellar hook-associated protein FlgK [Methylobacterium extorquens
           PA1]
 gi|163661729|gb|ABY29096.1| flagellar hook-associated protein FlgK [Methylobacterium extorquens
           PA1]
          Length = 487

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 134/489 (27%), Positives = 224/489 (45%), Gaps = 11/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           M L    N A+      S Q A   RN+  A++  Y R+  T+   S    TV   R+ +
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             ++ + L+A S A     LL     L + +  D     +P   ++  + +L++ +    
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVG-DTDDPTAPAARLTTFQAALQAAANQPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+  
Sbjct: 120 NAQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFDAANRAVTK 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F  
Sbjct: 180 TTALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            + +   +    + IDGV V+    S +P   G+I  L+ +RD     ++ QLD +A  L
Sbjct: 240 TSVFAAGTVGGGVRIDGVPVTGAT-SPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGL 298

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ-GISETICVN----PQYRSNPSFLR 352
           I +F+E D +  +S    GLF A G   L     + G++ +I VN    P    + + LR
Sbjct: 299 IDAFAESDAVGFDSGPRAGLFTAGGSGTLPTAAGRTGLAASISVNAAVDPARGGSVALLR 358

Query: 353 DGGSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
            GG     +              +     + +     DP  G+ T+  L + A +S GWL
Sbjct: 359 SGGMNGSDYADPAAGGDAAYAGRLRGLLTALSAARPVDPALGLGTSAGLPDLAASSAGWL 418

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           E  R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +
Sbjct: 419 EAQRKDASTDASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISVVNDL 478

Query: 472 LQTLLEGVK 480
           L+TLL+ V+
Sbjct: 479 LKTLLDAVR 487


>gi|240137258|ref|YP_002961727.1| FlgK protein [Methylobacterium extorquens AM1]
 gi|240007224|gb|ACS38450.1| FlgK protein [Methylobacterium extorquens AM1]
          Length = 487

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 134/489 (27%), Positives = 220/489 (44%), Gaps = 11/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           M L    N A+      S Q A   RN+  A++  Y R+  T+   S    TV   R+ +
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             ++ + L+A S A     LL     L + +  D     +P   ++  + +L++ +    
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVG-DTDDPTAPAARLTTFQAALQAAANQPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+  
Sbjct: 120 NAQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFDAANRAVTK 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F  
Sbjct: 180 TTALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            + +   +    + IDGV V+    S +P   G+I  L+ +RD     ++ QLD +A  L
Sbjct: 240 TSVFAAGTVGGGVRIDGVPVTGAT-SPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGL 298

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLD-----NKLCQGISETICVNPQYRSNPSFLR 352
           I +F+E D +  +S    GLF A G   L        L   IS    V+P    + + LR
Sbjct: 299 IDAFAESDAVGLDSGPRAGLFTAGGSGILPPAAGRTGLAASISVNAAVDPARGGSVALLR 358

Query: 353 DGGSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
            GG     +              +     +       DP  G+ T+  L + A +S GWL
Sbjct: 359 SGGMNGSDYADPAAGGDAAYAGRLRGLLTALTAARPVDPALGLGTSAGLPDLATSSAGWL 418

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           E  R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +
Sbjct: 419 EAQRKDASTEASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISVVNDL 478

Query: 472 LQTLLEGVK 480
           L+TLL+ V+
Sbjct: 479 LKTLLDAVR 487


>gi|319403979|emb|CBI77567.1| Flagellar hook-associated protein FlgK [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 456

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 125/482 (25%), Positives = 237/482 (49%), Gaps = 28/482 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           MSL    N A+N     + +  ++ RN+  A + NY RR +     P   V VV +R  +
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNVVKAGDPNYTRRTSYLESGPGGAVHVVVRRDGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            ++ +  L   S A     L      L ++  +D  ++NSP+  + + + +L+ Y+ +  
Sbjct: 61  IHLLNNYLVKASEAAAAGSLSNGLNRLSDIYGSD-RFSNSPSKLLGEFQKALQLYANDPQ 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   G   +D A ++ +  N  +RE++K   D + +I+  +  +   L +   ++  +  
Sbjct: 120 QRSNGDAAVDRARDLAKGLNAGSREIEKSYNDVNSDIQDSVDYINDLLQKFHELDQLVAR 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  +  D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+ 
Sbjct: 180 ERNANRDDSVYMDQRDAILKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKMPRTVSFQF 239

Query: 240 MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             S         IFIDGV +  S+       G +  LL++RD ++P +Q QLDE+A  L+
Sbjct: 240 STSLPSGISGKQIFIDGVPLGHSSFIDPNGGGNLGGLLKLRDDIIPQYQKQLDEIANALM 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F     +  + E   G   A           +G++  I +NP + S      +GG   
Sbjct: 300 QMFPGPPSLFLDGEQPSGQIGA----------LEGLAGRIQLNPIFDSK----TEGGGPE 345

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                       + D +    DSFN+   F    G++   +++++ +NS+GWL+  RS++
Sbjct: 346 H-----------FGDKLQELVDSFNEKQKFGTGTGLDLEQSIMDFGKNSVGWLQGLRSNA 394

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                    +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  
Sbjct: 395 DKEARYKGTMFLHAAEALSNATGVNTDDELALMLQLEQTYGATSRIISTVGKMLDDLLAA 454

Query: 479 VK 480
           V+
Sbjct: 455 VR 456


>gi|218528728|ref|YP_002419544.1| flagellar hook-associated protein FlgK [Methylobacterium
           chloromethanicum CM4]
 gi|218521031|gb|ACK81616.1| flagellar hook-associated protein FlgK [Methylobacterium
           chloromethanicum CM4]
          Length = 487

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 133/489 (27%), Positives = 222/489 (45%), Gaps = 11/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           M L    N A+      S Q A   RN+  A++  Y R+  T+   S    TV   R+ +
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             ++ + L+A S A     LL     L + +  D     +P   ++  + +L++ +    
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVG-DTDDPTAPAARLTTFQAALQAAANQPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+  
Sbjct: 120 NAQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFDAANRAVTK 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F  
Sbjct: 180 TTALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            + +   +    + IDGV V+    S +P   G+I  L+ +RD     ++ QLD +A  L
Sbjct: 240 TSVFAAGTVGGGVRIDGVPVTGAT-SPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGL 298

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ-GISETICVN----PQYRSNPSFLR 352
           I +F+E D +  +S     LF A G   L     + G++ +I VN    P    + + LR
Sbjct: 299 IDAFAESDAVGFDSGPRAALFTAGGSGTLPTAAGRTGLAASISVNAAVDPARGGSVALLR 358

Query: 353 DGGSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
            GG     +              +     +       DP  G+ T+  L + A +S GWL
Sbjct: 359 SGGMNGSDYADPAAGGDAAYAGRLRGLLTALTAARPVDPALGLGTSAGLPDLAASSAGWL 418

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           E  R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +
Sbjct: 419 EAQRKDASTDASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISIVNDL 478

Query: 472 LQTLLEGVK 480
           L+TLL+ V+
Sbjct: 479 LKTLLDAVR 487


>gi|319898657|ref|YP_004158750.1| flagellar hook-associated protein FlgK [Bartonella clarridgeiae 73]
 gi|319402621|emb|CBI76166.1| Flagellar hook-associated protein FlgK [Bartonella clarridgeiae 73]
          Length = 456

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 128/482 (26%), Positives = 239/482 (49%), Gaps = 28/482 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           MSL    N A+N     + +  ++ RNI  A + NY RR +     P   V VV +R  +
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNIVRAGDPNYTRRTSYLESGPGGAVHVVVRRDGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            ++ +  L   S A     L      L ++  AD  ++NSP+  + + + +L+ Y+ +  
Sbjct: 61  IHLLNNYLVKASEAAAAGSLSNGLNRLSDIYGAD-KFSNSPSKLLGEFQKALQLYANDPQ 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   G   +D A ++ +  NT + E++K+  D + +I+  +  +   L +   ++  +  
Sbjct: 120 QRSNGDAAVDRARDLAKGLNTGSYEIEKLYNDVNSDIQDSVDYINDLLQKFHELDQLVVR 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  +  D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+ 
Sbjct: 180 ERNANRDDSVYMDQRDAILKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKMPRTVSFQF 239

Query: 240 MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             S         +FIDGV +  S+  +    G +  LL++RD +VP +Q QLDE+A  L+
Sbjct: 240 SASLPPGISGKQVFIDGVPLGHSSFLNPNGGGNLGGLLKLRDDIVPQYQKQLDEIANALM 299

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F             P LF+            +G++  I +NP + S        G   
Sbjct: 300 HMFP----------GPPSLFLDGDQPSGQIGPLEGLAGRIQLNPIFDSKTE-----GGGP 344

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
           + F  N++ L           D+FN    F    G++ + ++ ++++NS+GWLE  RS++
Sbjct: 345 EHFGDNLQAL----------VDAFNGKQQFGTGTGLDPDQSIKDFSKNSVGWLEGLRSNA 394

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                    +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  
Sbjct: 395 DKEAKYQGTMFLHAAEALSNATGVNADDELALMLQLEQTYGATSRIISTVGKMLDDLLAA 454

Query: 479 VK 480
           V+
Sbjct: 455 VR 456


>gi|255605408|ref|XP_002538389.1| Flagellar hook-associated protein, putative [Ricinus communis]
 gi|223512404|gb|EEF23994.1| Flagellar hook-associated protein, putative [Ricinus communis]
          Length = 283

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 166/283 (58%), Gaps = 4/283 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP--ENVTVVTQRSE 58
           M+L    N A+    N S   A +  NI NA + +Y RR  +TT++     +TV  +R+E
Sbjct: 1   MALSTTLNTAKATLGNTSLSSAVVSNNISNASSSDYNRRAAVTTVNTLTGAITVKIERAE 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  +  + L A S   G+Q+ L   ++L  +M  ++ Y  +P+ Y++ L+++L +Y+ + 
Sbjct: 61  DSALLKQYLSAASDDAGKQKFLAGMKSLSVVMGGEE-YTAAPSTYLASLQNALNTYAASP 119

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           ++  L   V+  A +     NTS + VQ++R DAD EI+  I+ L + L +    ND +K
Sbjct: 120 TDITLASAVVSAATDTTNALNTSTKAVQQLRVDADSEIDSTITRLNQLLKDFGDANDQVK 179

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
           + T    D ++ LD+R+ LL++IS IIGIST  R  ND+ +YT+DGTTLFET PR I+FE
Sbjct: 180 YATQVGRDPNNALDKREGLLKEISGIIGISTATRPGNDVAIYTTDGTTLFETTPRKISFE 239

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRD 280
              +Y   +  + IFIDGV+V +  GS    KG + ALLQ+RD
Sbjct: 240 SRAAYDADTTGSGIFIDGVMVKTGSGSNTTAKGSLPALLQLRD 282


>gi|254505051|ref|ZP_05117202.1| flagellar hook-associated protein FlgK [Labrenzia alexandrii
           DFL-11]
 gi|222441122|gb|EEE47801.1| flagellar hook-associated protein FlgK [Labrenzia alexandrii
           DFL-11]
          Length = 482

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 141/492 (28%), Positives = 247/492 (50%), Gaps = 30/492 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENAD----NKNYVRRDTMTTISPENVTV---V 53
           MSL      AQ+       + + I RNI  A     +K  V+  TM T S +   +    
Sbjct: 1   MSLSVALQVAQSALAARQTESSVIARNITGAQEPGFSKKSVQLSTMYTSSGQAGGLRVNG 60

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +  ++  +L + S    QQ  L     + E +  D     SP   + +L+ +L++
Sbjct: 61  VARMADSALYASLLTSTSVGTSQQAKLDGITRMAETI-GDTELETSPAALLGELQKTLQN 119

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
           Y+ + +  ++ +  + +A+ +  +  +S+  VQ++RA+AD ++   +  +   L EL  +
Sbjct: 120 YASDPNNSVMAQDTLQSAKNMAASLRSSSDLVQEVRANADSDMATSVREISSLLGELENL 179

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I   T +  D  D LD RD +L  +SE IGI T+ R N D+VVYT  G TLFET  R
Sbjct: 180 NSTIVKGTQNGADVTDALDDRDQVLLALSEEIGIKTMDRANGDIVVYTDSGVTLFETSAR 239

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLD 291
           +++F    +Y+  +  + + +DGV V +  G+ +P   G++  L ++RD     +Q+QLD
Sbjct: 240 EVSFAPTTTYSPGTVGSAVIVDGVPV-TGPGAIMPISSGRLHGLAELRDDTAVTYQSQLD 298

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ--GISETICVNPQYRSNPS 349
           E+AR +I +F E +  A       GLF   G   +        G++  I VNP    +  
Sbjct: 299 EIARGVIEAFGESNGDA-------GLFTWSGAPAIPPGATHSVGLAADIIVNPNADPDQG 351

Query: 350 F----LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
                +RDG SV+    +N    AG+   +     +F+ +  F     ++ + +L  +A 
Sbjct: 352 GSLDRIRDGFSVA----YNPAGDAGFSARLQELVGAFDTSRTFAGSVELDPDASLNSFAG 407

Query: 406 NSIGWLEKNRSD-SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           +S+ WLE  R   + ++ ++S V+    +E+ SNT GVN+ EEL+ L++VE++Y  +++L
Sbjct: 408 SSVSWLENGRKTLTKNVEIQS-VIVGRTAENLSNTTGVNIDEELTLLLEVERAYAAASRL 466

Query: 465 IMFTDKMLQTLL 476
           I   D ML+ L+
Sbjct: 467 ITAVDTMLEELM 478


>gi|218670905|ref|ZP_03520576.1| flagellar hook-associated protein FlgK [Rhizobium etli GR56]
          Length = 283

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 162/281 (57%), Gaps = 17/281 (6%)

Query: 213 NNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGK 271
           +NNDMV+ T DGT LFETVPR + F+  + YT +   N ++IDGV +   +GS    +G 
Sbjct: 1   DNNDMVLSTPDGTILFETVPRKVTFKSQDVYTASIVGNSVYIDGVALPLGKGSTTTGQGS 60

Query: 272 IKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFI-ADGIKDLDNKL 330
           +++LLQIRD + P FQ QLDE+AR L+  F E++  A     VPGLF  + G  D     
Sbjct: 61  LQSLLQIRDEIAPNFQKQLDEIARGLVSLFKEQN-TAAPPAYVPGLFTWSGGTIDTGATA 119

Query: 331 CQGISETICVNPQY----RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNF 386
             G++ TI V+ +       +P  LRDGG  +   + N   ++GY   ++    + + + 
Sbjct: 120 VAGMASTISVSTRVITSQGGDPMRLRDGGVNATGVVLNTSGVSGYTAELDRLYTAMSADI 179

Query: 387 IFDPVAG----------INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESY 436
            FDP AG          I++NV+++EYA NSIGWLE+ RSD+      +    +   E+Y
Sbjct: 180 DFDPAAGAPVGFDATTGIDSNVSIMEYATNSIGWLEQYRSDATSASETTAAALSRSDEAY 239

Query: 437 SNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           SN  GVNL EEL+ L+ +EQSY  + K++   D+M Q+LL+
Sbjct: 240 SNETGVNLDEELTLLLDIEQSYKAATKILNVIDEMFQSLLD 280


>gi|254559269|ref|YP_003066364.1| FlgK protein [Methylobacterium extorquens DM4]
 gi|254266547|emb|CAX22311.1| FlgK protein [Methylobacterium extorquens DM4]
          Length = 487

 Score =  186 bits (471), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 133/489 (27%), Positives = 222/489 (45%), Gaps = 11/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           M L    N A+      S Q A   RN+  A++  Y R+  T+   S    TV   R+ +
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             ++ + L+A S A     LL     L + +  D     +P   ++  + +L++ +    
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVG-DTDDPTAPAARLTTFQAALQAAANQPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+  
Sbjct: 120 NAQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFEAANRAVTK 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F  
Sbjct: 180 TTALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSA 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            + +   +    + IDGV V+    S +P   G+I  L+ +RD     ++ QLD +A  L
Sbjct: 240 TSVFAAGTVGGGVRIDGVPVTGAT-SPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGL 298

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ-GISETICVN----PQYRSNPSFLR 352
           I +F+E D +  +S    GLF   G   L     + G++ +I VN    P    + + LR
Sbjct: 299 IDAFAESDAVGFDSGPRAGLFTVGGSGILPTGAGRTGLAASISVNAAVDPARGGSVALLR 358

Query: 353 DGGSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
            GG     +              +     +       DP  G+ T+  L + A +S GWL
Sbjct: 359 SGGMNGSDYADPAAGGDAAYAGRLRGLLTALTAARPVDPDLGLGTSAGLPDLATSSAGWL 418

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           E  R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +
Sbjct: 419 EAQRKDASTDASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISVVNDL 478

Query: 472 LQTLLEGVK 480
           L+TLL+ V+
Sbjct: 479 LKTLLDAVR 487


>gi|218663527|ref|ZP_03519457.1| flagellar hook-associated protein FlgK [Rhizobium etli IE4771]
          Length = 291

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 163/288 (56%), Gaps = 16/288 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N  Q+I NN  QQ + +  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNSVQSIFNNTGQQSSVVSTNIANVGNSDYVRREASITTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L +++    QQ L+   E+LK ++  +D Y  SP+ Y+S  +++L++++ + S
Sbjct: 61  TALLAQYLQSNAKDSAQQTLVTGLESLKSLVGGND-YETSPSTYLSAFQEALQTFATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ +  A+++  + NT++  VQ IRA+AD EI  ++S L   LS+    N+A+K 
Sbjct: 120 STTSAQSAVTAAQDLANSLNTASDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D    LD+R+ LL++IS I+G++++VR+NNDM +Y SDGT LFETVPR +    
Sbjct: 180 ATATGTDMSSALDEREKLLKQISSIVGVNSVVRDNNDMALYASDGTVLFETVPRTVTSAS 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKG-------KIKALLQIRD 280
             +Y   +E+ P         S + +  P          ++ALLQ+RD
Sbjct: 240 TATYVAGTEAMPSI-------STRCTRCPAKIDDERLRSLQALLQLRD 280


>gi|209963558|ref|YP_002296473.1| flagellar hook-associated protein 1 FlgK, putative [Rhodospirillum
           centenum SW]
 gi|209957024|gb|ACI97660.1| flagellar hook-associated protein 1 FlgK, putative [Rhodospirillum
           centenum SW]
          Length = 495

 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 98/371 (26%), Positives = 179/371 (48%), Gaps = 24/371 (6%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V+D A  +    N +  +++++R  AD +I   ++++ + L +L  +N  +K +T S 
Sbjct: 130 RAVVDAAVSLANRLNAADDKIKQVRQQADSDIAASVADVNQALVQLEKLNREVKMRTGSG 189

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
            D  +  DQRDVLL +I+  IGI    R+ N++VV T  G TL +   R + F       
Sbjct: 190 QDTTELEDQRDVLLDRIAGQIGIQYFTRSPNELVVMTDGGVTLLDGSARMLEFTPTAVIG 249

Query: 245 VTSESNPIF----IDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            T+E   +     ++G  ++   G  +P   G+I  L ++RDS++P  + Q+DE+A VL+
Sbjct: 250 STTEYPSMLSGLKVEGADIAPGSGYPLPLKSGRIAGLFEVRDSLMPQARRQIDEIASVLV 309

Query: 299 GSFSEKDP-IAGNSENVPGLFIADGIK-------DLDNKLCQGISETICVNPQYR----S 346
             F   D  I G   +  GLF   G++          +    G++  I VN   R     
Sbjct: 310 DRFQAADASITGTGLSDTGLFTDAGVRHYRAPPYSPASPGPAGLAGRIAVNDLVRVEAGG 369

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           NP+ LR G  +      +V + A     I  +   F +   FD  AG+    TL  +A  
Sbjct: 370 NPALLRTG--IHAATTGDVGDTA----QIRSFLGVFQQTVSFDADAGLIPTGTLKGFASA 423

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
           ++G  +  R+ + +      V+   +  +  +  GVN++EE+  L+ +E+++  + +++ 
Sbjct: 424 AMGHQQMLRATAANDAKAQSVLLETVETARISKDGVNIEEEMQELLLIEKAFAAAGQVMQ 483

Query: 467 FTDKMLQTLLE 477
              +ML TL+E
Sbjct: 484 AASRMLDTLME 494


>gi|218660072|ref|ZP_03516002.1| flagellar hook-associated protein FlgK [Rhizobium etli IE4771]
          Length = 231

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 127/224 (56%), Gaps = 16/224 (7%)

Query: 269 KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFI-ADGIKDLD 327
           +G +++LLQIRD + P FQ QLDE+AR L+  F E++  A     VPGLF  + G  D  
Sbjct: 6   QGSLQSLLQIRDEIAPNFQKQLDEIARGLVSLFKEQN-TAAPPAYVPGLFTWSGGTVDTG 64

Query: 328 NKLCQGISETICVNPQY----RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
                G++ TI V+ +       +P  LRDGG  +   + N   ++GY   ++    + +
Sbjct: 65  ATAVAGMASTISVSTRVITSQGGDPMRLRDGGVNATGVVLNTSGVSGYTAELDRLYTAMS 124

Query: 384 KNFIFDPVAG----------INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHIS 433
            +  FDP AG          I++NV+++EYA NS+GWLE+ RS++      +    +   
Sbjct: 125 ADIDFDPAAGAPVGFDATTGIDSNVSIMEYATNSLGWLEQYRSNATTAAENTSAALSRSD 184

Query: 434 ESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           E+YSN  GVNL EEL+ L+ +EQSY  + K++   D+ML++LL+
Sbjct: 185 EAYSNETGVNLDEELTLLLDIEQSYKAATKILNAVDEMLKSLLD 228


>gi|46205094|ref|ZP_00049039.2| COG1256: Flagellar hook-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 271

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 125/274 (45%), Gaps = 15/274 (5%)

Query: 210 IVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP- 268
           + R N D+ +YT  G TLF+  PR + F   +++   ++ + + IDGV V+   G+A P 
Sbjct: 1   MARANGDVALYTDGGVTLFDRGPRAVGFAPTSAFAAGTKGSAVIIDGVAVT---GAASPM 57

Query: 269 ---KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKD 325
               G+I  L  +RD     ++ QLD +A  LI +F+E D +        GLF A G   
Sbjct: 58  PLASGRIAGLAALRDQTAVTYEAQLDALAGGLIDAFAETDAVPPLGAPKAGLFTAGGSAT 117

Query: 326 LDNKLCQG---ISETICVN----PQYRSNPSFLRDGGSVSKKFL-WNVKNLAGYPDLINH 377
           L      G   ++ TI VN    P    + + LR GG     ++       A Y   +  
Sbjct: 118 LPAASAAGRTGLASTIAVNAAVDPDRNGDLALLRSGGMNGTDYVDPAAGGDAAYTGRLRG 177

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
              +  +    DP   + T   L   A  S GWLE  R D+       + +    +E+ S
Sbjct: 178 LVSALGQTRSLDPALDLGTASDLPSLAAASAGWLEAQRKDASASASYQKTLLTRANEALS 237

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           N VGVN  +E +  +++E+SY+ S K+I   D +
Sbjct: 238 NVVGVNGDDETALALQLERSYSASAKIIAVIDDL 271


>gi|163794165|ref|ZP_02188138.1| hypothetical protein BAL199_02089 [alpha proteobacterium BAL199]
 gi|159180779|gb|EDP65298.1| hypothetical protein BAL199_02089 [alpha proteobacterium BAL199]
          Length = 476

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 124/496 (25%), Positives = 222/496 (44%), Gaps = 36/496 (7%)

Query: 1   MSLL-AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----SPENVTVVTQ 55
           MSLL A+++ +  I   A  +     RNI +A  + Y R+   T+         + +V Q
Sbjct: 1   MSLLNAIYSASSGIAA-AQAKIDVASRNIASASVEGYTRKTQETSTRVVDGRGGLVLVEQ 59

Query: 56  RSENKN-MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            + N N    + +   +S + +  +L  F A  E+       N+S +  I+ L+   ++ 
Sbjct: 60  VTRNVNAQLQRDVREQTSVVEKLTILDDFLARFELEFGRPEDNSSISSKITDLKTKFQAL 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + N  +      VI  A+EV    N  +  +Q +RA+AD  +E  +  + + L  +  +N
Sbjct: 120 ATNPDQSTAQNDVISAAQEVALTLNNLSARLQALRAEADLRVEDSVDIINQALQNVQSLN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I  + A+     D  DQRDV + K+SE + I T  R +  + + T D   L +     
Sbjct: 180 AEIGSRKAAGESTADLEDQRDVWISKLSEQMDIKTFERPDGKIAILTGDSQFLLDQEAVT 239

Query: 235 INFEKMNSYTVTSESNPIFID-GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
           + F    + +  S  N + +D G +   +  ++   G +  LLQ+RD+ +P+ Q+QLD +
Sbjct: 240 LTFVASTTVSAGSVLNDVMLDNGFMAPFSITNSFSGGTVSGLLQLRDTTLPLAQSQLDSL 299

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD-----NKLCQGISETICVNPQYRS-- 346
           A  L             +E    + +     DLD          G +       Q RS  
Sbjct: 300 AFEL-------------AEQFDAITVGATTADLDLFTDAADAIPGAAAGFAAVIQVRSTV 346

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT-NVTLLEYAR 405
             + LRDG      F  +  + +  P  I    D F+   +F  V G+NT + TL E+A 
Sbjct: 347 TGAELRDG--TGGTFASSGVSDSSLPLAI---IDMFDTKQVFTAVTGLNTASSTLEEFAA 401

Query: 406 NSIGWLEKNRSDSHDLHMKSQ-VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
             I + + N++  ++  ++ Q  V N +SE  ++  GVNL EEL+ LI++E ++  S ++
Sbjct: 402 QFISY-QANQAADYESQLQFQDQVRNLLSERLTDDSGVNLDEELASLIQLEAAFAASARV 460

Query: 465 IMFTDKMLQTLLEGVK 480
           +    + L  LL  ++
Sbjct: 461 LSSVQQALDELLGAIR 476


>gi|260429026|ref|ZP_05783003.1| flagellar hook-associated protein FlgK [Citreicella sp. SE45]
 gi|260419649|gb|EEX12902.1| flagellar hook-associated protein FlgK [Citreicella sp. SE45]
          Length = 485

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 223/510 (43%), Gaps = 61/510 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT---TISPENVTV--VTQ 55
           MSL    + A +     S+  + +  NI NA  ++Y RR   T   T+    V +  V +
Sbjct: 1   MSLSGALSNALSGLTANSRAASLVASNIANATTESYGRRTLETSSRTVGVGGVQIDGVNR 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           R +   + D+ L    +   +   +Q+F +  E +        S + + S   +++ S S
Sbjct: 61  RIDTAVLSDRRLSDAQTGFAEN--MQTFASKIESLLGPSGEAGSLSSFYSAFENAILSAS 118

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            + S     +TV   A++ V   N  +  +Q  RA AD+ I  ++ +L   L  +  +N+
Sbjct: 119 SDPSSTQRLQTVALAAQDFVGKLNDVSTTLQLSRATADRTIAAQVDSLNTALGRVKDLNE 178

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV---- 231
           AI        DA   +D+R  ++ ++SEI+ + T+ R+N  + VY + G  L +      
Sbjct: 179 AIAESMYRNGDASSLMDERQRVIDQVSEIVPLRTVQRDNGMIAVYAASGNPLLDPTIHSE 238

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVV------SSNQGSAVPKGKIKALLQIRDSVVPI 285
           P +I F   N  T         + G+ +      S+N+G  +  G + A LQIRD+V   
Sbjct: 239 PAEIGFTAQNLVTADMTLGNGLLSGLTISGKAVNSTNEGP-LGGGTLGAQLQIRDTVAVE 297

Query: 286 FQNQLDEMARVLIGSFSEKDP----IAGNSENVPGLFIADGIK-DLDNK--LCQGISETI 338
            Q+ LD +AR LI  F    P    +AG+    PGLF   G+  D  N+  L   IS   
Sbjct: 298 LQSVLDGIARDLIERFEPGGPDTTLVAGD----PGLFTDAGLAFDPLNEVGLAGRISLNA 353

Query: 339 CVNPQYRSNPSFLRDG-GSVSKKFLWNVKNLAGYPDLINHY-----------CDSFNKNF 386
            V+P   S    LRDG G+ ++  + + + L  Y D +                SF ++ 
Sbjct: 354 LVDP-TDSGTWRLRDGLGAATQGDVGDARLLQAYSDALESLNVPGSTSLGTGAFSFGEH- 411

Query: 387 IFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQE 446
           + D V+ ++T                + R+D       +Q   N   +    + GV+   
Sbjct: 412 VGDFVSAVST---------------ARVRADGQQSFSNAQ---NTALKELELSAGVDTDA 453

Query: 447 ELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           EL  ++++EQ Y  + ++I   D+++QTLL
Sbjct: 454 ELQEMLRIEQHYAANARVITTVDELMQTLL 483


>gi|310816851|ref|YP_003964815.1| flagellar hook-associated protein [Ketogulonicigenium vulgare Y25]
 gi|308755586|gb|ADO43515.1| flagellar hook-associated protein [Ketogulonicigenium vulgare Y25]
          Length = 468

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 128/500 (25%), Positives = 213/500 (42%), Gaps = 56/500 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-----ENVTV--V 53
           MSL      A +     S+Q   I  NI NA  + Y RR+   + S        VTV  V
Sbjct: 1   MSLTYSLGNALSGLAAVSRQTEVISSNISNALTEGYARREVALSASSIGGRGAGVTVDGV 60

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALK-EMMSADDHYNNSPTHYISKLRDSLE 112
           T R+ N  +      A +   G   L      L+  M SA D    S    I  L  +L 
Sbjct: 61  T-RAVNAAITADRRAAQTHMSGALALSDGLARLEVAMGSAADA--GSIAGRIGALEQALV 117

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + +   S D   +      + VV   N SA +VQ++R DAD +I  +I  L   L+++  
Sbjct: 118 AAAAEPSSDAGLQAAQQALQAVVSTLNASAAKVQQMRVDADADIATQIKALNTSLTQIAA 177

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I     +  DA   +DQR +L+ +++ ++ ++ + R+N  + +    G  L +   
Sbjct: 178 LNTQISRALTTGADAAGLMDQRAILIDQVASLVPLTEVPRDNGAVALMAPGGVMLVDNSA 237

Query: 233 RDINFEKMNSYTVTSES-------NPIFIDGVVVSSNQGSA-VPKGKIKALLQIRDSVVP 284
              +F   +S+T+T++        + + +DG  + ++ G   +  G + A   +RD+V+ 
Sbjct: 238 ATFSFT--HSHTITADMTLENGLLSGVLVDGRPLDASGGMGKLAGGTLGAAFALRDTVLT 295

Query: 285 IFQNQLDEMARVLIGSF--SEKDP-IAGNSENVPGLFIADGIKDLDNKLCQGISETI--- 338
             Q+ LDE+A  L   F  S  DP IAG      GLF   G   +D     G+S  +   
Sbjct: 296 AAQSGLDEIAADLALKFQDSANDPSIAGG----LGLFTDSG-GLVDPSDATGLSARLRLN 350

Query: 339 -CVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
             ++P    +   LRDG       L+      G    +N +  +  ++      AG+  +
Sbjct: 351 TLIDPAQGGSAQLLRDG-------LYGGGTAVGSAVQLNRWSSALGQSSAL--AAGVLND 401

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
           +     AR     +  +R  S+        +FN +  S     GV+   E+  L+ +E S
Sbjct: 402 IA---AAR-----VSSDREASYQ-----SALFNSL-YSAEAAQGVDTDREMQKLLLIETS 447

Query: 458 YNISNKLIMFTDKMLQTLLE 477
           Y  + K++   D MLQTLLE
Sbjct: 448 YAANAKVLQAVDGMLQTLLE 467


>gi|218678738|ref|ZP_03526635.1| flagellar hook-associated protein FlgK [Rhizobium etli CIAT 894]
          Length = 168

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 96/169 (56%), Gaps = 2/169 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSEN 59
           MSL +  N AQ+I NN  QQ + I  NI N  N +YVRR+   T S     VV+  R++ 
Sbjct: 1   MSLTSALNSAQSIFNNTGQQSSVISTNIANVGNSDYVRREASITTSLSGAQVVSISRAQE 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +  + L +++    QQ L+   E+LK +M  +D Y  SP+ Y+S  + +L++Y+ + S
Sbjct: 61  TALLAQYLQSNAKDSAQQTLVTGLESLKSLMGGND-YETSPSTYLSAFQQALQTYATSPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
                ++ +  A+++  + NT++  VQ IRADAD +I  ++S+L   LS
Sbjct: 120 STTAAQSAVTAAQDLANSLNTASDGVQSIRADADADIATQVSSLNTLLS 168


>gi|83955134|ref|ZP_00963790.1| flagellar hook-associated protein [Sulfitobacter sp. NAS-14.1]
 gi|83840463|gb|EAP79636.1| flagellar hook-associated protein [Sulfitobacter sp. NAS-14.1]
          Length = 472

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 118/494 (23%), Positives = 206/494 (41%), Gaps = 37/494 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM--TTISPENVTVVTQRSE 58
           MSL    N A    +    Q      N+ NA    YVRR+ M  T    +   V+   SE
Sbjct: 1   MSLSGALNSATAGLHTTQGQSRIAADNVSNAMTPGYVRREAMLVTASGGQGGAVI---SE 57

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHY------NNSPTHYISKLRDSLE 112
            +   D  L    S +   R+ Q +++++E ++    Y        SP    +  ++SL 
Sbjct: 58  VRREVDATLQ-RMSRLENSRMTQ-YQSIQEGLTTYTAYLGQPGDGTSPADRFNDFQNSLT 115

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +     S +    +V   AE++V++   +A  +     D + EI  E+++L   L +L  
Sbjct: 116 TLVNMPSSNGAQTSVALAAEDLVRSVKGAATTLSTTLNDVNMEIRYEVADLNTALYQLRD 175

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET-V 231
           +N +    T    +A  F ++ D +L +IS I+       +N  + +YT  G  L E  V
Sbjct: 176 LNASGSGFTPGSLEAAQFDEKVDTILDQISGIVDTRIHRSSNGSISLYTVSGAALLEGRV 235

Query: 232 PRDINFEKMNSYTVTSESN-PIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            +D+ F   +   +    +   F DGV         +  G +  L +++   +P F  QL
Sbjct: 236 VQDVTFNPSDGTLMAGNQDITPFKDGV-------RGIQHGSLAGLSELKRETIPQFSQQL 288

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           DE AR LI +F E D      E   GLF  +GI   D     G++  + +N +  S    
Sbjct: 289 DEYARGLIQTFEEADASLAPGE--AGLFTDNGIA-FDPANITGLASRLQINSKISSTGDA 345

Query: 351 ----LRDGGSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
               +RDG       L      AG   + IN +    +         GI   VTL +++ 
Sbjct: 346 EVWRIRDG-------LGATSPGAGSETVQINAFLAGLDTAMNAATGTGIPAEVTLRDFSA 398

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
             I      R+ + +    +      +  +  N+ GVN+ +E+  L+ +EQSY  +++++
Sbjct: 399 EMITSQAATRARAENDFNAAASAAEVVMSARRNSEGVNIDDEMQQLLLIEQSYAANSRVL 458

Query: 466 MFTDKMLQTLLEGV 479
               +M+ TL+  V
Sbjct: 459 TAVSEMIDTLIAAV 472


>gi|261313951|ref|ZP_05953148.1| flagellar hook-associated protein FlgK [Brucella pinnipedialis
           M163/99/10]
 gi|261302977|gb|EEY06474.1| flagellar hook-associated protein FlgK [Brucella pinnipedialis
           M163/99/10]
          Length = 201

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 108/202 (53%), Gaps = 2/202 (0%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL +    A++     S+Q + + RNI  A + +Y RR       P  ++ V   RS +
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
           + MF++ + ++S+A     L    + L  + SAD +Y+ SP+  I  LRD+L++Y+ + S
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSAD-NYSGSPSGLIGDLRDALQTYAASPS 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +  
Sbjct: 120 NSALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVG 179

Query: 180 KTASKHDAHDFLDQRDVLLQKI 201
            T    D  D+LDQRD LL+++
Sbjct: 180 GTRMGRDVSDYLDQRDALLKQL 201


>gi|254475034|ref|ZP_05088420.1| flagellar hook-associated protein FlgK [Ruegeria sp. R11]
 gi|214029277|gb|EEB70112.1| flagellar hook-associated protein FlgK [Ruegeria sp. R11]
          Length = 482

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 115/494 (23%), Positives = 218/494 (44%), Gaps = 32/494 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV----TQR 56
           M++ +  N A +    A +Q + +  N+ N     Y RR    T + +    V     QR
Sbjct: 1   MTITSALNSAMSGLTAAGRQTSVVSENLANVLTPGYSRRSVALTSAGDGFAGVRVNGVQR 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEA-LKEMMS-ADDHYNNSPTHYISKLRDSL-ES 113
             +  +   V  A++  +G  ++   F   + E++  ADD Y  S T  ++    +L E+
Sbjct: 61  FNDPGLQASVRTANTE-LGVSKVQSDFYGRMVELVGKADDPY--SVTQRLTDFDSALIEA 117

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            S+  S   L    I  AEE+ ++ + +A  ++  R  AD+ I++++  + + L ++  +
Sbjct: 118 ISRPDSGPRLNDLSI-QAEELARSISDAAEGLRNERTAADRAIDVQVETVNQSLEKIQKL 176

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I    A+  D    LDQRD+L+ +++EII +  + R+   + +++  G  L +  P 
Sbjct: 177 NAKIAISQAAGADTVSLLDQRDLLIDQVNEIIPVKVVNRDRGQVALFSDGGAVLLDGQPA 236

Query: 234 DINFE-KMNSYTVTSESNPIF----IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           ++ F+ K ++    +  N +     I+G+ V +  G  +  G + A  ++RD +    Q 
Sbjct: 237 ELTFDGKADTLPYMTLGNGLLSGLQINGIDVDTGPGGPLRGGSLAANFEVRDVLTVEAQE 296

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENV--PGLFIADGIKDLDNKLCQGISETICVNP---- 342
            LD +AR LI  F  +DP    +     PGLF   G    D     GI+  I +N     
Sbjct: 297 DLDAVARDLIERF--QDPALDTTLGALDPGLFTDQGAF-FDPANTVGIANRIELNDKVAM 353

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
           Q ++    LRDG + +          AG   L+  Y D+ +   +   V     N+    
Sbjct: 354 QGQAETWRLRDGLNAAG------PGNAGDASLLRAYTDALDTKRLVSSVGLGTANLDAST 407

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
            + N +    ++   +      +Q     + +      GV+   EL  LI +E+ Y  + 
Sbjct: 408 LSANLLSRFAQSEYSAQQNVAFAQATHTEMQQRQLAQ-GVDSDAELQNLIVIEKVYQANA 466

Query: 463 KLIMFTDKMLQTLL 476
           ++I   D++++TLL
Sbjct: 467 RMISVVDELMETLL 480


>gi|89068727|ref|ZP_01156113.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
 gi|89045690|gb|EAR51752.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
          Length = 470

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 105/503 (20%), Positives = 208/503 (41%), Gaps = 57/503 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MTTISPENVTVVTQRSEN 59
           MSL    +  ++     S+   +   N+ NA  + YVRRD  ++T       +VT  + +
Sbjct: 1   MSLTNALSAGRSGLLAVSRWSETTAGNVANAKTQGYVRRDVGLSTNVVGGGVIVTGITRD 60

Query: 60  KNMFDKVLHAHSSAIG--QQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESY 114
            +     LH    A G  Q  +    +A    +         PT     +  L+D+  + 
Sbjct: 61  SDAALTRLHRDHLAEGATQSTISDRLQAYATALG----QPGDPTTLSARLGGLQDAFVAL 116

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           +         ++V++ AE      N  +R++        ++I  ++  +   LSEL  +N
Sbjct: 117 ASTPGSGPAQRSVLEAAEGAAAALNGLSRQLDSAVRGVGEQIAGQVERVEGLLSELAAMN 176

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV-PR 233
             +         + +  D+ D  L  ++  +      R +  + ++T DGT + +   P 
Sbjct: 177 ARMAGTEQGTAASAELRDRMDGRLDALATSLDFQVRERVDGGLDIFTPDGTVMLDGDDPA 236

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQ--GSAVPKGKIKALLQIRDSVVPIFQNQLD 291
            + F+          ++ +  DGV ++  +  G  + +G +  L ++R  ++P F+ QLD
Sbjct: 237 PLTFDP---------NSGLAFDGVDITPGKAVGRGITEGVLAGLTELRSEILPRFRMQLD 287

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           E AR L+ +F++ DP  G      GLF  D     D  L +G++  I VN   R      
Sbjct: 288 ETARALVQTFADADPTVGAGGA--GLFT-DAGAGYDPALHEGLAGRITVNDAARPEA--- 341

Query: 352 RDGGSVSKKFLWNVKNLAGY--------PDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
             GG+     LW V++  G           +++   D   +  ++DP  G+     L E+
Sbjct: 342 --GGA-----LWRVRDGMGAVSEGPPGDATVVDGILDRLAQGQVYDPATGLQGGAPLGEF 394

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNH-------ISESYSNTVGVNLQEELSFLIKVEQ 456
           A   +       +D H +  ++             ++ES +   GV++  E+  L+++EQ
Sbjct: 395 AAQLM-------ADQHAVRARADTALEGLNTATAAVAESRAARQGVDIDAEMQRLLEIEQ 447

Query: 457 SYNISNKLIMFTDKMLQTLLEGV 479
           +Y  ++K++    +M+  LL  +
Sbjct: 448 TYAANSKVLTTVVRMIDDLLAAI 470


>gi|83594184|ref|YP_427936.1| hypothetical protein Rru_A2852 [Rhodospirillum rubrum ATCC 11170]
 gi|83577098|gb|ABC23649.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 727

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 109/208 (52%), Gaps = 5/208 (2%)

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           NNS +H ++      ++ +    +       + +A+E+   FNT +  +Q++R  AD++I
Sbjct: 102 NNSISHNLTAFGQQFDTLALETDKSTQQMATVRSAQELTSQFNTISTRLQQMRLTADQDI 161

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
              ++ +   L  +  +ND I    A+  D  D  D+RD+ +Q+++E++ ++T  R    
Sbjct: 162 AGAVAEVNGHLKNIDTLNDEITLGVATGRDVTDLQDKRDLEVQQLTELVDVTTFERPGGA 221

Query: 217 MVVYTSDGTTLFETVPRDINFEKMNSYTV-TSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           +VVYT  G+TL +  P  ++F   +S T   S+    F    V  S+    +  GK+ AL
Sbjct: 222 LVVYTKGGSTLLDADPIPVSFTASSSVTAWDSKGGGDFSAISVGGSDITGEIGAGKLAAL 281

Query: 276 LQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           + +RD  VP +Q+Q+DE+A    G FS+
Sbjct: 282 IDMRDKTVPAYQSQMDELA----GKFSD 305


>gi|163738040|ref|ZP_02145456.1| Flagellar hook-associated protein [Phaeobacter gallaeciensis BS107]
 gi|161388656|gb|EDQ13009.1| Flagellar hook-associated protein [Phaeobacter gallaeciensis BS107]
          Length = 482

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 118/496 (23%), Positives = 219/496 (44%), Gaps = 36/496 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV----TQR 56
           MS+ +  N A      A +  + +  N+ N     Y RR    T + +  + V     QR
Sbjct: 1   MSITSALNSAMTGLTAAGRSTSVVSENLSNVLTPGYSRRSLALTSAGDGFSGVKVGHVQR 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEA-LKEMM-SADDHYNNSPTHYISKLRDSL-ES 113
             +  +   V  A+S  +G   +  +F   + E++ SADD Y  S T  ++     L E 
Sbjct: 61  INDPALQSSVRSANSE-VGVAEVKSAFFGRMTELVGSADDPY--SITQRLTDFDSGLIEV 117

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            S+  S   L    I  AEE+V++   +A  ++  R  AD+ I++++  + + L +L  +
Sbjct: 118 ISRPDSGPRLNDLAI-QAEELVRSIADAAEGLRNQRTAADRAIDVQVDTVNQSLEKLQKL 176

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I    ++  D+   LDQRD+L+ ++++II +  + R+   + +++  G  L +    
Sbjct: 177 NAKIAISQSTGSDSASLLDQRDLLIDEVNKIIPVKVVNRDRGQVALFSEGGAVLLDGQAA 236

Query: 234 DINFE-KMNSYTVTSESNPIF----IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           +++F+ K ++    +  N +     I+G+ V++  G  V  G + A  ++RD +    Q 
Sbjct: 237 ELSFDGKADTLPYMTLGNGLLSGLQINGIDVATGPGGPVRGGTLAAQFEVRDVLTVEAQE 296

Query: 289 QLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP---- 342
            LD MA+ LI  F +   DP    ++  PG+F   G    D     GI+  I +N     
Sbjct: 297 DLDAMAKDLIERFQDPALDPTLTATD--PGIFTDQGAF-FDPANTVGIANRIELNDKIAM 353

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
           Q ++    LRDG + +          AG   L+  Y D+ +       V+ +      L+
Sbjct: 354 QGQAETWRLRDGLNAAS------PGNAGDATLLRGYADALDAKRT---VSSVGLGTANLD 404

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTV--GVNLQEELSFLIKVEQSYNI 460
            +  S   L +     +             +E Y   +  GV+   EL  LI +E+ Y  
Sbjct: 405 ASTLSANLLSRFAQSENSAEQNVAFAAATYTEMYQRELAQGVDSDAELQNLIVIEKVYQA 464

Query: 461 SNKLIMFTDKMLQTLL 476
           + ++I   D++++TLL
Sbjct: 465 NARMISVVDELMETLL 480


>gi|114765248|ref|ZP_01444380.1| flagellar hook-associated protein K [Pelagibaca bermudensis
           HTCC2601]
 gi|114542383|gb|EAU45411.1| flagellar hook-associated protein K [Roseovarius sp. HTCC2601]
          Length = 470

 Score =  100 bits (248), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 109/493 (22%), Positives = 207/493 (41%), Gaps = 37/493 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL+   N A++  + +S+   ++  NI NA+N +Y RR+T  T    NV    Q SE  
Sbjct: 1   MSLITALNAARSGMSTSSRWAETVSTNIANANNASYARRETQVTT---NVQGAAQVSEIT 57

Query: 61  NMFDKVLHA-HSSAIG----QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
              D  L A +   +G    Q  +    E+   ++  D    ++    ++  + SL   +
Sbjct: 58  RAVDGALDAMYRGEVGRTAKQDAIAAGLESYTSLL-GDTESTDTVLTRLTDFQSSLGLLA 116

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            + ++  L +  + +A+E+ Q  N +   +      A   I  +++ +   L ++  +++
Sbjct: 117 VSPADTALQRATVGDAQELTQALNRAGANLDAALDRAGDGISSDVAAVNSTLEKIAGLSE 176

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF-----ET 230
            +  +  S        D+    L  +SE I  +T   +   + ++T  GT L      ET
Sbjct: 177 RLAGQGQSADARLALQDELGAELDALSEYIDFTTRTDSKGRIEIFTGGGTALITGGEAET 236

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
           +  D +   + +  +  E  P       V+  +G  + +G +   +++  +V+P  ++QL
Sbjct: 237 LSFDTDTGILTAGEI--EITP------GVAGKRG--ISEGSLSGKIELVTTVLPEMRSQL 286

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRS 346
           DE+AR LI      D      E   GLF  +G   L +    G++  I VN    P+   
Sbjct: 287 DEVARALIDGMVAADASLAAGE--AGLFTDNGAA-LSDPFEPGLASRISVNDAVVPESGG 343

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           +   +RDG         +    AG    +  + D+ +    FD   G+  N++L  Y   
Sbjct: 344 SLWRIRDG------LGADAPGPAGDNTQVTAFLDTLDGAMNFDESLGLGDNMSLSSYIST 397

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
            I      R+ +             +  S  + +GVN+ +EL  L  ++QSYN + + + 
Sbjct: 398 LIASQNTTRASAETSAESLAAGAIAVQSSRLSFMGVNVDDELQQLAAIQQSYNANAQTLS 457

Query: 467 FTDKMLQTLLEGV 479
              +ML TLL  +
Sbjct: 458 VVSEMLDTLLSAI 470


>gi|114762176|ref|ZP_01441644.1| flagellar hook-associated protein K [Pelagibaca bermudensis
           HTCC2601]
 gi|114545200|gb|EAU48203.1| flagellar hook-associated protein K [Roseovarius sp. HTCC2601]
          Length = 486

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 122/505 (24%), Positives = 212/505 (41%), Gaps = 50/505 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD------TMTTISPENVTVVT 54
           MSL    + A +     S+    +  NI NA  ++Y RR       T+       +  VT
Sbjct: 1   MSLSGALSNALSGLTANSRSAGLVASNIANATTESYGRRTLDLSARTLGNSGGVWIDGVT 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           +  +   + D+ L    S    +  +QSF +  E +        S     +    +L S 
Sbjct: 61  RNVDPAVLADRRLSDAQSGFADE--MQSFASRVETLLGPTDTAGSLVGRYAAFETALLSA 118

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + + + D   K V   AE+     N  + E+Q  R DAD+ I  +++     L  ++ +N
Sbjct: 119 ATDPASDQRLKLVAQRAEDFTTMLNQISVEIQDARTDADRSIGSQVTRFNTALGRVSELN 178

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL----FET 230
            AI        D    +DQR  ++  +S+I+ + ++ R N  + +Y + GT L    F +
Sbjct: 179 TAISDSLLRGGDPASLMDQRQRVIDDVSDIVPLRSVARENGAVALYAASGTVLLDPDFHS 238

Query: 231 VPRDINFEKMNSYTV-----TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
            P +I+F   +  T          + + ++G  V+S+   A+  G + A  QIRD V P 
Sbjct: 239 DPVEISFTPQDPVTADLSIGAGTLSGLEVNGKAVNSSNDGALGGGTLGAQFQIRDIVAPD 298

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK--DLDNKLCQG-ISETICVNP 342
            Q  +D +AR LI  F+   P +      PGLF   G     LD     G I+    V+P
Sbjct: 299 MQAAIDGIARDLIERFAPGGPDSTLGATDPGLFTDAGTAFDPLDETGLAGRIALNSLVDP 358

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
              S    LRDG   +      V+   G   L+  Y D+ +   +  P      +  L  
Sbjct: 359 AG-SGTWRLRDGLGAA------VQGPVGEARLLRGYSDALDA--LMSP-----GSAALGS 404

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS---NTV--------GVNLQEELSFL 451
            A++      ++ +D H     +++  +   +S+S   NT         GV+   EL  L
Sbjct: 405 GAQS----FAQHVADFHAAIAAARLRADG-EQSFSSAQNTALKELELSKGVDTDAELQEL 459

Query: 452 IKVEQSYNISNKLIMFTDKMLQTLL 476
           +++EQ Y  + ++I   D+++QTL+
Sbjct: 460 LRIEQHYAANARVITTVDELMQTLM 484


>gi|294675565|ref|YP_003576180.1| flagellar hook-associated protein FlgK [Rhodobacter capsulatus SB
           1003]
 gi|294474385|gb|ADE83773.1| flagellar hook-associated protein FlgK [Rhodobacter capsulatus SB
           1003]
          Length = 484

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 118/507 (23%), Positives = 204/507 (40%), Gaps = 54/507 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MS+ + FN A +    +S++   +  NI NA  + Y RR+         +++ +Q     
Sbjct: 1   MSIASAFNFAISGLTASSRKAEVVSSNIANAMTEGYARRE---------LSIASQTLGGT 51

Query: 61  NMFDKVLHAHS--SAIGQQRLLQSFEALKEMMSADDHYN------------NSPTHYISK 106
               ++L  +   + + QQ LL    A     +  D YN             S +  +S 
Sbjct: 52  GGGVRILGVNRIVNQVVQQDLLLMDSAAANTTAKADFYNRLETQIGDPETAGSLSATMSD 111

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
              +L + +          T +  A  V    N+ + ++Q  R  ADK I  ++  L   
Sbjct: 112 FESALLTAASMPDSTARLTTAVRAASTVADKLNSISEDLQAARLTADKSIAKQVRTLNET 171

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
           L +L  +N  I  + +  +DA   +D+R  L+ +I+EI+ +  + R NN + ++T+ G  
Sbjct: 172 LVQLQEMNRTITTQISIGNDAAGLMDERQSLVNQIAEIVPLRVVQRENNQIALFTTGGAI 231

Query: 227 LFETVPRDINFEKMNSYT--VTSESNP---IFIDGVVVSSNQGSAVPKGKIKALLQIRDS 281
           L +     I F+        +T +S     + I+G   S+     +  G + A   +RD 
Sbjct: 232 LLDGSAATIGFDGAGVMAPHLTLDSGALSGLTINGYPTSTKDDGPLGGGTLGAAFAVRDE 291

Query: 282 VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETI--- 338
           + P  Q+QLD  AR L+  F +       S   PGLF  D     D     G++  I   
Sbjct: 292 LAPEAQSQLDAFARDLMTRFEDPSVDTTLSAGDPGLFT-DAGSAFDASTEVGLAGRIRMN 350

Query: 339 -CVNPQYRSNPSFLRDG------GSVSKKFLWNVKNLAGYPDLINHYCD-SFNKNFIFDP 390
             V+P+   +   LRDG      G+VS   + N  + A    L       S N       
Sbjct: 351 AIVDPEQGGSSWHLRDGLMAAAPGAVSDGTILNALSAA----LTRESAPASGNYGSALRS 406

Query: 391 VAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSF 450
            +G+     LL +A +           S +L        +      S   GV+   E+  
Sbjct: 407 ASGLAAE--LLSFASSG--------RQSAELTQGYATARHEALTEMSLADGVDTDYEMQS 456

Query: 451 LIKVEQSYNISNKLIMFTDKMLQTLLE 477
           L+ +E++Y  + K++   D MLQ LL+
Sbjct: 457 LLVIEKAYAANAKVVQTIDAMLQELLD 483


>gi|296531743|ref|ZP_06894568.1| flagellar hook-associated protein FlgK [Roseomonas cervicalis ATCC
           49957]
 gi|296267926|gb|EFH13728.1| flagellar hook-associated protein FlgK [Roseomonas cervicalis ATCC
           49957]
          Length = 485

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 119/496 (23%), Positives = 209/496 (42%), Gaps = 37/496 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT------MTTISPENVTVVT 54
           M++ A  + A +      +Q A +  NI NA+   YVRRD       +  I     T +T
Sbjct: 1   MTISAALSNALSSLAAEQRQAAILSNNIANANTPGYVRRDMPRSERLVAGIGSGVDTAIT 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           QR  +  +      A +S     +L Q  E    ++        S +  +   + ++ + 
Sbjct: 61  QRLGDAALAAASRSADASEAYALQLKQGLETYNALIGQPSD-QRSLSSRLGAFQTAMTTL 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S      +     ++ A ++V   + +   V K RA+AD ++  E+  +   L +L   +
Sbjct: 120 SSAPDNAVAQSQALEAARDLVDALHDADAAVAKARAEADLQLSREVGAINSALDQLAETD 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPR 233
             +   +A      ++ D+RD LL +I   I I         ++V +  GT+L + TV  
Sbjct: 180 RRMALASARGGSTAEYEDRRDTLLAEIGRKIPIRIFDNGPGHLLVMSDGGTSLLDSTVVH 239

Query: 234 DINFEKMNSYTVTSES-NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
            +NF   ++  V +E  +P  +  V V          G +   L++RD+ +P F + LD+
Sbjct: 240 RLNF--THTPVVQAEQRHPAALSAVTVEGQALRVTETGSMAGALRLRDTTLPNFIDMLDQ 297

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ----GISETICVNPQYRSNP 348
           +A  LI SF + DP    + N  GLF   G  + D         G++  I +N     +P
Sbjct: 298 VAVRLIESFQDADPTL--TGNQAGLFTDAGAANWDGSGGYASFIGMARKIAINAAV--DP 353

Query: 349 SFLRDGGSVSKKFLWNVK---------NLAGYPDLINHYCDSFNKNFIFDPVAGINTNVT 399
                GG      LW ++         N A   ++I    D+ N    +D   G+  ++T
Sbjct: 354 D---QGGQ-----LWRLRTGVNAVAQGNAADNTNII-AALDAMNVVRSYDSNTGLPASMT 404

Query: 400 LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYN 459
           L + A  SIG ++  R+   D       +     +  SN   VN+ EEL  L+ V+Q+Y+
Sbjct: 405 LSQAASQSIGLMQGERAVWSDRAETRGRLAAEARQELSNKTAVNVDEELQRLLLVQQTYS 464

Query: 460 ISNKLIMFTDKMLQTL 475
            S ++I    +ML  L
Sbjct: 465 ASVQIIQAATRMLDEL 480


>gi|260431757|ref|ZP_05785728.1| flagellar hook-associated protein FlgK [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415585|gb|EEX08844.1| flagellar hook-associated protein FlgK [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 483

 Score = 97.8 bits (242), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 115/500 (23%), Positives = 210/500 (42%), Gaps = 43/500 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD---TMTTISPENVTVVTQRS 57
           MS+    N A    + AS+  A +  NI NA    Y +R      + IS   V VV    
Sbjct: 1   MSMSTALNNALGGLSAASRGAAVVSGNIANALTPGYAKRTLELATSQISGNGVQVVGVTR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +  +    L A  + +     +  F +  E +        S +  +    +SL + + N
Sbjct: 61  HHDPVLAANLRAADADLALNSAIADFHSRFEALVGTPDDAASVSARLVDFENSLITAASN 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                    V  + +++ +  N ++  ++++R+DAD++I   +  L   L ++  +N  I
Sbjct: 121 PGSAERLDQVARSGDDLARALNDASEGLREMRSDADRKIGSYVDTLNTTLKDIEDLNARI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  D +  LD+R VL+ +++E+I ++ + R+NN + +Y+  G  L E    +  F
Sbjct: 181 PAVQNAGGDINGLLDRRQVLIDQVNELIPVNVVARDNNRVSLYSDGGLILLEGSAAEFAF 240

Query: 238 EKMNSYTVTSESNP-----------IFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPI 285
                 T T ++ P           + I+G  V +S + + +  G + A  QIRD +   
Sbjct: 241 ------TTTGDTKPHMTIGNGLLSGLEINGQPVRTSGENAQIRGGALMAQFQIRDELSIE 294

Query: 286 FQNQLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIKDLDNKLCQGISETI----C 339
            Q QLD +A+ LI  F     DP A  ++  PGLF  DG +        G++  I     
Sbjct: 295 AQVQLDAVAQDLIERFETPGLDPTALATD--PGLFTDDGSR-FSAAAPAGLASRIELNAT 351

Query: 340 VNPQYRSNPSFLRDG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNV 398
           V+P    N   LR G G+ +     +   L  +  ++N             PV+  +   
Sbjct: 352 VDPDAGGNSWKLRAGLGAAAPNDSGDATQLQAFSTVLNQAR----------PVSIPDFGT 401

Query: 399 TLLEYARNSIGWLEKNRSDSHDLH--MKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
             L  A  S   L K  +++H     M      +   E      GV+   EL  ++++EQ
Sbjct: 402 GSLRAAELSEALLSKAGANAHTAQSRMTFAASLHQQMEQLVAEQGVDSDAELQRMMQIEQ 461

Query: 457 SYNISNKLIMFTDKMLQTLL 476
           +Y  + ++I   D++++ LL
Sbjct: 462 AYAANARIISVVDELMEMLL 481


>gi|83944166|ref|ZP_00956622.1| flagellar hook-associated protein [Sulfitobacter sp. EE-36]
 gi|83845033|gb|EAP82914.1| flagellar hook-associated protein [Sulfitobacter sp. EE-36]
          Length = 472

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 115/494 (23%), Positives = 205/494 (41%), Gaps = 37/494 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM--TTISPENVTVVTQRSE 58
           MSL    N A    +    Q      N+ NA    YVRR+ +  T    +   V+   SE
Sbjct: 1   MSLSGALNSATAGLHTTQGQSRIAADNVSNAMTPGYVRREAVLVTASGGQGGAVI---SE 57

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHY------NNSPTHYISKLRDSLE 112
            +   D  L    S +   R+ Q +++++E ++    Y        SP    +  ++SL 
Sbjct: 58  VRREVDATLQ-RMSRLENSRMTQ-YQSIQEGLTTYTAYLGQPGDGTSPADRFNDFQNSLT 115

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +     S +    +V   AE++V++   +A  +     D + EI  E+++L   L +L  
Sbjct: 116 TLVNMPSSNGAQTSVALAAEDLVRSVKGAATTLSTTLNDVNMEIRYEVADLNTALYQLRD 175

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET-V 231
           +N +    T    +A  F ++ D +L +IS I+       +N  + +YT  G  L E  V
Sbjct: 176 LNASGSGFTPGSLEAAQFDEKVDTILDQISGIVDTRIHRSSNGSISLYTVSGAALLEGRV 235

Query: 232 PRDINFEKMNSYTVTSESN-PIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            +D+ F   +   +    +   F DGV         +  G +  L +++   +P F  QL
Sbjct: 236 VQDVTFNPSDGTLMAGNQDITPFKDGV-------RGIQHGSLAGLSELKRETIPQFSQQL 288

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           DE AR LI +F + D      E   GLF  +G    D     G++  + +N +  S    
Sbjct: 289 DEYARGLIQTFEDADASLAPGE--AGLFTDNG-NAFDPANITGLASRLQINSKISSTGDA 345

Query: 351 ----LRDGGSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
               +RDG       L      AG   + IN +    +         GI   VTL +++ 
Sbjct: 346 EVWRIRDG-------LGATSPGAGSETVQINAFLAGLDTAMNAATGTGIPAEVTLRDFSA 398

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
             I      R+ + +    +      +  +  N+ GVN+ +E+  L+ +EQSY  +++++
Sbjct: 399 EMITSQAATRARAENDFNAAASAAEVVMSARRNSEGVNIDDEMQQLLLIEQSYAANSRVL 458

Query: 466 MFTDKMLQTLLEGV 479
               +M+ TL+  V
Sbjct: 459 TAVSEMIDTLIAAV 472


>gi|126730122|ref|ZP_01745934.1| flagellar hook-associated protein K [Sagittula stellata E-37]
 gi|126709502|gb|EBA08556.1| flagellar hook-associated protein K [Sagittula stellata E-37]
          Length = 482

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 120/495 (24%), Positives = 205/495 (41%), Gaps = 34/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR----DTMTTISPENVTV--VT 54
           MSL    N A +     ++  + I  NI NA N+ Y RR    + + + +   V V  V 
Sbjct: 1   MSLTGALNAAVSGLKANTRAASLISTNISNATNEAYGRRTLELNALGSGTRGGVLVAGVV 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           ++ +   M D++  A  S +     + +F    E +  +   + S T  I+   ++L S 
Sbjct: 61  RQYDPVLMADRM--ASDSQLAGGNDMYAFAKRMETLVGESGTSGSLTSRITAFENALLSA 118

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S N +     + V   A ++    N  + EVQ  R  AD  I  ++S L   +S L  +N
Sbjct: 119 SSNPASAQRLELVAVTATDLTNAVNDLSNEVQLARQTADTTIAKQVSTLNAAVSRLAAIN 178

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
           D ++   AS  +    LD+R  LL +IS I+ +  + R+   + ++T  G  L +    +
Sbjct: 179 DIVRSAEASGTETASILDERQALLNEISGIVPLRVVERDRGQIAIFTRRGGVLLDGKAYE 238

Query: 235 INFEKMN----SYTVTSES-NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
           I F        S T+ S   + + ++G  ++S+       G + A  ++RD      Q +
Sbjct: 239 IGFSTTGTIDASTTLGSGGLSGLTLNGAPINSSFNGMFAGGSLAAQFELRDVTAVGRQAE 298

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           LD +AR LI       P        PG F  +GI         GI+  I +N      P+
Sbjct: 299 LDGIARDLIERLGPGGPDTTLGATDPGFFTDNGIA-FTAANETGIAGRISLNALL--APA 355

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT--NVTLLEYARNS 407
               GG+      W +++  G         D+     I D +   N   + +L   AR  
Sbjct: 356 ---GGGT------WRIRDGIGAA-APGEVGDAALIQDIADALGASNVPGSASLPSIARTF 405

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHIS------ESYSNTVGVNLQEELSFLIKVEQSYNIS 461
           I  + +  S      ++S+  F  +S           T GV+  +EL  L++VEQ Y  +
Sbjct: 406 IDQVSQFSSSVAGERVRSENAFTFLSAQNRALREMELTKGVDTDQELQKLMQVEQYYTAN 465

Query: 462 NKLIMFTDKMLQTLL 476
            K+I   D + + LL
Sbjct: 466 AKVISTVDDLFERLL 480


>gi|163742564|ref|ZP_02149950.1| flagellar hook-associated protein K [Phaeobacter gallaeciensis
           2.10]
 gi|161384149|gb|EDQ08532.1| flagellar hook-associated protein K [Phaeobacter gallaeciensis
           2.10]
          Length = 472

 Score = 96.7 bits (239), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 115/482 (23%), Positives = 217/482 (45%), Gaps = 40/482 (8%)

Query: 17  ASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV----TQRSENKNMFDKVLHAHSS 72
           A +  + +  N+ N     Y RR    T + +  + V     QR  +  +   V  A+S 
Sbjct: 7   AGRSTSVVSENLSNVLTPGYSRRSLALTSAGDGFSGVKVGHVQRINDPALQSSVRSANSE 66

Query: 73  AIGQQRLLQSFEA-LKEMM-SADDHYNNSPTHYISKLRDSL-ESYSKNLSEDILGKTVID 129
            +G   +  +F   + E++ SADD Y  S T  ++     L E  S+  S   L    I 
Sbjct: 67  -VGVAEVKSAFFGRMTELVGSADDPY--SITQRLTDFDSGLIEVISRPDSGPRLNDLAI- 122

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
            AEE+V++   +A  ++  R  AD+ I++++  + + L +L  +N  I    ++  D+  
Sbjct: 123 QAEELVRSIADAAEGLRNQRTAADRAIDVQVDTVNQSLEKLQKLNAKIAISQSTGSDSAS 182

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE-KMNSYTVTSE 248
            LDQRD+L+ ++++II +  + R+   + +++  G  L +    +++F+ K ++    + 
Sbjct: 183 LLDQRDLLIDEVNKIIPVKVVNRDRGQVALFSEGGAVLLDGQAAELSFDGKADTLPYMTL 242

Query: 249 SNPIF----IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
            N +     I+G+ V++  G  V  G + A  ++RD +    Q  LD MA+ LI  F + 
Sbjct: 243 GNGLLSGLQINGIDVATGPGGPVRGGTLAAQFEVRDVLTVEAQEDLDAMAKDLIERFQDP 302

Query: 305 --DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP----QYRSNPSFLRDGGSVS 358
             DP    ++  PG+F   G    D     GI+  I +N     Q ++    LRDG + +
Sbjct: 303 ALDPTLTATD--PGIFTDQGAF-FDPANTVGIANRIELNDKIAMQGQAETWRLRDGLNAA 359

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                     AG   L+  Y D+ +       V     N+     + N +    ++++ +
Sbjct: 360 S------PGNAGDATLLRGYADALDAKRTVSSVGLGTANLDASTLSANLLSRFAQSKNSA 413

Query: 419 HDLHMKSQVVFNHI--SESYSNTV--GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
                +  V F     +E Y   +  GV+   EL  LI +E+ Y  + ++I   D++++T
Sbjct: 414 -----EQNVAFAAATYTEMYQRELAQGVDSDAELQNLIVIEKVYQANARMISVVDELMET 468

Query: 475 LL 476
           LL
Sbjct: 469 LL 470


>gi|254511786|ref|ZP_05123853.1| flagellar hook-associated protein FlgK [Rhodobacteraceae bacterium
           KLH11]
 gi|221535497|gb|EEE38485.1| flagellar hook-associated protein FlgK [Rhodobacteraceae bacterium
           KLH11]
          Length = 483

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 115/507 (22%), Positives = 208/507 (41%), Gaps = 57/507 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP---ENVTVVTQRS 57
           M++    N A    N AS+  A +  NI NA    Y RR    T SP     V VV    
Sbjct: 1   MNMSTALNNALGGLNAASRGAAVVSGNIANALTPGYARRTLELTTSPISGNGVRVVGITR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMM--SADDHYNNSPTHYISKLRDSLESYS 115
               +      A  + +   + + +F A  E +  +ADD    S    +++   SL    
Sbjct: 61  HQDPVLIANRRATDADLAAAKTVSAFHAGFEQLVGTADDA--TSIAARLAEFESSL---- 114

Query: 116 KNLSEDILGKTVIDNAEEVVQ----------NFNTSAREVQKIRADADKEIELEISNLRR 165
                 I   ++ D+A+ + Q            N ++  ++++R+DAD+ I  +I  L +
Sbjct: 115 ------ITAASLPDSAQRLDQAARAGAGLSATLNHASEGLRQMRSDADRTIGKQIDTLNQ 168

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
            L ++  +N  I   + S  D    LDQR +L+ +++E++ ++ + R N+ + +Y+  G 
Sbjct: 169 TLKDIEKLNARIPAVSNSGGDIGALLDQRQILIDQVNELVPVNVVARANDQVSLYSDGGL 228

Query: 226 TLFETVPRDINF----EKMNSYTVTSE--------SNPIFIDGVVVSSNQGSAVPKGKIK 273
            L E    + +F    + M   T+ +           P+ IDG          +  G + 
Sbjct: 229 ILLEGPAAEFSFSTTGDTMPHMTIGNGLLSGLEVNGQPVRIDGDFAQ------IRGGALM 282

Query: 274 ALLQIRDSVVPIFQNQLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIKDLDNKLC 331
           +   IRD +    Q  LD +AR LI  F     DP    ++  PGLF  +G +  D  L 
Sbjct: 283 SQFMIRDELAVEAQADLDAVARDLIERFEAPGLDPTTLATD--PGLFTDEGNR-FDPALQ 339

Query: 332 QGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV 391
            G++  I +N     +P    D   +       +    G   L++ +  +  +     P 
Sbjct: 340 TGLASRITLNATV--DPDTGGDSWRLRAGLGATLPGAPGDASLLHAFGAALTE---ARPS 394

Query: 392 AGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI--SESYSNTVGVNLQEELS 449
            G++     L  A  S   L +  +++H    +     N     E      GV+   EL 
Sbjct: 395 PGLSFGTGSLRAAEISEALLSRAGANAHSADQRRSFAANAQLEMEKIVAEQGVDSDVELQ 454

Query: 450 FLIKVEQSYNISNKLIMFTDKMLQTLL 476
            L+++EQ+Y  + +++   D+++ TLL
Sbjct: 455 RLMQIEQAYAANARIVAVVDELMDTLL 481


>gi|304321121|ref|YP_003854764.1| flagellar hook-associated protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300023|gb|ADM09622.1| flagellar hook-associated protein [Parvularcula bermudensis
           HTCC2503]
          Length = 481

 Score = 96.3 bits (238), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 114/495 (23%), Positives = 216/495 (43%), Gaps = 44/495 (8%)

Query: 7   FNKAQNICNN----ASQQFASIVRNIENADNKNYVRRDTM--------TTISPENVTVV- 53
           F+ A +I N+    AS +  +   NI NA  + Y RRD +        T I    V+VV 
Sbjct: 3   FSSALSIANSGLAAASIRAQTTASNIANATVEGYSRRDVVLSERVVGSTGI---GVSVVG 59

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
           T+R  +  +    +   ++     +   + ++L +++      N     Y ++   SL  
Sbjct: 60  TERVTSPVLTSTRIRLEAADSFATQTADTAKSLTQIVGEPGAQNGLFGAY-NRFEASLRD 118

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            +      I    V D+A+ +++ F  ++++   +R DAD+EI   ++ +   L  L  +
Sbjct: 119 AAATPESSIFQAEVADSAQNLIRVFANASQDANDLRRDADQEIGRLVNEVNEKLERLEDI 178

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N   + +      + + LD+R  L+ +I+EII ++   R    + + +  G  L +T  R
Sbjct: 179 NGLPEARI-----SPEILDERQKLVDEINEIIPVTAQNRGGQ-LKLISEGGQFLLDTTAR 232

Query: 234 DINFEKMNSYTVT----SESNPIFIDGVVVSSNQGSAVPK---GKIKALLQIRDSVVPIF 286
           +I+F    +   T    +  + + ++GV ++   GSA  K   G+I AL + RD  VP  
Sbjct: 233 EISFSTTGAIGRTAVLGAPLSGLTVNGVDITPT-GSAAHKSSGGRIGALFEARDVTVPGL 291

Query: 287 QNQLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
           Q++LD +A  L+  F+    DP   +++   GLF  DG          GI+E + +N   
Sbjct: 292 QDKLDGLAFDLVSRFAGDTVDPTIASTD--AGLFT-DGNTTAPTASYVGIAEALELNAAV 348

Query: 345 RSNPSFLRDGGS---VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLL 401
             +     +GG    +           +G  D +N   D+F       P  GIN N + +
Sbjct: 349 DPD-----EGGELYRIQAGIGATAPAPSGNGDQLNRLIDAFGAERAAPPALGINGNASAV 403

Query: 402 EYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
           +        + +  +++ D  + +        E     +GV+   EL  L+ +EQ+Y  +
Sbjct: 404 DLVAEVNAAVTEADAEAQDDALYASTRAQLAREEEQAIIGVDTDRELQQLLLIEQAYGAN 463

Query: 462 NKLIMFTDKMLQTLL 476
            ++I   D+ML  L+
Sbjct: 464 ARVIQTIDEMLDILM 478


>gi|254488055|ref|ZP_05101260.1| flagellar hook-associated protein FlgK [Roseobacter sp. GAI101]
 gi|214044924|gb|EEB85562.1| flagellar hook-associated protein FlgK [Roseobacter sp. GAI101]
          Length = 490

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 165/372 (44%), Gaps = 40/372 (10%)

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
           TV+ +A  +   FN ++  +QK+R  AD+ IEL++  L   L ++  +N  I       +
Sbjct: 136 TVVASARILANTFNEASDGLQKVRTTADRTIELQVDQLNNALLQVQELNAQITKTQVQGN 195

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT- 244
           ++   LD R  ++ +IS ++ + T+ R+N  + +Y++ G  L +++  +I FE+ N  T 
Sbjct: 196 NSSGLLDLRQRVIDEISVLVPVRTVARDNGQVAIYSTGGAVLLDSLAAEIGFERSNLVTP 255

Query: 245 VTSES----NPIFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             SES    + + I+G+   + +    +  G I A  +IRD +    Q Q+D +AR L+ 
Sbjct: 256 YMSESAGTLSGLTINGIAFRTGSSSGVLSGGSIAAQFEIRDEIAVEAQAQIDALARDLVE 315

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLD----------NKLCQGISETICVNPQYRSNPS 349
            F  +DP        PGL I D     D          N L Q +     V+P       
Sbjct: 316 RF--QDPAVD-----PGLAIGDAGLFTDEGNFFDPANENGLAQRLVLNAAVDPDQGGETW 368

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPD-----LINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            LRDG            N AG  D     L+N+   + +   +         + + ++  
Sbjct: 369 RLRDG-----------INAAGPGDVGDATLLNNMISALSTGRVSSSGIFSGGSYSTIDLT 417

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
                     R ++  +   S      ++E   +  GV+  +EL  L+ VEQ++  + ++
Sbjct: 418 STLTSHYGAERLNAEQIQSFSATQVTELTERLLSE-GVDSDQELQKLLLVEQAFAANARM 476

Query: 465 IMFTDKMLQTLL 476
           +   D+M+QTLL
Sbjct: 477 VQAVDEMMQTLL 488


>gi|119385424|ref|YP_916480.1| flagellar hook-associated protein FlgK [Paracoccus denitrificans
           PD1222]
 gi|119375191|gb|ABL70784.1| flagellar hook-associated protein FlgK [Paracoccus denitrificans
           PD1222]
          Length = 486

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 117/511 (22%), Positives = 205/511 (40%), Gaps = 63/511 (12%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE------NVTVVT 54
           MS+ +  + A +    AS+    +  NI NA    + RR+   +  P       N+  V+
Sbjct: 1   MSISSAISNAVSGLTAASRGIEIVSSNIANALTPGHARRELDLSSRPSEHGGGVNIDGVS 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           +      + D  L    + +G  R + +F A  E         +S    ++    +L S 
Sbjct: 61  RIFTAGLIADNRLA--EAGVGSSRTVAAFHAAMEKAFGTGTGISSLGQSLTDFESALTSA 118

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           +     D+    V+D A  + +  N  +  +Q  R+ A++ IE ++S L   L ++  +N
Sbjct: 119 ASRPDSDMRLSNVLDTATALAKKINDISTTIQAERSKAEQAIESDVSRLNAALQQVAKLN 178

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPR 233
             I   TA   DA   +D R   +  IS+I+ I  + R N  + ++T DG  L + T P 
Sbjct: 179 AQIVTITAQSKDASSLVDARQAAIDGISDILPIKEVPRENGRIALFTPDGAILLDGTEPA 238

Query: 234 DINFEKMNSYTV-----TSESNPIFIDG-VVVSSNQGSAVPKGKIKALLQIRDSVVPIFQ 287
            I F  +   T      +S  + + ++G  +    Q + +  G + A   IRD + P +Q
Sbjct: 239 RIEFSAVPGITAEMSIGSSALSALTLNGKPLTGPQQQTMLSGGSLGANFAIRDQIAPAYQ 298

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENV--PGLFI-ADGIKDLDNK--LCQGISETICVNP 342
            Q+D  AR L    S  DP+  +S N   PGLF  A G  D  N+      I+ T  V+P
Sbjct: 299 QQIDAFARDLYDRLS--DPMIDSSLNTGGPGLFTDAQGAFDPANESGFAGRIAVTFLVSP 356

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPD--------LINHYCDSFNKNFIFDPVAGI 394
           +          GG      LW ++     PD        L++    + + +         
Sbjct: 357 ET---------GGQ-----LWRIRAGINAPDPGNSGESALLDRLSSAISASRFPASAHLS 402

Query: 395 NTNVTLLEYARNSIGWLEKNR---------SDSHDLHMKSQVVFNHISESYSNTVGVNLQ 445
           N   +L   +         NR         S SH   +K+ ++            GV+  
Sbjct: 403 NAPRSLQTLSAELSSGAATNRIRSEASALQSSSHQSGLKAALLAE----------GVDSD 452

Query: 446 EELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +E+  L+ +E++Y  + K+    + ML  +L
Sbjct: 453 KEMESLLALERAYAANAKVFQTANDMLDAIL 483


>gi|114798876|ref|YP_758980.1| flagellar hook-associated protein FlgK [Hyphomonas neptunium ATCC
           15444]
 gi|114739050|gb|ABI77175.1| flagellar hook-associated protein FlgK [Hyphomonas neptunium ATCC
           15444]
          Length = 483

 Score = 94.0 bits (232), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 122/505 (24%), Positives = 210/505 (41%), Gaps = 51/505 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MS+ A    A++     SQ+   +  N+ NA    YVRR  +       V  +   S+  
Sbjct: 1   MSISAAILAARSGLQVTSQKAEIVATNVANASTPGYVRRSLV-------VGELVNGSQTA 53

Query: 61  N-MFDKVLHAHSSAI-GQQRLLQSFEALKEMMSA-----DDHYNNSPTHYISKLRDSLES 113
             M + V  A   AI  Q+R L S  A   ++++          N+ +     L  S  +
Sbjct: 54  GVMANGVARAGDDAIKAQRRELTSDVAQATVLASTWQTISQRVGNTSSG--GGLFRSFSN 111

Query: 114 YSKNLSEDIL-------GKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
           +   LS  +        G  ++D A+ V +  N+ +    + RA+AD EI   +  +   
Sbjct: 112 FETALSAAVTSPESTANGSALLDAAKSVARELNSLSEYGAQARAEADSEIAQGVETVNTA 171

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
           L ++  +N  I     +   A   +D+R  +L  I+E + I T+ R+   + V T+ G  
Sbjct: 172 LKQVQDLNKRIASIDRTSEQAATLMDERQRVLDTIAEFLPIQTVQRDAGTIDVLTTQGVY 231

Query: 227 LF-ETVPRDINFEKMNSYT-----VTSESNPIFIDGVVVSSNQGS--AVPKGKIKALLQI 278
           L   +  R I F   +++T        + + I +DG+ +++   S  AV  G   AL  +
Sbjct: 232 LINGSTARQIEFTPSSAFTSGQTLANGDLSGISVDGIDLTTGSTSFGAVSGGLFGALFTL 291

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSEK--DPIAGNSENVPGLFI---ADGIKDLDNKLCQG 333
           RD  VP F +QLD +A  +I   S+   DP     E   GLF+   A G+  L ++    
Sbjct: 292 RDQDVPAFMDQLDMVANDIITRLSDDAIDPTKTPGEQ--GLFVDPDAAGLSGLASR---- 345

Query: 334 ISETICVNPQYRSNPSFLRDG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA 392
           IS    V+P    +   LRDG G+ +     N   L+   D       S N N       
Sbjct: 346 ISVNAAVDPAQGGDIWRLRDGLGATASGPPGNSATLSAIYDAFTQ-VKSLNAN------- 397

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
           GI    +  + A      + + R     +   +Q     + E+  +  GV++  E+  L+
Sbjct: 398 GIQGAFSASDLAAQLSSVVGQKRVYQDSVLASTQAQHVTLVEAEQSLTGVDVDVEMESLL 457

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLE 477
            +EQ+Y  + ++I     M+  L+E
Sbjct: 458 LIEQAYAANARVIQVARDMIGILME 482


>gi|288962672|ref|YP_003452966.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
 gi|288914938|dbj|BAI76422.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
          Length = 465

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 111/494 (22%), Positives = 192/494 (38%), Gaps = 49/494 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD---TMTTISPENVTV---VT 54
           MS+      A +      QQ A +  N+ NA    YVRR+   +  T +     V     
Sbjct: 1   MSVQLALTAALSGLRTTQQQAAMLSHNLANATTAGYVRRELDLSAVTTAGRGAGVRVDAV 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  ++ +        S   GQQ    +  A   ++        S +  +SKL+ +    
Sbjct: 61  ARKVDELLIRDARFETSRYTGQQARASAL-ADYALVLGQPQDEKSVSTQLSKLQQAFSRL 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
               ++D     V+  A  +    N +A+  Q + ADA   ++  +  +   L  ++ +N
Sbjct: 120 HDMPNDDAARNAVVSQASALADGLNRNAQAAQTVLADAKDRLQTSVDAVNGSLQRVSELN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE--TVP 232
             I        DA D  D+RD LL ++S+ IGI T  R +  MVV T +G TL +    P
Sbjct: 180 GRIATLETRGGDAGDLRDERDRLLDQVSQEIGIRTYSREDGQMVVMTRNGQTLLDHPLAP 239

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                       +T     +  +GV +S+   S +  G+I   +Q     +P    QLDE
Sbjct: 240 --------GEQPLTLVGGEVTANGVALSAKPDSEIQSGRIMGYVQTIKQDMPRALAQLDE 291

Query: 293 MARVLIGSF--SEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           +A  L+  F  +E DP        PGLF              G++  I VN         
Sbjct: 292 LAAGLVQGFQGAEADPTK------PGLFTD---AGAAYGATAGLASRIAVN--------- 333

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNF--IFDPVAG-----INTNVTLLEY 403
                 V K   W +++       +     +  + F  +F    G     +  + TL  Y
Sbjct: 334 -----GVVKTESWRIQSGVQAAAALKPGDQTQIEKFQAVFTAARGFTATDMPASATLGSY 388

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A   +   +  R+ +       ++  + +  +  N  GVN+ +E+  L+ +EQSY  S +
Sbjct: 389 ATAMVSAQQGYRTGAESEMNARKISADTLESARINRDGVNIDDEMQKLLLIEQSYGASAQ 448

Query: 464 LIMFTDKMLQTLLE 477
           ++    +M+  LL+
Sbjct: 449 VVQVAGRMIDVLLQ 462


>gi|260574381|ref|ZP_05842385.1| flagellar hook-associated protein FlgK [Rhodobacter sp. SW2]
 gi|259023277|gb|EEW26569.1| flagellar hook-associated protein FlgK [Rhodobacter sp. SW2]
          Length = 485

 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 112/505 (22%), Positives = 218/505 (43%), Gaps = 51/505 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD----TMTTISPENVTVVTQ- 55
           MSL A  + A +    +S+    +  N+ NA  + Y RR+     ++        VVT  
Sbjct: 1   MSLSASLSNAMSGLTASSRAAEVVSSNVANAMTEGYARREINLAALSLGGAGKGVVVTGI 60

Query: 56  -RSENKNMF-DKVLHAHSSAIGQQRLLQSF-EALKEMMSADDHYNNSPTHYISKLRDSL- 111
            R  N+++  D+      + +G +    +F + L+  +   D  + S    ++    +L 
Sbjct: 61  NRVVNQSLLADR--RVAEAGVGDRDARTAFLQRLESTLGTSDSAS-SVLGRVAAFDSALI 117

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           E+ S+  SE  L   V+  A+ +    N ++ ++Q  RA AD +IE E++ L   L+ + 
Sbjct: 118 EASSRPESEARL-SNVLVAAQSLASGINAASTDIQAARASADDQIETEVATLNAGLARIA 176

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N  I+ +     DA   +DQR  L+ +++ I+ +  + R +N + +YT+ G  L +  
Sbjct: 177 ELNVQIRAQFGVSRDATALMDQRQQLVDQLASIVPLREVDRGHNQIALYTTGGIQLLDGR 236

Query: 232 PRDINFEKMN----SYTVTSES-NPIFIDG-VVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
              I F  +       T+ S S + + ++G  + +S   S +  G + A   +RD + P 
Sbjct: 237 AAVIEFTPVGVVTPDMTLASGSLSGLTLNGRSLPTSGAASMIGGGSLAAHFAVRDELAPA 296

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADG---IKDLDNKLCQGISETICVNP 342
            Q +LD +AR L+  F++       +   PGLF   G   +   +  L Q ++    V+P
Sbjct: 297 AQTKLDAVARDLVERFADPAIDTTRAPGDPGLFTDAGSAFVATDEVGLSQRLALNGAVDP 356

Query: 343 QYRSNPSFLRDG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI----------FDPV 391
                   LRDG G+V+     N   L+     +       +  F+           D +
Sbjct: 357 AQGGALWRLRDGMGAVAPGLSGNSALLSSLQTALAAPRAPVSGGFMPGARSFSSLNADVI 416

Query: 392 AGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFL 451
           +G++T     E         E + + +    ++ Q + N          GV+  +E+  L
Sbjct: 417 SGVSTARLGAEA--------ESSFATARATALQQQELEN----------GVDTDQEMQKL 458

Query: 452 IKVEQSYNISNKLIMFTDKMLQTLL 476
           + +EQ+Y+ + ++I     M+  L+
Sbjct: 459 LLIEQAYSANARVIQTAGDMIDILM 483


>gi|115522799|ref|YP_779710.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
 gi|115516746|gb|ABJ04730.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
          Length = 589

 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 130/288 (45%), Gaps = 13/288 (4%)

Query: 27  NIENADNKNY-VRRDTMTTISPENVTVVTQRSENKNMFDKVL--------HAHSSAIGQQ 77
           NI NAD   Y V+  + T+     V   T  +   +  DK+L            +A    
Sbjct: 27  NISNADTTGYTVKTASQTSEVTSGVGTGTSVTGITSNVDKLLMKSLVQAISGLGAADSTN 86

Query: 78  RLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQN 137
            +L+  +AL    S DD    S  + I+    ++ S +       L    +   + +   
Sbjct: 87  SMLERLQALYGSTSDDDGSGTSLANSIAAFETAIASLAATPGSASLQANAVSALDSLASQ 146

Query: 138 FNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVL 197
              ++  +Q +R+DAD+ I   + ++   L+ +  +N  IK   AS     D  DQR+  
Sbjct: 147 LRETSSGIQDLRSDADQSIASAVDDVNEQLNAIASLNAQIKQAAASNQPTGDLEDQRNTA 206

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY---TVTSESNPIFI 254
           LQ+I+  I +S  + ++ DM +YTS G  L ++   ++++   ++    T  S + P   
Sbjct: 207 LQEIASRINVSYFISSSGDMQIYTSSGQALLDSSVHELSYTTASTVAASTTYSTTPPSGF 266

Query: 255 DGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
            G++V  ++  S +  G + AL+ +RD+ +P  Q QLD++A  L  S 
Sbjct: 267 SGILVNGTDITSQISSGSVGALITLRDTTLPAAQAQLDQLATTLADSL 314


>gi|163744345|ref|ZP_02151705.1| Flagellar hook-associated protein [Oceanibulbus indolifex HEL-45]
 gi|161381163|gb|EDQ05572.1| Flagellar hook-associated protein [Oceanibulbus indolifex HEL-45]
          Length = 468

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 97/489 (19%), Positives = 202/489 (41%), Gaps = 31/489 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MS+ + FN A++  +    + + +  NI NA  + Y RR+ +       V +   R  ++
Sbjct: 1   MSISSAFNIARSGLSTTEGRASLVAGNIANAQTEGYARREAVQVTGNNTVDLRVARQVDE 60

Query: 61  NMFDKVLHAHSSAIGQQ----RLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
            +   +    S+ +G       +L S+  L  +    D    SP   +++ +  L+  + 
Sbjct: 61  RLA-GMTRGASAQLGAASVTGEVLGSY--LLTLGEPGDEV--SPAARLAEFQAGLDLLAN 115

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+      ++  +E +V + N +A  ++  R  A       +S +   L+++  +N+ 
Sbjct: 116 NPSDPAAQNDLLSRSETLVNSVNQAAVALEASRVQAGDSFVQSVSEVNEALADIAELNER 175

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           ++            +D+ +  L  +   +   +   ++  + ++T+ GT L       ++
Sbjct: 176 LRLVGGDGTGKAGLMDEMNRRLDALGSQMDFQSRWESDGSLTLHTTGGTEL-------VH 228

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK--GKIKALLQIRDSVVPIFQNQLDEMA 294
            +K    T   E+  +    + ++  + +A     G++  L  +  + +P  + QLDE A
Sbjct: 229 GDKAVRLTANRETGTLMAGNIDITPGRATARGSDSGRLAGLSGLIANDLPQMKLQLDEFA 288

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSF 350
           R L+ SF   D   G  +  PGLF  D     D     G++  + +N    P        
Sbjct: 289 RGLVQSFEAADASVGAGQ--PGLFT-DAGGAFDATALDGLAGRLSINNSVHPDKGGALWR 345

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           LRDG   +      ++   G    +N + D       FD   G++T   L ++  + +  
Sbjct: 346 LRDGAGAT------IQGEPGDTTQLNAFVDVLETGITFDAATGLSTTARLGDFGADMVSQ 399

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
               R  +      ++V      ++ S+  GVN+  EL  L+++EQ+Y  + +++     
Sbjct: 400 QNVLRVGADAQAETARVRLVTFEDNRSSIEGVNIDTELQKLLEIEQAYGANAQVLSSLTD 459

Query: 471 MLQTLLEGV 479
           ML TLL  V
Sbjct: 460 MLDTLLASV 468


>gi|328545572|ref|YP_004305681.1| flagellar hook-associated protein [polymorphum gilvum SL003B-26A1]
 gi|326415313|gb|ADZ72376.1| Flagellar hook-associated protein [Polymorphum gilvum SL003B-26A1]
          Length = 459

 Score = 91.3 bits (225), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 85/385 (22%), Positives = 161/385 (41%), Gaps = 56/385 (14%)

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           + L D+ ES S       L  T ++  +E+       +  VQ +R+ AD +I   +++  
Sbjct: 122 AALADTPESVS-------LAATAVNELDELAAQLRALSASVQSLRSAADTDIAAAVTSAN 174

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             ++ +  +N+ I    A      D  DQR+  L  +S+ +G+++ + ++  M VYT+ G
Sbjct: 175 DTITAIASLNEQILATAARGQSTADLEDQRNQALATLSQSLGVTSFIADDGSMKVYTTTG 234

Query: 225 TTLFETVPRDINFEKMNSY--TVTSESNPIFIDGVVVSSNQGSA-VPKGKIKALLQIRDS 281
             L ++    ++F+  +S    V  + +   + G+ V     +A + +G+I ALL +RDS
Sbjct: 235 QVLVDSRAHLLSFDPSSSVGAGVVYDGSGSGLSGITVDGKDITASMTEGEIGALLALRDS 294

Query: 282 VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISET-ICV 340
            +P  Q  LD +A  L+ S +   P                       L  G   T I V
Sbjct: 295 TLPEVQEMLDALASTLVSSLNAVSP----------------------DLLSGTDATDITV 332

Query: 341 NPQYRSNPSFL---RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
           N      PS L     G  ++   +  ++    +PD                        
Sbjct: 333 NGDLLRTPSALLPETGGADIATALVEALQGKTAFPDTARQG----------------GGE 376

Query: 398 VTLLEYARNSIGWL--EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
            T  +YA   +  +  + N + +H     +Q+    IS++ S+  GVN+ EE + +  +E
Sbjct: 377 STFADYAARLLSLVVSDANSASAHLERATAQLA--EISDTMSSLYGVNIDEETARMSNLE 434

Query: 456 QSYNISNKLIMFTDKMLQTLLEGVK 480
           Q Y+ S +++    +M + LL  + 
Sbjct: 435 QLYSASAQVLSILKQMYEDLLAAIA 459


>gi|89067518|ref|ZP_01155031.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
 gi|89047087|gb|EAR53141.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
          Length = 478

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 167/395 (42%), Gaps = 43/395 (10%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           ++ +  +L S + + S DI    V D    +    N +   +Q++R +AD+ I  ++++L
Sbjct: 105 LTAVEQALVSAAADPSSDIRLGHVADRLTALTGALNHAGDSLQEMRTEADRSIATQVASL 164

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            R L  +  +N  I    A   D    LD+R   +  IS ++ +  IVR N+ + + T  
Sbjct: 165 NRQLERVETLNGEITSLRARGVDVSPLLDERQKAVDGISALVPVREIVRENDAIALMTLS 224

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN--QGSA----VPKGKIKALLQ 277
           G TL +   R+I F  +N  T         + G+ ++ +   GS     +  G++ +   
Sbjct: 225 GATLLDGKAREIGFSPVNLVTADMTHASGALSGLTIAGDPVTGSTAYGKLGGGRLGSTFD 284

Query: 278 IRDSVVPIFQNQLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIKDLDNKLCQGIS 335
           IRD+++P     LD  AR L   F++   DP    +   PGL   D    LD     G++
Sbjct: 285 IRDTILPDVSTGLDAFARDLADRFADPATDPTL--AAGAPGLLT-DAGAALDPLDTPGLA 341

Query: 336 ETICVNPQYRSNP------SFLRDG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIF 388
             I +NP    +P      + LRDG G  S   +       G    I  + D+   +   
Sbjct: 342 SRIALNPTV--DPGNGGSLARLRDGLGETSSAPV-------GSSTQIERWLDALQDSRRT 392

Query: 389 DPVAGINTNVTLLEYARNSIGWLEKNRSD--SHDLHMKSQVVFN----HISESYSNTVGV 442
           D          L   A ++ G +    +D  S    ++  + F      + +S     GV
Sbjct: 393 D----------LGGSAASASGHMASLLADVGSRRYAIEQDLAFETARWEVLKSAELANGV 442

Query: 443 NLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   EL  L+ +EQ+Y  + K++   + +L  LLE
Sbjct: 443 DTDRELQELLLIEQAYAANAKVLQTVNSVLTRLLE 477


>gi|27378814|ref|NP_770343.1| flagellar hook-associated protein [Bradyrhizobium japonicum USDA
           110]
 gi|27351963|dbj|BAC48968.1| flaN [Bradyrhizobium japonicum USDA 110]
          Length = 582

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           ++ L  +L S +   S   L    +    +VV     ++  +QK+R++ADK+I   + ++
Sbjct: 115 LADLESALSSLASTPSSASLQSNAVSALNDVVSQLRETSSGIQKLRSNADKDIASSVDDV 174

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            + L ++  VN  IK   AS     D  DQR+  LQ ++  + +S    +N D+ VYT+ 
Sbjct: 175 NKDLQQIANVNAEIKQVAASGQSTADLEDQRNTALQDVASKMNVSYFTASNGDLQVYTTS 234

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
           G  L ++    I++    + + ++    I ++GV ++S     +  G I AL+ +RD  +
Sbjct: 235 GQALVDSSAHTISYTTAANVSSSTSFGAISVNGVDITSQ----ITSGDIGALVTLRDKTL 290

Query: 284 PIFQNQLDEMAR 295
           P  Q+QLD++A+
Sbjct: 291 PAAQSQLDQLAQ 302


>gi|159045918|ref|YP_001534712.1| flagellar hook-associated protein FlgK [Dinoroseobacter shibae DFL
           12]
 gi|157913678|gb|ABV95111.1| flagellar hook-associated protein FlgK [Dinoroseobacter shibae DFL
           12]
          Length = 485

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 122/501 (24%), Positives = 215/501 (42%), Gaps = 43/501 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNY-VRRDTMTTIS----PENVTVVTQ 55
           MS+ +    A +    AS+  + +  NI NA  + Y VR+   T++S       V VV  
Sbjct: 1   MSVTSTLGNALSGLTAASKAASVVSSNIANATTEGYGVRQVQTTSVSLNGQGSGVQVV-- 58

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQ---SFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
            S ++N+ + VL    +A           SF    E          S +   S+   +L 
Sbjct: 59  -SVSRNVNEGVLADRRAADAAYAQAATLASFYGSVEGAIGLPGDEGSLSSEFSQFEAALV 117

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
                   D     V+  AE +    N  + ++Q  R +A+KEI  ++ NL   L+++  
Sbjct: 118 EAGSRPDSDARLANVVRAAESLAGTLNDLSADIQSERLEAEKEIARQVDNLNTSLAQIQD 177

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I+ + A+ +D    +DQR VL+ +I+ I+ +S + R+   + + T  G  L +   
Sbjct: 178 LNGDIRLQIAAGNDPLGLMDQRQVLIDQIATIVPVSVVDRDFGQVALITESGGVLLDGTA 237

Query: 233 RDINFEKMNSYT--VTSESNPIF---IDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIF 286
            +I+F  +   T  +T  S  ++   I+G  V S++  + +  G + AL +IRD +    
Sbjct: 238 AEISFRDVGLITPDMTVASGGLYQVEINGSPVDSTSPNNPLKGGSLDALFEIRDELAVSA 297

Query: 287 QNQLDEMARVLIGSF--SEKDPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQ 343
           Q  +D +AR LI  F  S  DP     E  PGLF  A  + D  N++  G++  I +N  
Sbjct: 298 QGDVDAVARDLIERFQNSAIDPTLSAGE--PGLFTDAGALVDPANEV--GLAGRIELN-- 351

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNL--------AGYPDLINHYCDSFNKNFIFDPVAGIN 395
            R +P+    GG V     W V+           G   +I    D+ ++  +    +  +
Sbjct: 352 ARVDPA---KGGEV-----WRVRTGLGATSPGDPGAGGIILALSDALSEPKVVASGSFSS 403

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
              T    A + +  +   R  S +    +   +  +  S     GV+   EL  L+ +E
Sbjct: 404 IPRTAAALASDLLSTIGAARQASENEVSYTAAKWETL-RSLELEGGVDTDAELQKLLMIE 462

Query: 456 QSYNISNKLIMFTDKMLQTLL 476
            +Y  + ++I   D+ML  LL
Sbjct: 463 TAYAANARVIQTVDEMLDLLL 483


>gi|146341764|ref|YP_001206812.1| putative flagellar hook-associated protein 1 FlgK [Bradyrhizobium
           sp. ORS278]
 gi|146194570|emb|CAL78595.1| putative flagellar hook-associated protein 1 (HAP1, FlgK protein)
           [Bradyrhizobium sp. ORS278]
          Length = 581

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 88/166 (53%), Gaps = 4/166 (2%)

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
           ++      +++  VQ +R +ADK+I   + ++   L +++ +N  I+   AS     D  
Sbjct: 143 DDFASQLRSTSSSVQTLRGNADKDIASSVQSVNDDLKQISDLNVEIRKMAASGQSTADLE 202

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           D+R+  LQ +S  + +S    +N D+ VYTS G  L ++    +++    + + +S  + 
Sbjct: 203 DERNSALQDLSSYMNVSYYTASNGDLQVYTSSGRALVDSSAHTLSYTTSANISASSSFSG 262

Query: 252 IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           I +DGV VSS     +  GKI +L+ +RD  +P  Q QLD++A  L
Sbjct: 263 IMVDGVDVSSQ----ITSGKIGSLITLRDDTLPAVQTQLDQLASQL 304


>gi|126734126|ref|ZP_01749873.1| flagellar hook-associated protein FlgK [Roseobacter sp. CCS2]
 gi|126716992|gb|EBA13856.1| flagellar hook-associated protein FlgK [Roseobacter sp. CCS2]
          Length = 480

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 117/492 (23%), Positives = 201/492 (40%), Gaps = 55/492 (11%)

Query: 16  NASQQFASIVR-NIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMF-------DKVL 67
            A+ + A +V  N+ NA  + Y RR    +           R ++ N F       D+ L
Sbjct: 13  TATSRMAEVVSSNLSNALTEGYGRRGVELSSVQVGGRGGGVRVDSINRFVDAGLLADRRL 72

Query: 68  HAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTV 127
            A ++  GQ+R +     L++ +   D             R  + + S   SE  L  +V
Sbjct: 73  -ADAALSGQERSVDLVMRLEQAIGGPDDAAGLGARLAEFERALIAAGSDPASELRL-ASV 130

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           +   E V      +   VQ +R DAD  I  +I  L   L ++  +N  I   + S  D 
Sbjct: 131 VARLEGVAGTLKANTASVQALRQDADVAIARDIDVLNGALQQVDALNKDILRISGSGDDP 190

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTS 247
              LD R   + +I+ I+ +  + R+N  + + T+ GTTL ++ PR+  F+  N+ T+T+
Sbjct: 191 SALLDARQRAVDQIAGIVPVREMPRDNGSIGLMTTSGTTLLDSRPREFGFQ--NTLTITA 248

Query: 248 ES-------NPIFIDGVVVSSNQGSA-VPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           +          I +DGV +    G   +  G + A   +RD  +   Q+ LD +   L+ 
Sbjct: 249 DMTLASGALGAIKLDGVALDLATGVGRLDGGTLGAAFVLRDQTLVQAQSALDGITADLVA 308

Query: 300 SFSEKDPIAGNSENVPGLFIAD-G-IKDLDNKL----CQGISETICVNPQY----RSNPS 349
            F +       S N P L   D G + D  N L      G++  I VNP        N +
Sbjct: 309 RFQD-------STNDPSLMPGDIGLLTDQGNPLDLSDLSGLAGRISVNPAIVPAQGGNLA 361

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
            LRDG + +           G    IN +  + +   +  P A + +    +    + +G
Sbjct: 362 LLRDGLNAT------TPGPTGDAAQINRWIAALDTPRMDVPGATLASASGRIAAYVSEVG 415

Query: 410 WLEKNRSDSHDLHMKSQVVFNHIS-ESYSNTV---GVNLQEELSFLIKVEQSYNISNKLI 465
                   +  L  + Q+ F     E+        G++   EL  L+++EQ+Y  + K+I
Sbjct: 416 --------TTRLMAQEQLSFTTARWETLREAELADGIDTDVELQRLLQIEQAYAANAKVI 467

Query: 466 MFTDKMLQTLLE 477
              D M+Q L+E
Sbjct: 468 QTVDFMMQRLME 479


>gi|144900940|emb|CAM77804.1| Possible flagellar hook-associated protein 1 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 554

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 104/471 (22%), Positives = 194/471 (41%), Gaps = 86/471 (18%)

Query: 84  EALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           E L ++ S+D     + +  +++L  +LE  +     D L    +    +   +   ++ 
Sbjct: 96  EILGQLTSSD-SGGGTLSASLTELSATLEELAATPESDTLKTQAVLQLTDAAASLRDTSA 154

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISE 203
           +VQ +RA+AD  IE  ++++   L  +  +ND+I    +      D  DQR VL+ ++S 
Sbjct: 155 QVQDLRAEADDGIESAVASVNESLHAIDSLNDSIVLAQSRGESTADLEDQRMVLVAQLST 214

Query: 204 IIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSES-NPIFIDGVVVSSN 262
            + IS     +  M +YT  G  L  +   +++++  N  TVTSE+  P   D + ++  
Sbjct: 215 QMDISYYTGEDGAMTIYTG-GQPLLNSSVHELSYQASN--TVTSETVYPGGFDAITLNGQ 271

Query: 263 Q-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL-----------------------I 298
              ++V  G I AL+++RD  +P  Q+QLD +A  L                       +
Sbjct: 272 DITTSVKSGTIAALVELRDDTLPAVQDQLDTIATDLRDQMNALSNQGSASPAPQNLTGTV 331

Query: 299 GSFSEKDPIAGNSENVPGLFIADG------------IKDLDNKL-----CQGISETICVN 341
              +  D IAG      GL  +DG            I  +D+ L       G+S ++  +
Sbjct: 332 AGLAGTDAIAGTGTLRVGLVDSDGSAQTLTDIDMSTITSVDDLLGALNAIAGVSASLDAD 391

Query: 342 PQY-----RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
            Q       ++      GG V  K   +V    G  D++    D     F+    A +  
Sbjct: 392 GQLVVESTDASLGIALSGGDVGGK---SVSGYFGLNDMLTG--DGAEDLFVS---ASLTA 443

Query: 397 NVTLLEYAR---NSIGW----LEKNRSDSHDLHMKSQVV--------------------F 429
           + +LL       N IG     L +  +D+ D    + +V                     
Sbjct: 444 DPSLLAVGSLGDNGIGLDGGALAQAMADAIDTSAATDLVADIGAKSKAADSVATSRETTL 503

Query: 430 NHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
             +++S+S+  GVN+ EE + + ++E +Y+ S +++    +M  +LL  V 
Sbjct: 504 TALTDSFSSRYGVNIDEETAHISELENAYSASAQVLSAIQEMFDSLLNAVS 554


>gi|110677962|ref|YP_680969.1| flagellar hook-associated protein FlgK [Roseobacter denitrificans
           OCh 114]
 gi|109454078|gb|ABG30283.1| flagellar hook-associated protein FlgK [Roseobacter denitrificans
           OCh 114]
          Length = 481

 Score = 83.6 bits (205), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 176/366 (48%), Gaps = 28/366 (7%)

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
           +V+D A ++    + ++  VQ+ R+DAD+ I+++I  L   L  +  +N  I    ++  
Sbjct: 127 SVVDAARDIATLISKASDGVQQARSDADRAIQVQIDRLNTSLQSVKELNSQITRTISTGS 186

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV 245
           DA    D R  ++ +I+ I+ +  + R+N  + +Y++ G  L +    +I F  +N  T 
Sbjct: 187 DASALFDNRQAIVDEINAIVPVRLVPRDNGQIALYSTGGAILIDGGVAEIEFNAVNQVTP 246

Query: 246 -----TSESNPIFIDGVVVSSNQGSAVPKGKIKAL-LQIRDSVVPIFQNQLDEMARVLIG 299
                    + + ++G  V ++       G       +IRD +    Q QLD  AR LI 
Sbjct: 247 FMTLGGGTLSGLSVNGYPVRTDSARGALGGGTLGAHFEIRDELGTSAQTQLDAFARDLIE 306

Query: 300 SFSEKDPIAGNSENV--PGLFIADGIK-DLDNKLCQGISETICVNP---QYRSNPSF-LR 352
            F  +DP    S  V  PG+F   G+  D  N++  G+S  + VN    + +   S+ +R
Sbjct: 307 RF--QDPAVDASLAVGDPGIFTDAGLAFDPVNEI--GLSARLSVNAAVDERQGGESWRIR 362

Query: 353 DG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
           DG  +++   + + + +    D ++      + +F     AG  + + L+    + +G  
Sbjct: 363 DGVNALTPGDVGDARLIQALSDTLSAKRAPASGDF----GAGAFSAMNLISTFTSQVGA- 417

Query: 412 EKNRSDSHDLHMKSQVVFNHISES-YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +++R++       SQ  F+ +++   +N  GV+  +EL  L+ VEQ+Y  + ++I   D+
Sbjct: 418 DRSRAEQTLSFASSQ--FDELTQQVLAN--GVDSDQELQRLLIVEQAYAANARMIEAADE 473

Query: 471 MLQTLL 476
           M+QT+L
Sbjct: 474 MMQTIL 479


>gi|56695116|ref|YP_165463.1| flagellar hook-associated protein FlgK [Ruegeria pomeroyi DSS-3]
 gi|56676853|gb|AAV93519.1| flagellar hook-associated protein FlgK, putative [Ruegeria pomeroyi
           DSS-3]
          Length = 483

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 108/502 (21%), Positives = 198/502 (39%), Gaps = 47/502 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD---TMTTISPENVTVVTQRS 57
           M++ A  N A +    AS+       NI NA    Y RR       TI    V ++    
Sbjct: 1   MTISAALNSALSGLTAASRATGVASDNIANALTPGYARRSLEVAGNTIGGAGVRILGVVR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +  +         +A G    +  F      +  + +   S  + I++   SL + +  
Sbjct: 61  NSDPVLLASRRGADAAQGYADGVSGFHTRMARLVGNVNDPRSVPNLIAEFESSLIAAAST 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S       V   A E+    N ++  +++ R DAD+ I  ++  L   L  +  +N  I
Sbjct: 121 PSVQTRLDAVATAASELATALNAASNGLREARNDADRSIGQQVDRLNTVLQNVETLNGRI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
           +    S  D+   LDQR  L+ +++ +I ++ + R++  + ++T  G  L +     +  
Sbjct: 181 QSVKLSGGDSAPLLDQRQKLIDEVNTMIPVNVVARDHGSVALFTDGGAILLDGPAAQL-- 238

Query: 238 EKMNSYTVTSESNP-----------IFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPI 285
               S+T T ++ P           + ++G+ +  S   SA+  G + A  ++RD +   
Sbjct: 239 ----SFTPTLQTMPHMTLENGLLSGLELNGMPLRLSGPTSAIRGGSLAAAFEVRDDLAIE 294

Query: 286 FQNQLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIK---DLDNKLCQGISETICV 340
            Q  LD +AR LI  F     DP A  ++   GLF  +G +        L   +     V
Sbjct: 295 AQQDLDAVARDLIERFEAPGLDPTAAPTD--AGLFTDNGARFSASAQTGLAGRLKLNASV 352

Query: 341 NPQYRSNPSFLRDG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI-FDPVAGINTNV 398
           +P        LRDG G+     + N +        IN +  +        DP  G     
Sbjct: 353 DPGQGGQSWRLRDGLGAAVPGAVGNAQQ-------INAFHQALTATRTPSDPRFGTG--- 402

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTV----GVNLQEELSFLIKV 454
              +   N +G    +R   ++     ++ F   S +    +    GV+   EL  L+++
Sbjct: 403 ---DMTANQVGAALLSRVAQNESLATERLTFASASRTEMQKLELEQGVDTDVELQMLMQI 459

Query: 455 EQSYNISNKLIMFTDKMLQTLL 476
           EQ+Y  + ++I    +M+ TLL
Sbjct: 460 EQAYAANARMIETVGEMMDTLL 481


>gi|163735544|ref|ZP_02142976.1| flagellar hook-associated protein K [Roseobacter litoralis Och 149]
 gi|161391164|gb|EDQ15501.1| flagellar hook-associated protein K [Roseobacter litoralis Och 149]
          Length = 481

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 89/367 (24%), Positives = 177/367 (48%), Gaps = 32/367 (8%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+D A ++    + ++  VQ+ R+DAD+ I+++I  L   L  +  +N  I    ++  D
Sbjct: 128 VVDAARDIANLISAASDGVQQARSDADRSIQVQIDRLNTSLQNVKELNSQITRTISTGSD 187

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV- 245
           A    D R  ++ +I+ I+ +  + R+N  + +Y++ G  L +    +I F  +N  T  
Sbjct: 188 ASALFDSRQAIVDEINAIVPVRLVPRDNGQIALYSTGGAILLDGGVAEIEFNAVNQVTPF 247

Query: 246 ----TSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
                   + + ++G  V ++     +  G + A  +IRD +    Q QLD  AR L+  
Sbjct: 248 MTLGNGTLSGLSVNGYPVRTDSARGTLGGGTLGAQFEIRDELGTSAQTQLDAFARDLVER 307

Query: 301 FSEK--DP--IAGNSENVPGLFIADGIK-DLDNKLCQGISETICVNP---QYRSNPSF-L 351
           F +   DP   AG+    PG+F   G+  D  N++  G+S  + +N    + +   S+ +
Sbjct: 308 FQDPAVDPSLAAGD----PGIFTDAGVAFDPLNEV--GLSARLGINADVDERQGGESWRI 361

Query: 352 RDG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDG  +V+   + + + +    D +       +  F     AG  + + L+    + +G 
Sbjct: 362 RDGVNAVTPGDVGDARLIQSLSDTLTAKRTPASGEF----GAGSFSAMNLISTLTSQVGS 417

Query: 411 LEKNRSDSHDLHMKSQVVFNHISES-YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +++R++       SQ  F+ +++   +N  GV+  +EL  L+ VEQ+Y  + ++I   D
Sbjct: 418 -DRSRAEQSLSFASSQ--FDELTQQILAN--GVDSDQELQRLLIVEQAYAANVRMIEAAD 472

Query: 470 KMLQTLL 476
           +M+QT+L
Sbjct: 473 EMMQTIL 479


>gi|86747894|ref|YP_484390.1| flagellar hook-associated protein [Rhodopseudomonas palustris HaA2]
 gi|86570922|gb|ABD05479.1| Flagellar hook-associated protein [Rhodopseudomonas palustris HaA2]
          Length = 588

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 138/298 (46%), Gaps = 21/298 (7%)

Query: 17  ASQ-QFASIVRNIENADNKNYVRRD-----TMTTISPENVTVVTQRSENKNMFDKVLHAH 70
           ASQ Q +    N+ NAD   Y  +      T +  +   V++    S    +  K + A 
Sbjct: 16  ASQVQISVASSNVSNADTTGYSVKTANQVATTSGGAGTGVSITGITSSVDKLLMKSVIAA 75

Query: 71  SSAIGQQRL----LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKT 126
           +S +G   +    L   +AL    S  +    S  + ++ L  ++ S +   S   L   
Sbjct: 76  TSELGAAEIDDTYLDRLQALYGSTSGANDTGTSLANTLASLESAVTSLAGTPSSASLQAN 135

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+   +++      ++  +Q +RADAD EI  ++  +   L  +  +ND IK   AS + 
Sbjct: 136 VVSALDDLASQLRETSSGIQSLRADADAEIAADVDEVNTALKTIDDLNDQIKQAAASGNS 195

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS---- 242
             D  DQR+V LQ ++  + IS  V ++ DM VYTS G  L ++    ++F   +S    
Sbjct: 196 TADLEDQRNVALQTVAGKMNISYFVSSSGDMQVYTSGGQALVDSSAHLLSFTAASSVKAS 255

Query: 243 --YTVTSES-NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             Y  TS   + I ++GV V+S     +  G+I AL  +RD+ +P  Q QLD++A  L
Sbjct: 256 STYDGTSSGLSGITLNGVDVTSQ----ISSGEIGALFDLRDTELPAAQAQLDQLATTL 309


>gi|192289145|ref|YP_001989750.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           TIE-1]
 gi|192282894|gb|ACE99274.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           TIE-1]
          Length = 587

 Score = 80.5 bits (197), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 104/199 (52%), Gaps = 9/199 (4%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           ++ L  +L S +   +   L   V+D  + V      ++  +QK+R++AD++I   + ++
Sbjct: 115 LASLESALSSLASTPTSSALQSNVVDALDSVTSQLRETSSGIQKLRSNADQDIASAVGSV 174

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              + ++  +N AIK   A+     D  D+R+  LQ +S  + +S    +N D+ VYT+ 
Sbjct: 175 NDDVQKIADLNAAIKQAAAAGQSTADLEDKRNTALQDLSSQMNVSYYTASNGDLQVYTAT 234

Query: 224 GTTLFETVPRDINFEKMNSYT-VTSES----NPIFIDGVVVSSNQGSAVPKGKIKALLQI 278
           G  L ++    +++    S + VTS      + I ++GV V+S     +  GKI AL+ +
Sbjct: 235 GQALVDSTAHPLSYTTTASVSAVTSYGSGGFSGIMLNGVDVTSQ----ITSGKIGALVAL 290

Query: 279 RDSVVPIFQNQLDEMARVL 297
           RD  +P  Q+QLDE+A+ L
Sbjct: 291 RDQTLPAAQSQLDELAQQL 309


>gi|221640803|ref|YP_002527065.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           KD131]
 gi|332559781|ref|ZP_08414103.1| FlgK2 [Rhodobacter sphaeroides WS8N]
 gi|221161584|gb|ACM02564.1| Flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           KD131]
 gi|332277493|gb|EGJ22808.1| FlgK2 [Rhodobacter sphaeroides WS8N]
          Length = 481

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 113/506 (22%), Positives = 193/506 (38%), Gaps = 55/506 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENV-TVVT 54
           MS+    + A +  N  S+   +   N+ NA  + + RR+   T        + V TV  
Sbjct: 1   MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSYGGGGQGVRTVGI 60

Query: 55  QRSENKNMF-DKVLHAHSSAIGQQRLLQSF-EALKEMMSADDHYNNSPTHYISKLRDSLE 112
            R  N  +  D+ L    +A G +    +F +AL +     D    S    IS    SL 
Sbjct: 61  DRMVNMALVADRRLA--DAATGDRDTRAAFYQALADATG--DTGGGSLLARISAFSASLV 116

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + +         + V+D A+ +      ++  V + R  AD  I  +I  L   L+ +  
Sbjct: 117 TAASRPESQARLQDVLDKAQSLAAGLRAASDAVLEARRAADASIADQIKTLTATLARVQQ 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I     +  D+    D+R  L+  IS I+ +  + R N  + ++T+ G  L +   
Sbjct: 177 MNATITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLDGRV 236

Query: 233 RDINFEK-----MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIF 286
            DI FE        S     +   + ++G+ +  +  G  +  G + A   +RD + P  
Sbjct: 237 ADIAFEPEPGLVAASSVAAGDLGLLTVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAE 296

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----P 342
           Q +LD +A+ LIG  +  D   G  +   GLF  DG    D     G++  + VN    P
Sbjct: 297 QARLDALAQDLIGRMAAADASLGAGD--AGLFTDDGAA-FDPAAPAGLASRLSVNALADP 353

Query: 343 QYRSNPSFLRDG---------GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
                   LRDG         G  +          A  P    H  +  +  F F  +A 
Sbjct: 354 DRGGALWHLRDGLQRPSEGDSGDPTLLNALAAALDARTP----HAANGLSGTFSFSGLAA 409

Query: 394 --INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFL 451
             ++     L  A     +    R +   L +                 GV+   E+  L
Sbjct: 410 ETVSGAAVALVSAEAEASFASARRDELQALILAD---------------GVDTDREMEQL 454

Query: 452 IKVEQSYNISNKLIMFTDKMLQTLLE 477
           + +E++Y  + K++   D +LQ LLE
Sbjct: 455 LLLERAYAANAKVVTACDDLLQYLLE 480


>gi|23016696|ref|ZP_00056449.1| COG1256: Flagellar hook-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 858

 Score = 79.7 bits (195), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 133/290 (45%), Gaps = 23/290 (7%)

Query: 24  IVRNIENADNKNYVRRDTMTTISPENVTV------VTQRSENKNMFDKVLH---AHSSAI 74
           I +N+ N + K YVR+     ++PE+  V      V Q +  +N+ + ++      +S  
Sbjct: 24  ISQNVVNVNTKGYVRKQ----MTPESRVVAGVGAGVQQGALTRNVDEGLMRDIRRQTSTQ 79

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
           G   + Q++    E M      + S +H I  L+ S E+ +  ++        +  A+++
Sbjct: 80  GALDVTQTYYPRLEDMFGTVGSSTSISHQIETLQASFETLATQVNTPAFQSATVQTAKDM 139

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
              FN    ++Q +R +AD+ +      +   LS++  +N  I    A   D  D  D+R
Sbjct: 140 TDKFNEMTSQMQNLRLEADRALHDTTGLINNQLSDIFDLNQKIVRNNAIGGDIGDLQDKR 199

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP---RDINFEKMNSYTVTSESNP 251
           D  L  +S+ + I    R +  M VYT  G TL +  P     +     +S+   +  N 
Sbjct: 200 DTALTALSKYMDIQYFERGDGAMGVYTKSGKTLVDKGPAVMSHVATTITDSWMTAAGGN- 258

Query: 252 IFIDGVVVSSNQG----SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              + + +S++      + +  G+++ALL IRD++VP  Q Q+DE+A  L
Sbjct: 259 --FNKLTLSTSDAPDINADINDGEVRALLDIRDTIVPNLQAQIDEVASKL 306



 Score = 43.1 bits (100), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%)

Query: 402 EYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
           E+A  SI  +  + + S D       +   + + Y++T GVNL EE++ +I  +Q+Y+ S
Sbjct: 780 EHAAASIAQVSTDAAHSKDRQDYQTTLGQALDKQYASTSGVNLDEEVANMINFQQAYSAS 839

Query: 462 NKLIMFTDKMLQTLLEGVK 480
            K+I    +ML  L+  VK
Sbjct: 840 AKVISTLQEMLDVLVNIVK 858


>gi|126463724|ref|YP_001044838.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105388|gb|ABN78066.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 481

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 113/506 (22%), Positives = 193/506 (38%), Gaps = 55/506 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENV-TVVT 54
           MS+    + A +  N  S+   +   N+ NA  + + RR+   T        + V TV  
Sbjct: 1   MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSYGGGGQGVRTVGI 60

Query: 55  QRSENKNMF-DKVLHAHSSAIGQQRLLQSF-EALKEMMSADDHYNNSPTHYISKLRDSLE 112
            R  N  +  D+ L    +A G +    +F +AL +     D    S    IS    SL 
Sbjct: 61  DRMMNMALVADRRLA--DAATGDRDTRAAFYQALADATG--DTGGGSLLARISAFSASLV 116

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + +         + V+D A+ +      ++  V + R  AD  I  +I  L   L+ +  
Sbjct: 117 TAASRPESQARLQDVLDRAQSLAAGLRAASDAVLEARRAADASIADQIKTLTATLARVQQ 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I     +  D+    D+R  L+  IS I+ +  + R N  + ++T+ G  L +   
Sbjct: 177 MNATITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLDGRV 236

Query: 233 RDINFEK-----MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIF 286
            DI FE        S     +   + ++G+ +  +  G  +  G + A   +RD + P  
Sbjct: 237 ADIAFEPEPGLVAASSVAAGDLGLLTVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAE 296

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----P 342
           Q +LD +A+ LIG  +  D   G  +   GLF  DG    D     G++  + VN    P
Sbjct: 297 QARLDALAQDLIGRMAAADGSLGAGD--AGLFTDDGAA-FDPAAPAGLASRLSVNALADP 353

Query: 343 QYRSNPSFLRDG---------GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
                   LRDG         G  +          A  P    H  +  +  F F  +A 
Sbjct: 354 DRGGALWHLRDGLQRPSEGDSGDPTLLNALAAALDARTP----HAANGLSGTFSFSGLAA 409

Query: 394 --INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFL 451
             ++     L  A     +    R +   L +                 GV+   E+  L
Sbjct: 410 ETVSGAAVALVSAEAEASFASARRDELQALILAD---------------GVDTDREMEQL 454

Query: 452 IKVEQSYNISNKLIMFTDKMLQTLLE 477
           + +E++Y  + K++   D +LQ LLE
Sbjct: 455 LLLERAYAANAKVVTACDDLLQYLLE 480


>gi|39933725|ref|NP_946001.1| flagellar hook-associated protein 1 FlgK [Rhodopseudomonas
           palustris CGA009]
 gi|39647572|emb|CAE26092.1| possible flagellar hook-associated protein 1 (HAP1, FlgK protein)
           [Rhodopseudomonas palustris CGA009]
          Length = 587

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 103/199 (51%), Gaps = 13/199 (6%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           ++ L  +L S +   +   L   V+D  + V      ++  +QK+R++AD++I   + ++
Sbjct: 115 LASLESALSSLASTPTSSALQSNVVDALDGVTSQLRETSSGIQKLRSNADQDIASAVGSV 174

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              + ++  +N AIK   A+     D  D+R+  LQ +S  + +S    +N D+ VYT+ 
Sbjct: 175 NDDVQKIADLNAAIKQAAAAGQSTADLEDKRNTALQDLSSQMNVSYYTASNGDLQVYTAT 234

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESN-------PIFIDGVVVSSNQGSAVPKGKIKALL 276
           G  L ++    +++    S  V++ +N        I ++GV V+S     +  GKI AL+
Sbjct: 235 GQALVDSTAHPLSYTTTAS--VSAATNYGSGGFSGIMLNGVDVTSQ----ITSGKIGALV 288

Query: 277 QIRDSVVPIFQNQLDEMAR 295
            +RD  +P  Q+QLDE+A+
Sbjct: 289 ALRDQTLPAAQSQLDELAQ 307


>gi|121535557|ref|ZP_01667365.1| flagellar hook-associated protein FlgK [Thermosinus carboxydivorans
           Nor1]
 gi|121305885|gb|EAX46819.1| flagellar hook-associated protein FlgK [Thermosinus carboxydivorans
           Nor1]
          Length = 494

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 108/500 (21%), Positives = 214/500 (42%), Gaps = 79/500 (15%)

Query: 23  SIVRNIENADNKNYVRR-DTMTTISPENV------------TVVTQRSENKNMF-DKVLH 68
           ++  NI NA+ + Y R+  ++ +  PE +              V   +  ++ F D+   
Sbjct: 24  TVGHNISNANTEGYSRQLASIVSTRPETLYGEYGPMQLGTGAAVEAVTRARDSFIDRQFW 83

Query: 69  AHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY-----ISKLRDSLESYSKNLSEDIL 123
             +S++G        E   E++S  +     P+ Y     ++    + ++ S N S+D  
Sbjct: 84  QENSSLGYG------ETATEILSKIEGVFREPSEYGLQTVLNNFWQAWQTLSTNASDDGA 137

Query: 124 GKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF-KTA 182
              +     E+V     +A++++ + AD +  +E++++ + +  SE+  +N  I   +T 
Sbjct: 138 RAALQQRGVELVNAIGHAAQQLKDMVADINSVVEIKVNKVNQITSEILSLNKQIALIETG 197

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGIST--------IVRNNNDMVVYTSDGTT-----LFE 229
            +  A+D  D+RD+L+ ++S ++G++         IVR  N ++V   DG T     +  
Sbjct: 198 GRDHANDLRDRRDLLVDQLSTLVGVTVTEDKYGNYIVRTGNVLLV---DGNTRNELGVVS 254

Query: 230 TVPRDINFEKMN-SYTVTSESNPIFIDGVVVSSNQGSAV--P---KGKIKALLQIRDSV- 282
               D  +E  N  Y  T  S   F+ G       G+AV  P   KG+IK LL +RD+  
Sbjct: 255 QKDSDYGYEVYNVVYGGTVPSGSRFMQG-------GTAVVFPEGNKGEIKGLLAMRDATG 307

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP 342
           V  + ++L  M++  +  F        NS +  G  +AD     D  +  G S       
Sbjct: 308 VKGYLDKLATMSQFFLTDF--------NSLHRDGYGLADTATGNDFFVTGGASPA----- 354

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT----NV 398
              +   +L+   + +   + +   +A   D+        +   + + +  + +    N 
Sbjct: 355 ---TKAEYLQ---AFTSSTIVDTALIAARSDVAMGVASGDHAVALSNLLKTVTSPTLDNA 408

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
           TL  Y    IG L     D+  L    + + + I     +  GVN+ EE++ +I+ +Q Y
Sbjct: 409 TLDSYYNAFIGKLGVQSQDAKRLAENQKTLVSQIRNWRESVAGVNMDEEMTNMIRYQQGY 468

Query: 459 NISNKLIMFTDKMLQTLLEG 478
           N + +++   D+ML  L+ G
Sbjct: 469 NAAARVVTAIDEMLDKLING 488


>gi|254464939|ref|ZP_05078350.1| flagellar hook-associated protein FlgK [Rhodobacterales bacterium
           Y4I]
 gi|206685847|gb|EDZ46329.1| flagellar hook-associated protein FlgK [Rhodobacterales bacterium
           Y4I]
          Length = 482

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 111/500 (22%), Positives = 209/500 (41%), Gaps = 44/500 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MS+ +  N A    + A +    +  N+ NA    Y RR  +   SP       +  + +
Sbjct: 1   MSIYSALNSAMTGLSAAGRSSQVVAENLANALTPGYTRR-VLDLNSPGAGVPGVRIGDVQ 59

Query: 61  NMFDKVLHAHSSAIGQQRLLQS-----------FEALKEMM-SADDHYNNSPTHYISKLR 108
            + D VL      I  +R+ ++           F  + +++ + DD    S    +S   
Sbjct: 60  RLNDPVL------ISNRRVAEAEYGAAKAEGDFFSRISDLVGTVDDEM--SLASQLSDFE 111

Query: 109 DSL-ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
            SL E+ S+  S+  L    +  A  +  + + +A  ++ +R +AD  I  ++  + + L
Sbjct: 112 SSLIEAVSRPDSQPRLNDLSV-KANALADSISRTAEGLRGLRINADSAIGSQVDTVNQAL 170

Query: 168 SELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            E+  +N  I    A   DA    DQRD L+ +++ II ++ + R++  + +Y++ G  L
Sbjct: 171 KEIEKLNARIMVVEAGGMDAVSMQDQRDQLIDQVNAIIPVNVVRRDSGQVTLYSTGGVML 230

Query: 228 FETVPRDINFEK----MNSYTVTSES-NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
            +    +++F      M   T+ +   + + ++G  + +     +  G + A  QIRD  
Sbjct: 231 LDHKASELSFAPSRDIMPHMTLGNGMISGLQVNGKTIGTGPDGPLRGGTLTAQFQIRDVT 290

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENV--PGLFIADGIKDLDNKLCQGISETICV 340
               Q  LD MA  LI  F  +DP    +  V   G+F  DG    D     G+S  I +
Sbjct: 291 AVEAQEDLDAMAADLIERF--QDPSLDATIGVTDAGIFTDDG-SFYDPANIVGLSNRIEL 347

Query: 341 NPQY---RSNPSF-LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
           N      R+  ++  RDG               G   L+  Y D+ N       V     
Sbjct: 348 NDLLALDRAGETWRFRDG------LYAAAPGDPGDSSLLQAYSDALNTTRTVSSVGLGTA 401

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T    + N +    ++   +      +   FN +S++    +GV+   EL  L+ VE+
Sbjct: 402 NMTAATLSANLLSRFAQDNETAARASTFAATSFNELSQA-ELALGVDTDAELQNLMLVEK 460

Query: 457 SYNISNKLIMFTDKMLQTLL 476
            Y  + +++   D++++TLL
Sbjct: 461 YYAANARMLSVVDELMETLL 480


>gi|296534169|ref|ZP_06896661.1| flagellar hook-associated protein FlgK [Roseomonas cervicalis ATCC
           49957]
 gi|296265505|gb|EFH11638.1| flagellar hook-associated protein FlgK [Roseomonas cervicalis ATCC
           49957]
          Length = 500

 Score = 77.8 bits (190), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 100/522 (19%), Positives = 202/522 (38%), Gaps = 64/522 (12%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV------T 54
           MSL +    A +     ++Q     +NI NAD   Y R+    T+S E VT         
Sbjct: 1   MSLSSALLTATSGLRLTTRQLEQSAQNIANADTAGYTRK----TVSGEAVTTGGVRTGEA 56

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           QR+ +  + ++ L A S+  G      +   L  +   D          IS L D+  + 
Sbjct: 57  QRAVDTALRNQALKARSAEAGASLANATLSPLAGLQG-DTSDGRDTAGLISALNDAFTAL 115

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + + ++      V+  AE++    NT++  +   R      +  ++      + ++  ++
Sbjct: 116 AASPADSSAMSGVLRAAEDIASQLNTASEAIGTTRQAVQDGLVADVDAANGLIRQIGALD 175

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL---FETV 231
             I+ + A+  DA    DQRD  + ++S+ +G+ +    +  + +  + G+ L    E+ 
Sbjct: 176 KQIRAEAAAGRDAAALKDQRDTAIGQLSDYLGVKSTEGADGGVTLTLASGSVLPLDAESG 235

Query: 232 PRDINFEKMNSYTVTSESNPIF-IDGVVVSSNQ--GSAVPKGKIKALLQIRDSVVPIFQN 288
           P  +  E+      +    P   + G+ ++     G+A+  G++ A   +RD  +P  Q 
Sbjct: 236 P--LGLERATVTPGSYHGTPAGTLPGLTLNGQAVNGAAL-GGRLGAGFTLRDQTLPTMQA 292

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ------------GISE 336
           +LD+ A  L G   E+           GL +     D D                 G + 
Sbjct: 293 ELDQTAATLAGRLDEQ-----------GLRL---FTDSDGSAPPAAGTAAGAAQTVGFAA 338

Query: 337 TICVNPQYRSNPSFLRDGGSVSKKFLWN-VKNLAGYPDLINHYCD-SFNKNFIFD----- 389
            + VN      P  LRDG   +  F  N     +G+  L++     SF            
Sbjct: 339 RMTVNAAVAEAPRLLRDGTHATADFTPNPAGGPSGFTTLLSRVSQYSFGAEKAAGVPHTA 398

Query: 390 -PVAGINTNVTL----------LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSN 438
            P +G+    TL          ++YA + +G      + +      +    +++      
Sbjct: 399 IPTSGLGPGGTLSSNFAAPQRIIDYAASVVGSQAGTIAAAESAAEGATTQRSYLDGLVQK 458

Query: 439 TVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           + GV+   EL+ ++ ++ +Y+ + +++     M   LL+ V+
Sbjct: 459 SEGVDTDAELANMVALQNAYSANARVMSAVQSMWDALLDAVR 500


>gi|84502375|ref|ZP_01000511.1| flagellar hook-associated protein [Oceanicola batsensis HTCC2597]
 gi|84389187|gb|EAQ01984.1| flagellar hook-associated protein [Oceanicola batsensis HTCC2597]
          Length = 470

 Score = 77.8 bits (190), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 116/493 (23%), Positives = 207/493 (41%), Gaps = 43/493 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD-TMTTISPENVTVVTQRSEN 59
           MS+L     +++     SQ+   +  NI +A ++NY  R   +T      V V+      
Sbjct: 1   MSILTAILASRSGLQANSQRAQLVSTNIAHAQDENYSHRSLEVTEALGGGVRVIGVARAM 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
               D +     S   +Q  + +   +      +     S  + +S  ++ L   S +  
Sbjct: 61  DTAMDALYRTEMSFAAKQDAMATTLGVYGAELGELDTETSIPNLLSAFQNDLGLLSNDPG 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +  L + V  +A+ +     ++   +  +   A   I  +IS     L EL  +N  I  
Sbjct: 121 DASLQQEVYLSAKALTGAIRSANSALNTVETTAVNGIGNDISAANEALRELARINADIG- 179

Query: 180 KTASKHDAHDFL-DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN-- 236
           KT    + +  L D+R   L K++ I+ I      +    V+ + G +L   V   +N  
Sbjct: 180 KTEQGTETYAALEDRRAAELDKLANIVQIQVSYDTDGRANVHAAGGQSLV--VAGHVNEF 237

Query: 237 -FEKMNS--YTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            F++     Y+   +  P       V+  +G+   +G +   + + + VVP  + +LDE+
Sbjct: 238 SFDRPTGTLYSGDQDVTP------GVAGRRGA--EQGSLSGYVTLLNDVVPQQRLELDEI 289

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPS 349
           AR LI  F + D      +   GLF   G+  L + +  G++  I VN    P    + S
Sbjct: 290 ARGLIQGFEDADTSLAPGQ--AGLFTNGGMA-LGSPVTPGLAGRIAVNDAIDPFRGGDLS 346

Query: 350 FLRDG-GSVSKKFLW-NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
            LRDG G+V+      N + LA        + D F+    FDP AG     T++++   +
Sbjct: 347 LLRDGIGAVTTGAASDNTQVLA--------FLDFFDTQVAFDPAAGQGATGTIMDFTTGA 398

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYS----NTVGVNLQEELSFLIKVEQSYNISNK 463
           I   +  R D+   ++ S +     SE+Y     N  GVN+  EL  L  +EQSYN +++
Sbjct: 399 ISQQQARRVDAES-NLNSLIAS---SETYRAARLNARGVNIDTELQNLSLIEQSYNANSQ 454

Query: 464 LIMFTDKMLQTLL 476
            +    +M+ TLL
Sbjct: 455 ALRVASEMIDTLL 467


>gi|83312926|ref|YP_423190.1| flagellar hook-associated protein [Magnetospirillum magneticum
           AMB-1]
 gi|82947767|dbj|BAE52631.1| Flagellar hook-associated protein [Magnetospirillum magneticum
           AMB-1]
          Length = 858

 Score = 77.4 bits (189), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 133/300 (44%), Gaps = 43/300 (14%)

Query: 24  IVRNIENADNKNYVRRDTMTTISPENVTV------VTQRSENKNMFDKVLH---AHSSAI 74
           I +N+ N + K YVR+     ++PE+  V      V Q +  +N+ + ++      +S  
Sbjct: 24  ISQNVVNVNTKGYVRKQ----MTPESRVVAGVGAGVQQGALTRNVDEGLMRDIRRQTSTQ 79

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
           G   + Q++    E M      +NS +H I  L+ S E+ +  ++      + +  A ++
Sbjct: 80  GALDVTQTYYPRLEDMFGTVGSSNSISHQIETLQASFETLATQVNTPAFQSSTVQTANDM 139

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
              FN     +Q +R +AD+ +      + + L ++  +N  I    A   D  D  D+R
Sbjct: 140 TDQFNEMTTHMQNLRLEADRALHDTTGQVNKQLEDIFDLNQKIVRNNAIGGDIGDLQDKR 199

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI-----------------NF 237
           D  L  +S+ + I    R +  + V+T  G TL +  P  +                 NF
Sbjct: 200 DNALTTLSKYMDIQYFERGDGSVGVFTKSGKTLVDKGPAVLSHVATTITDSWMTSAGGNF 259

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            K+   T+++  +P          + G  +  G+++ALL +RD++VP  Q Q+DE+A  L
Sbjct: 260 NKL---TLSTTDSP----------DVGEDINDGEVRALLDLRDTIVPNLQAQIDEVASKL 306



 Score = 43.5 bits (101), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%)

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
           T  E+A  SI  +  + + + D       +   ++  +++T GVNL EE++ +I  +Q+Y
Sbjct: 777 TFAEHAAASIAQVSTDAAHAKDRQDYQTTLGQALNSQFASTSGVNLDEEVANMINFQQAY 836

Query: 459 NISNKLIMFTDKMLQTLLEGVK 480
           + S K+I    +ML TL+  VK
Sbjct: 837 SASAKVISTLQEMLDTLVNIVK 858


>gi|83595981|gb|ABC25341.1| flagellar hook associated protein [uncultured marine bacterium
           Ant24C4]
          Length = 478

 Score = 77.4 bits (189), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 108/496 (21%), Positives = 206/496 (41%), Gaps = 38/496 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV--TQRSE 58
           M++ + FN A    + +++    +  N+ N+  + Y RR+   +       V+    R  
Sbjct: 1   MTISSAFNNATGGLSASARMAEVVSSNLSNSLTEGYGRREVNLSSGLLGGVVLDGISRVV 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK---LRDSLESYS 115
           +  +      A +    +QR  Q    L++           P+  + +   L  SL S S
Sbjct: 61  DPGILRDRRTADADVGSKQRGAQVLSQLEQAFGP----VGDPSGVVGRLAALEQSLISAS 116

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
              S D     V    E V    ++    +Q  R DADK I  ++  L   L ++  +N 
Sbjct: 117 SRPSSDQRLNIVFSGLEGVTTALHSDDDAIQIQRQDADKAITADVKTLNSTLLQIEKLNA 176

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            +     S +D     D R   + +++ I+ ++ I R    + +YT  G  L +  P   
Sbjct: 177 DVSRLIGSGNDPSPVFDARQNAIDRLTSIVPLTEINRGRGQVALYTRSGVALIDGAPATF 236

Query: 236 NFEKMNSYTVTSESNPIF--IDGVVVS------SNQGSAVPKGKIKALLQIRDSVVPIFQ 287
            F   ++ T+ +E   +   + GV ++      +N    +  G ++A   +RD  +   Q
Sbjct: 237 GFA--HTGTIVAEMTLVLGALSGVTLNGEPLDLANGYGRMKGGSLEAAFTLRDQTLVGLQ 294

Query: 288 NQLDEMARVLIGSFSEK--DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
             LD++A  L+  F     DP    +   PGLF+ D     D     G+S  I VN    
Sbjct: 295 ANLDKVAADLVKRFERPVTDPTL--TLGDPGLFL-DHNGAFDPLNIDGLSSRITVNTSV- 350

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----GINTNVTLL 401
            +P   R+GG++S +    V   A  P   N     +  + + DP+A    G+  +   +
Sbjct: 351 -DP---REGGALS-RLRHGVNATASGPTGDNSQLQRW-LSALDDPIALSVGGMARSA--I 402

Query: 402 EYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
           E+  + +  + + R ++ +  +  ++      +S   + GV+  +EL  L+++EQSY  +
Sbjct: 403 EHGSDQVATVGRLRLNAEE-SLGFEIARYDSLKSAELSGGVDSDQELQRLLRIEQSYAAN 461

Query: 462 NKLIMFTDKMLQTLLE 477
            ++I   D M+  LL+
Sbjct: 462 ARVIQTLDAMMSRLLD 477


>gi|326402283|ref|YP_004282364.1| flagellar hook-associated protein [Acidiphilium multivorum AIU301]
 gi|325049144|dbj|BAJ79482.1| flagellar hook-associated protein [Acidiphilium multivorum AIU301]
          Length = 485

 Score = 77.0 bits (188), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 105/497 (21%), Positives = 197/497 (39%), Gaps = 75/497 (15%)

Query: 19  QQFASIVRNIENADNKNY-VRRDTMTTISPEN-----VTVVTQRSENKNMFDKVLHAHSS 72
           QQ A + +NI NA+   Y V    +++ +        ++    R  N ++  +V ++ + 
Sbjct: 19  QQLAVVSQNIANANTSGYSVETANLSSATAGGQGSGVISAPATRQVNTSIQTQVNNSIAQ 78

Query: 73  AIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAE 132
              Q  +  +   + ++M      N+ P+  ++ ++   ++   + S  +   TV+  A+
Sbjct: 79  QSYQAVISTTLSGIDQVMGTPGQGNDLPS-LLANVQSGFQTLMTDPSNVVQQNTVVSAAK 137

Query: 133 EVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLD 192
            +    N+ A  +Q     A   I  ++  L   LS +  +N  I           D  +
Sbjct: 138 TLTGQINSIASTLQSASQSAASTITEDLKKLNSTLSTIGSLNAQIVNLAQQNKSTADLAN 197

Query: 193 QRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPI 252
           QRD  +Q I+ + G   + + N  + ++T +G  L       +N     + T T+ S   
Sbjct: 198 QRDAAIQTIASLTGAKALTQTNGSIALFTVNGIQL------PLNGSSPITATTTTNSTSY 251

Query: 253 FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSE 312
            I G  V+         G++    Q+ ++ +P  Q  LD  ++ L   F+     AG S 
Sbjct: 252 SIGGTPVTFG-------GELGGAQQLNNATLPQIQAGLDSFSQALSSRFAG----AGLS- 299

Query: 313 NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD------------------G 354
               LF  D I ++     +G+S  I VNP   SNP+ +RD                  G
Sbjct: 300 ----LFT-DPIGNVPTAATKGLSAVITVNPAVISNPALVRDGNVTVTNASGTPIPPNPAG 354

Query: 355 GSVS-KKFLWNVKNLA---------GYPDLINHYCDSFNKNFIFDPVAG------INTNV 398
           G       + NV N A           P  I  Y D+     +  P +G      I TN 
Sbjct: 355 GPAGYTALIQNVLNSAFGTTTVGGSAQPPAITAYTDA--TGTVSLPYSGSGSLSAIATNF 412

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
           T  E + +S    + +   +    +K+Q          S+T GVN+ +++S L+ ++ +Y
Sbjct: 413 TANEASISSAALTQVSNVGNLVTALKAQA---------SSTSGVNIDQQMSLLVTLQNAY 463

Query: 459 NISNKLIMFTDKMLQTL 475
             + K +    +M Q +
Sbjct: 464 AANAKTVTIAQQMWQAV 480


>gi|148254603|ref|YP_001239188.1| putative flagellar hook-associated protein FlgK [Bradyrhizobium sp.
           BTAi1]
 gi|146406776|gb|ABQ35282.1| putative flagellar hook-associated protein 1 (HAP1, FlgK protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 585

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 87/171 (50%), Gaps = 9/171 (5%)

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
           ++      +++  VQ +RA++DK+I   + ++   L ++  +N  I+   A+     D  
Sbjct: 143 DDFASQLRSTSSGVQSLRANSDKDIASSVKSVNDDLQQIADLNVQIRKMAAAGQSTADLE 202

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE-----KMNSYTVT 246
           DQR+  LQ +S  + +S    +N D+ VYTS G  L ++    +++        +S   +
Sbjct: 203 DQRNSALQDLSSYMNVSYYTASNGDLQVYTSSGRALVDSSAHTLSYTASANVSASSSYSS 262

Query: 247 SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              + I +DGV V+S     +  GKI AL+ +RD  +P  Q QLD++A  L
Sbjct: 263 GGFSGIMVDGVDVTSQ----ITSGKIGALITLRDQTLPATQTQLDQLATEL 309


>gi|316936120|ref|YP_004111102.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           DX-1]
 gi|315603834|gb|ADU46369.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           DX-1]
          Length = 587

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 93/183 (50%), Gaps = 12/183 (6%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           VI   + +   F  ++  +Q +R+DAD+ I+  + ++   L+ +  +N  I+  +AS   
Sbjct: 134 VISALDTLATRFRDTSSGIQDLRSDADQSIDDAVDDVNEQLNLIAGLNAQIRLASASGQA 193

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
             D  DQR+  +Q+I+  + +S  + ++ DM +YT  G  L ++   ++++    + T +
Sbjct: 194 TGDLEDQRNTAVQEIASRMNVSYFISSSGDMQIYTGSGRALLDSTVHELSYTPAATVTSS 253

Query: 247 SES--------NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +          + I +DGV V+      +  G I AL+ +RD+ +P  Q QLD++A  L 
Sbjct: 254 TTYSASSTGGFSGITVDGVDVTGQ----ISSGSIGALIVLRDTTLPAAQAQLDQLATELA 309

Query: 299 GSF 301
            S 
Sbjct: 310 DSL 312


>gi|154252985|ref|YP_001413809.1| flagellar hook-associated protein FlgK [Parvibaculum
           lavamentivorans DS-1]
 gi|154156935|gb|ABS64152.1| flagellar hook-associated protein FlgK [Parvibaculum
           lavamentivorans DS-1]
          Length = 613

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 125/307 (40%), Gaps = 18/307 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR---DTMTTISPENVTVVTQRS 57
           MSL +    A +  N          RNI N     Y R+           E + V  +R 
Sbjct: 1   MSLSSALGAAMSGLNVTQAGIDVTSRNIANVGTAGYTRKVQQQVNALAGGEGIGV--RRE 58

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEA-----LKEMMSADDHYNNSPTHYISKLRDSLE 112
             +   D+ L              + +A     +  M    D  N+S    IS L   L+
Sbjct: 59  AAQRQIDEFLQQQLRTASAGSAFANVKANMLGRVDSMFGTPDS-NSSIAGAISGLATMLQ 117

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             + N   D   +++++ A  +    N  +  VQ++R +A++ I   + +    L  +  
Sbjct: 118 ELAGNPESDAARQSLLNEAGNLAAKLNNMSGTVQEMRLEAERNIAAAVESANALLGTIAD 177

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           VN+ I  + A      D  D+RD+ + ++S ++ +  + R++  + ++TS G  L +  P
Sbjct: 178 VNNQIAQRQAGNLSVGDLQDKRDMAIDELSRLMDVKVVNRDDGTVTIFTSGGQLLLDRTP 237

Query: 233 RDINFEKMNSY--TVTSESNPIFIDGVVVSSNQ-----GSAVPKGKIKALLQIRDSVVPI 285
            ++ F++      T T E+  +    ++  SN        A+  G I   + +RD ++P 
Sbjct: 238 VELRFDERTQMDPTSTRENGGVGTISLISGSNSIDLLAAGAIRSGAIAGFVSLRDDILPK 297

Query: 286 FQNQLDE 292
            Q QLDE
Sbjct: 298 AQAQLDE 304


>gi|86136708|ref|ZP_01055286.1| flagellar hook-associated protein [Roseobacter sp. MED193]
 gi|85826032|gb|EAQ46229.1| flagellar hook-associated protein [Roseobacter sp. MED193]
          Length = 471

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/357 (22%), Positives = 165/357 (46%), Gaps = 27/357 (7%)

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQ 193
           VVQ+   +A  + + R  A+  I+L++  L   L EL  +N  I    A+  +     DQ
Sbjct: 126 VVQSITDAAEGLNQQREAAESSIDLQVDQLNTQLKELEKLNARIIVSQATGANTTAMEDQ 185

Query: 194 RDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV-TSESNPI 252
           RD+L+  +++ I ++ + R+   + +YT  G  L +    +++F+   +     +++N +
Sbjct: 186 RDLLVDAVNQAIPVNVVQRDQGRIALYTVGGVALLDGKAAELSFDVNRTIEPQMTQANGL 245

Query: 253 F----IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK--DP 306
                I+G+ + ++    +  G + A   IRD+V    QN LD MAR L+  F +   D 
Sbjct: 246 LSGLEINGLAMDTSSTGPLRGGTLIAAFDIRDNVTVEAQNDLDAMARDLVERFQDPALDA 305

Query: 307 IAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP----QYRSNPSFLRDG-GSVSKKF 361
             G ++   G+F  DG    D     G+S  + +N       ++    LRDG  + ++  
Sbjct: 306 TIGATD--AGIFT-DGGGAFDPSDTVGLSARLELNDLVAMDGQAETWRLRDGLYAATEGD 362

Query: 362 LWNVKNLAGYPDLI--NHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             +   L  Y + I  N    +     I   +  ++ +V +  +AR+S          ++
Sbjct: 363 PGDASQLIAYSEAISENRTVSTTKLGLISSDLNTLSASV-MSRFARDS--------DSAN 413

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           ++   +   +  ++++    +GV+   EL  ++ +E +Y  + K++   D+M+QTLL
Sbjct: 414 NMLSYAATSYTELAQA-ELALGVDSDAELQNMMLIENAYAANAKMLSAIDEMMQTLL 469


>gi|148259129|ref|YP_001233256.1| flagellar hook-associated protein FlgK [Acidiphilium cryptum JF-5]
 gi|146400810|gb|ABQ29337.1| flagellar hook-associated protein FlgK [Acidiphilium cryptum JF-5]
          Length = 485

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 103/500 (20%), Positives = 192/500 (38%), Gaps = 81/500 (16%)

Query: 19  QQFASIVRNIENADNKNY---VRRDTMTTISPENVTVVTQ---RSENKNMFDKVLHAHSS 72
           QQ A + +NI NA+   Y       +  T   +   V++    R  N ++  +V ++ + 
Sbjct: 19  QQLAVVSQNIANANTSGYSVETANLSAATAGGQGSGVISAPATRQVNTSIQTQVNNSIAQ 78

Query: 73  AIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAE 132
              Q  +  +   + ++M      N+ P+  ++ ++   ++   + S  +   TV+  A+
Sbjct: 79  QSYQAVISTTLSGIDQVMGTPGQGNDLPS-LLANVQSGFQTLMTDPSNVVQQNTVVSAAK 137

Query: 133 EVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLD 192
            +    N+ A  +Q     A   I  +I  L   L  +  +N  I           D  +
Sbjct: 138 TLTGQINSIASTLQSAGQSAASTITADIKKLNSTLGTIGSLNAQIVNLAQQNKSTADLAN 197

Query: 193 QRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT--TLFETVP-RDINFEKMNSYTVTSES 249
           QRD  +Q I+ + G   + + N  + ++T +G    L  + P          SY++    
Sbjct: 198 QRDAAIQTIASLTGAKALTQTNGSIALFTVNGIQFPLNGSSPITATTTTNNTSYSI--GG 255

Query: 250 NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAG 309
            P+   G              ++    Q+ ++ +P  Q  LD  ++ L   F+     AG
Sbjct: 256 TPVTFGG--------------ELGGAQQLINATLPQIQAGLDSFSQALSSRFAG----AG 297

Query: 310 NSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD---------------- 353
            S     LF  D I ++     +G+S  I VNP   SNP+ +RD                
Sbjct: 298 LS-----LFT-DPIGNVPTAATKGLSAVITVNPAVISNPALVRDGNVTVTNASGTPIPPN 351

Query: 354 --GGSVS-KKFLWNVKNLA---------GYPDLINHYCDSFNKNFIFDPVAG------IN 395
             GG       + NV N A           P  I  Y D+     +  P +G      I 
Sbjct: 352 PAGGPAGYTALIQNVLNSAFGTTTVGGSAQPPAITAYTDA--TGTVSLPYSGSGSLSAIA 409

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           TN T  E + +S    + +   +    +K+Q          S+T GVN+ +++S L+ ++
Sbjct: 410 TNFTANEASISSAALTQVSNVGNLVTALKAQA---------SSTSGVNIDQQMSLLVTLQ 460

Query: 456 QSYNISNKLIMFTDKMLQTL 475
            +Y  + K +    +M Q +
Sbjct: 461 NAYAANAKTVTIAQQMWQAV 480


>gi|299131803|ref|ZP_07024998.1| flagellar hook-associated protein FlgK [Afipia sp. 1NLS2]
 gi|298591940|gb|EFI52140.1| flagellar hook-associated protein FlgK [Afipia sp. 1NLS2]
          Length = 610

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 136/307 (44%), Gaps = 20/307 (6%)

Query: 17  ASQQFASIVR-NIENADNKNYVRR-----DTMTTISPENVTVV-TQRSENKNMFDKVLHA 69
           A+Q   S+V  N+ N +   YVR+      T T      V+V    R  +  +  +VL  
Sbjct: 6   ANQAALSLVSSNVANIETPGYVRKTVNQVQTTTGTGSAGVSVTGVNRELDVYVQKQVLTE 65

Query: 70  HSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVID 129
            S A     L  + + L+ +   D   + +     ++L  +L++ S +        T ++
Sbjct: 66  TSGASYASTLSAALQRLQGIY-GDPSSDTTLEAAFNQLTAALQALSTSSDSPAARSTAVN 124

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
            A+ + Q  N+++  +Q +RADA+  I+  +      + ++  +N+ +   T     A  
Sbjct: 125 AAQSLAQMLNSTSAGIQSLRADAESSIKSSVDAANNAMQQIATINNQLLGTTGDDAAAAS 184

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT--VTS 247
            LDQRD  + ++S+++ I  +  + N + V+T+ G  L  +    I F+   + T   T 
Sbjct: 185 LLDQRDQYITQLSQLMDIRVLTNDRNQVTVFTNSGVQLVGSEAAKITFDAQGTVTPNTTW 244

Query: 248 ESNP----------IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            S+P           F  G  +     +++  G I A LQ+RD  +   Q Q+D++A  +
Sbjct: 245 NSDPSKSTLGTLTLTFPHGGDIDLIATNSIRSGSIAANLQLRDQTLVQAQAQIDQLAASM 304

Query: 298 IGSFSEK 304
             + S+K
Sbjct: 305 ASALSDK 311


>gi|146278770|ref|YP_001168929.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145557011|gb|ABP71624.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 476

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 113/257 (43%), Gaps = 20/257 (7%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+D A+ +V   N ++  V   R  AD  I  ++  L   L  +  +N  I     +  D
Sbjct: 131 VLDTAQALVSGLNAASDAVLTARRGADASIADQVDQLNAGLESVRDLNLRITRLRVTGRD 190

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
           +    D+R  ++  ++ I+ +  I R N  + ++T+ G  L +    +I F         
Sbjct: 191 SSALEDERQRVVDSMATIVPLREIERENGQIALFTTGGAALLDGRVAEIGFTPTPGLVSA 250

Query: 247 SES-NPIFIDG--VVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           S S   + +DG  + V  + G  +  G + A   +RD++ P  Q +LD +AR LI  F+ 
Sbjct: 251 SSSLGSLTMDGRPISVPGDPG-LMAGGSLSAAFAVRDTLAPNEQQRLDALARDLIERFTA 309

Query: 304 KDP--IAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDG--- 354
            D    AG++    GLF  +G+   D     G++  I VN    P+      +LRDG   
Sbjct: 310 ADSSLSAGDA----GLFTDEGLA-FDAANASGLAGRISVNGKVDPERGGALRYLRDGLQS 364

Query: 355 --GSVSKKFLWNVKNLA 369
             GS     L+N  + A
Sbjct: 365 AAGSTGDGTLFNAMSAA 381


>gi|296134284|ref|YP_003641531.1| flagellar hook-associated protein FlgK [Thermincola sp. JR]
 gi|296032862|gb|ADG83630.1| flagellar hook-associated protein FlgK [Thermincola potens JR]
          Length = 479

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 148/366 (40%), Gaps = 68/366 (18%)

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQ 193
           V + FN    ++  +  D D  I++++  +     ++  +ND I        +A+D  D+
Sbjct: 151 VAETFNHLDGQLTDLAEDLDASIKIKVDEINNIAGQIDALNDQIVRIEVQGDNANDLRDK 210

Query: 194 RDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDINFEKMNSYTV 245
           RD+LL ++S+I+ I T+  +N+  V  +  G  L           VP   N    N Y  
Sbjct: 211 RDLLLDELSKIVQI-TVKEDNSGSVTVSIGGRALVSVAGVSKISAVPNGAN----NGYVD 265

Query: 246 TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKD 305
              +    +DG  VS      V  G IK +L +RD+ +P ++ QLD++A  L+ S     
Sbjct: 266 LQWA----VDGTAVS------VQSGSIKGMLDMRDTTIPSYRQQLDDLANALVTSL---- 311

Query: 306 PIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG------SVSK 359
               N+ +V G  +        NK   GI              +F    G      S+  
Sbjct: 312 ----NAVHVAGYGL--------NKTANGI--------------NFFDAAGTTAATISIDA 345

Query: 360 KFLWNVKNLAGY---------PDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
             L ++ N+A           P + N    S   N        +    T+ +Y R  +  
Sbjct: 346 AILGDLDNIAAASTAADPLASPSVENSGDGSNALNIAELKHQALLGTATIDDYYRGMVAQ 405

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           L     +S  +     ++ + +        GV+L EE++ +IK + +YN + + I   D+
Sbjct: 406 LGVEAQESSRMVENQNLLLSQLENRRQEVSGVSLDEEMTNMIKFQHAYNAAARTITAMDE 465

Query: 471 MLQTLL 476
           ML T++
Sbjct: 466 MLDTIV 471


>gi|77464882|ref|YP_354386.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           2.4.1]
 gi|77389300|gb|ABA80485.1| putative flagellar hook protein [Rhodobacter sphaeroides 2.4.1]
          Length = 481

 Score = 73.9 bits (180), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 109/512 (21%), Positives = 196/512 (38%), Gaps = 67/512 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENV-TVVT 54
           MS+    + A +  N  S+   +   N+ NA  + + RR+   T        + V TV  
Sbjct: 1   MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSYGGGGQGVRTVGI 60

Query: 55  QRSENKNMF-DKVLHAHSSAIGQQRLLQSF-EALKEMMSADDHYNNSPTHYISKLRDSLE 112
            R  N  +  D+ L    +A G +    +F +AL +     D    S    IS    SL 
Sbjct: 61  DRMVNMALVADRRLA--DAATGDRDTRAAFYQALADATG--DTGGGSLLARISAFSASLV 116

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + +         + V+D A+ +      ++  V + R  AD  I  +I  L   L+ +  
Sbjct: 117 TAASRPESQARLQDVLDKAQSLAAGLRAASDAVLEARRAADASIADQIKTLTATLARVQQ 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I     +  D+    D+R  L+  IS I+ +  + R N  + ++T+ G  L +   
Sbjct: 177 MNATITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLDGRV 236

Query: 233 RDINFEK-----MNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIF 286
            DI FE        S     +   + ++G+ +  +  G  +  G + A   +RD + P  
Sbjct: 237 ADIAFEPEPGLVAASSVAAGDLGLLKVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAE 296

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
           Q +LD +A+ LIG  +  D   G  +   G+F  D     D     G++  + VN    +
Sbjct: 297 QARLDALAQDLIGRMAAADASLGAGD--AGIFTDDSAA-FDPAAPAGLAGRLSVNAL--A 351

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPD-------------------LINHYCDSFNKNFI 387
           +P     GG+     LW++++    P                       H  +  +  F 
Sbjct: 352 DPDR---GGA-----LWHLRDGLQRPSEGDSGDPTLLNALAAALDARTAHAANGLSGTFS 403

Query: 388 FDPVAG--INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQ 445
           F  +A   ++     L  A     +    R +   L +                 GV+  
Sbjct: 404 FSGLAAETVSGAAVALVSAEAEASFASARRDELQALILAD---------------GVDTD 448

Query: 446 EELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
            E+  L+ +E++Y  + K++   D +LQ LLE
Sbjct: 449 REMEQLLLLERAYAANAKVVTACDDLLQYLLE 480


>gi|85859203|ref|YP_461405.1| flagellar hook-associated protein 1 [Syntrophus aciditrophicus SB]
 gi|85722294|gb|ABC77237.1| flagellar hook-associated protein 1 [Syntrophus aciditrophicus SB]
          Length = 463

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/353 (19%), Positives = 155/353 (43%), Gaps = 31/353 (8%)

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            +I +AE +  + N     ++ +R DA+  I+  +  +   +S +  VN  I+   + + 
Sbjct: 136 ALISSAESLCASINDYGNALESVREDAENNIQETVVEINNLISSIADVNRKIREAGSEQG 195

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV 245
           +++   D+RD  L+++   I  +  + ++  + V+  +G  L E   ++ +++ +   + 
Sbjct: 196 NSNILQDKRDEYLKELCSTINANYFIDSSGALNVFLPNGEPLVE---KEFSWQ-LRLSSE 251

Query: 246 TSESNPIF--IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           TSE+NP +  I  V  S +    +  GKI ALL +RD +V  +Q+ LD  A  L+     
Sbjct: 252 TSETNPPYHHITKVGSSDSLDEVITGGKIGALLDVRDMIVKNYQDNLDSFAAGLV----- 306

Query: 304 KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLW 363
                                 ++++  QG  +   +   +    +       V+ +   
Sbjct: 307 --------------------TQINDQHHQGYDQYKNIGSDFFDPTATDSKSMRVNSELAA 346

Query: 364 NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHM 423
           ++K +A    ++    ++   + + D  A +N   T   Y  + IG + ++ +D+     
Sbjct: 347 DLKKIAASSSILGDGANAVQISALKDNEAAMNGIFTFNNYVASLIGKIGQDVADAKTNVE 406

Query: 424 KSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
              +V + +        GV++ EE+  LI+ +  YN + +L    ++ML TL+
Sbjct: 407 HQNIVMSQLDRQREGISGVSIDEEMMKLIQYQMGYNAAGRLCSIINEMLDTLI 459


>gi|83589598|ref|YP_429607.1| flagellar hook-associated protein FlgK [Moorella thermoacetica ATCC
           39073]
 gi|83572512|gb|ABC19064.1| Flagellar hook-associated protein [Moorella thermoacetica ATCC
           39073]
          Length = 486

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 107/507 (21%), Positives = 211/507 (41%), Gaps = 66/507 (13%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQR---------- 56
           FN A        +   +   NI NA+ + Y R+  + T +P        R          
Sbjct: 8   FNTALRGMQAQQRGIYTTSHNIANANTEGYTRQQVVLTATPAYPVPAMNRPGGQGWQIGT 67

Query: 57  ----SENKNMFDKVLHAH----SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
                E + + D+ L       + ++GQ + +Q      E++  ++  +   +  +S+  
Sbjct: 68  GVDSQETRRLRDEFLDTQIRRETGSLGQWQQIQDVLQQVEVVF-NEPSDTGLSTLMSQFW 126

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
            + +  SKN     +  TV++ A  + + F  SA ++ +I+ D D+ IEL++  +     
Sbjct: 127 AAWQELSKNAESSPVRTTVVETANALAEAFRHSAAQLNQIKDDIDQSIELKVKEVNSLAQ 186

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           ++  +N  IK   A+    +D +DQRD+LL ++S+II  S       +MV    +     
Sbjct: 187 QIADLNGQIKNIVAAGDQPNDLMDQRDLLLDRLSKIIDFSV----EKNMVTVNDE----- 237

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVS----SNQG---------SAVPK-GKIKA 274
           E     I  +  + Y V  +     I  +V +    +N+G           VP  G+IK 
Sbjct: 238 EIADGQIKIKLGDQYLVNVDGTDGSIVNMVAAGTDDANKGKIFWEDSGDEIVPANGEIKG 297

Query: 275 LLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPG--LFIADGIKDLDNKLCQ 332
           L + R+ V     N L+ +A  L  + +E+  +  +     G   F+   I D  + +  
Sbjct: 298 LQKAREDVQTYLTN-LNTLAGELAAAINEQHILGKDLTGASGEDFFV---IGDDSDTIT- 352

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA 392
             +  I VNPQ  ++         VSK  +    N  G  D  N    +  ++ + + + 
Sbjct: 353 --AANIQVNPQIMAD---------VSK--IAAAANDGGPGDGSNALAIAQLQHKLIENL- 398

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
               N T  +Y +N    L  +  ++  +     V+ + ++    +  GV+L EE++ ++
Sbjct: 399 ---DNTTFDDYYKNFTAKLGVDAHEATRMTTNQGVLVDQLTNRKESISGVSLDEEMANML 455

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +  ++Y  S ++I   D ML  ++ G+
Sbjct: 456 QYLRAYEASARMITTLDSMLDKIINGM 482


>gi|163850384|ref|YP_001638427.1| flagellar hook-associated protein FlgK [Methylobacterium extorquens
           PA1]
 gi|163661989|gb|ABY29356.1| flagellar hook-associated protein FlgK [Methylobacterium extorquens
           PA1]
          Length = 632

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 134/311 (43%), Gaps = 36/311 (11%)

Query: 20  QFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAH--SSAIGQQ 77
           Q   + +NI N     YVRR    T++P     +T  S N  +    +     ++A+ Q 
Sbjct: 19  QIGVVSQNIANVGTAGYVRR----TLAP-----ITSGSGNAGVATGTVARALDAAALKQL 69

Query: 78  RLLQSFEALKEMMSAD----DHYNNSPTHYISKLRD-------SLESYSKNLSEDILGKT 126
           R   S  A   +MS      D     P    S L         SL++ + N +      T
Sbjct: 70  RAESSGAAYTSLMSKTRTQLDTLYGRPGDA-SALDGVFNNFTLSLQTLAANPTSTAARAT 128

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+  A ++     ++A  VQ +R+  + ++  +       L++L  +N  I    +    
Sbjct: 129 VLSAANDLATRIGSAANGVQALRSGLESQLATDTEKASGLLAQLAKLNTRIVATASGDAS 188

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTV 245
             +  DQRD  L  +S +I I+ + +++  + V TS G TL + +    + F+   + + 
Sbjct: 189 RPELEDQRDQALTSLSGLIDINAVPQSDGSVSVLTSSGVTLLDRSNAASLRFDARGTLSA 248

Query: 246 TS--ESNPIFID-GVVVSSNQG---------SAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            +   S+P     G +V+S  G          A+  G I A +++RD+V+P  Q QLD++
Sbjct: 249 NALYASDPSQSGVGTIVASTPGGGKIDLLGSGAIRSGSIAAAIELRDTVLPQAQRQLDDL 308

Query: 294 ARVLIGSFSEK 304
           A  L  + S++
Sbjct: 309 AAGLSRAMSDR 319


>gi|254559638|ref|YP_003066733.1| flagellar hook-associated protein 1 FlgK [Methylobacterium
           extorquens DM4]
 gi|254266916|emb|CAX22715.1| putative flagellar hook-associated protein 1 FlgK [Methylobacterium
           extorquens DM4]
          Length = 632

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 134/311 (43%), Gaps = 36/311 (11%)

Query: 20  QFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAH--SSAIGQQ 77
           Q   + +NI N     YVRR    T++P     +T  S N  +    +     ++A+ Q 
Sbjct: 19  QIGVVSQNIANVGTAGYVRR----TLAP-----ITSGSGNAGVATGTVARALDAAALKQL 69

Query: 78  RLLQSFEALKEMMSAD----DHYNNSPTHYISKLRD-------SLESYSKNLSEDILGKT 126
           R   S  A   +MS      D     P    S L         SL++ + N +      T
Sbjct: 70  RAESSGAAYTSLMSKTRTQLDTLYGRPGDA-SALDGVFNNFTLSLQTLAANPTSTAARAT 128

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+  A ++     ++A  VQ +R+  + ++  +       L++L  +N  I    +    
Sbjct: 129 VLSAANDLAARIGSAANGVQALRSGLESQLATDTEKASGLLAQLAKLNTRIVATASGDAS 188

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTV 245
             +  DQRD  L  +S +I I+ + +++  + V TS G TL + +    + F+   + + 
Sbjct: 189 RPELEDQRDQALTSLSGLIDINAVPQSDGSVSVLTSSGVTLLDRSNAASLRFDARGTLSA 248

Query: 246 TS--ESNPIFID-GVVVSSNQG---------SAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            +   S+P     G +V+S  G          A+  G I A +++RD+V+P  Q QLD++
Sbjct: 249 NALYASDPSQSGVGTIVASTPGGGKIDLLGSGAIRSGSIAAAIELRDTVLPQAQRQLDDL 308

Query: 294 ARVLIGSFSEK 304
           A  L  + S++
Sbjct: 309 AAGLSRAMSDR 319


>gi|304407695|ref|ZP_07389346.1| flagellar hook-associated protein FlgK [Paenibacillus
           curdlanolyticus YK9]
 gi|304343178|gb|EFM09021.1| flagellar hook-associated protein FlgK [Paenibacillus
           curdlanolyticus YK9]
          Length = 508

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 100/423 (23%), Positives = 186/423 (43%), Gaps = 70/423 (16%)

Query: 98  NSPTHYISKLRDSLESYSKNLS------EDILGKTVI-DNAEEVVQNFNTSAREVQKIRA 150
           N P+   S +R  ++++ K+ +      E I G+ ++ +NA  +V  FN +++ +  + A
Sbjct: 110 NEPSD--SGIRTVMDNFWKSWTDLSKDPESITGRKIVRENALALVDAFNETSKHLTDLDA 167

Query: 151 DADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI 210
           D    I  +   +      ++ +N  IK   A   + +D +D+RD L+ ++S++I +S  
Sbjct: 168 DLTTNIATKTEQINSIAKSVSDLNLEIKRLEAYGDNPNDLMDERDYLVDQLSKMINVS-- 225

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
                  VV T+DG  +  +V   +  + +N+   T       +  +    N G  V  G
Sbjct: 226 -------VVNTADGYDV--SVGNIMLVDGLNAPGTT-------VQALETQFNSGGVV-GG 268

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLI-GSFSEKDPIAGNSENVPGLFIAD------GI 323
           +I+ LL  RD ++  +++QLD MA  L+ G  +   P AG++ N   L  AD      GI
Sbjct: 269 EIQGLLVSRDQILKDYESQLDAMADTLVNGEITITIP-AGSTYNGSQL-AADLTTTVRGI 326

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGS---------VSKKFLWNVKNLA----- 369
             L N         +  NP  +++  F+   G+         +S+  + +  N+A     
Sbjct: 327 NGLHNLGY------LFTNPPTQADDIFVTSDGTPTITAANIRLSQDIIDDPMNIATSLRT 380

Query: 370 -----------GYPDLINHYCDSFNKNFIFDPVAGIN--TNVTLLEYARNSIGWLEKNRS 416
                      G   L N      +  F F PVA  N  TN T+ E+  + IG L     
Sbjct: 381 AVTNGVNETVKGNNVLANLMAGLKDTKFQFSPVASQNGITNGTIDEFYASMIGQLGLQSQ 440

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +++      Q +   +     +  GV+L EE+S LIK + +Y+ + + +   D+ L  ++
Sbjct: 441 EANRQATNQQDIVTQVDSRRQSVSGVSLDEEMSELIKYQHAYSAAARFMTTIDETLDKVI 500

Query: 477 EGV 479
            G+
Sbjct: 501 NGM 503


>gi|218528944|ref|YP_002419760.1| flagellar hook-associated protein FlgK [Methylobacterium
           chloromethanicum CM4]
 gi|218521247|gb|ACK81832.1| flagellar hook-associated protein FlgK [Methylobacterium
           chloromethanicum CM4]
          Length = 632

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 134/311 (43%), Gaps = 36/311 (11%)

Query: 20  QFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAH--SSAIGQQ 77
           Q   + +NI N     YVRR    T++P     +T  S N  +    +     ++A+ Q 
Sbjct: 19  QIGVVSQNIANVGTAGYVRR----TLAP-----ITSGSGNAGVATGTVARALDAAALKQL 69

Query: 78  RLLQSFEALKEMMSAD----DHYNNSPTHYISKLRD-------SLESYSKNLSEDILGKT 126
           R   S  A   +MS      D     P    S L         SL++ + N +      T
Sbjct: 70  RAESSGAAYTSLMSKTRTQLDTLYGRPGDA-SALDGVFNNFTLSLQTLAANPTSTAARAT 128

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+  A ++     ++A  VQ +R+  + ++  +       L++L  +N  I    +    
Sbjct: 129 VLSAANDLATRIGSAANGVQALRSGLESQLATDTEKASGLLAQLAKLNTRIVATASGDAS 188

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTV 245
             +  DQRD  L  +S +I I+ + +++  + V TS G TL + +    + F+   + + 
Sbjct: 189 RPELEDQRDQALTSLSGLIDINAVPQSDGSVSVLTSSGVTLLDRSNAASLRFDARGTLSA 248

Query: 246 TS--ESNPIFID-GVVVSSNQG---------SAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            +   S+P     G +V+S  G          A+  G I A +++RD+V+P  Q QLD++
Sbjct: 249 NALYASDPSQSGVGTIVASTPGGGKIDLLGSGAIRSGSIAAAIELRDTVLPQAQRQLDDL 308

Query: 294 ARVLIGSFSEK 304
           A  L  + S++
Sbjct: 309 AAGLSRAMSDR 319


>gi|188580158|ref|YP_001923603.1| flagellar hook-associated protein FlgK [Methylobacterium populi
           BJ001]
 gi|179343656|gb|ACB79068.1| flagellar hook-associated protein FlgK [Methylobacterium populi
           BJ001]
          Length = 632

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/381 (22%), Positives = 154/381 (40%), Gaps = 68/381 (17%)

Query: 20  QFASIVRNIENADNKNYVRRDTMTTISP-----ENVTVVTQ--------------RSENK 60
           Q   + +NI N     YVRR    T+SP      N  V T               RSE  
Sbjct: 19  QIGVVSQNIANVGTAGYVRR----TLSPVAAGVGNAGVATGTIGRALDAAALKQLRSETS 74

Query: 61  NMFDKVLHAHSSAIGQQRL-LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                   A++  + Q R  L +        SA D   NS T        SL++ + N +
Sbjct: 75  G------AAYTGLMAQTRTQLDTLYGRPGDSSALDGVFNSFTL-------SLQTLAANPT 121

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                 TV+ +A ++     ++A  VQ +R+  + ++  +       L++L  +N  I  
Sbjct: 122 STAARATVLSSASDLATRIGSAANGVQALRSGLESQLAADTDQASNLLAQLAKLNTRIVA 181

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFE 238
            +A      D  DQRD  L  +S +I I+ + +++  + V T  G TL + +    ++F+
Sbjct: 182 TSADDPSRPDLEDQRDQALTSLSGLIDINAVTQSDGSVSVLTGSGVTLLDRSNAASLSFD 241

Query: 239 KMNSYTVTSESNPIFID-------GVVVSSNQG---------SAVPKGKIKALLQIRDSV 282
              + +    +N ++ +       G +V++  G          A+  G I A +++RD+V
Sbjct: 242 ARGTLS----ANALYSNDPSQSGVGTIVATTPGGGKIDLLASGAIRSGSIAAAVELRDTV 297

Query: 283 VPIFQNQLDEMA---------RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG 333
           +P  Q QLD++A         RV  G+        G   ++ GL   + I  L  +   G
Sbjct: 298 LPQAQRQLDDLAAGLSRAMSDRVATGTVPTDGTKGGFDIDLTGLSAGNAIT-LTVQDGSG 356

Query: 334 ISETICVNPQYRSNPSFLRDG 354
               + + P Y++ P  +  G
Sbjct: 357 TQRNLILLPSYQTPPPAIPAG 377


>gi|172061965|ref|YP_001809617.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           MC40-6]
 gi|171994482|gb|ACB65401.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           MC40-6]
          Length = 665

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 128/279 (45%), Gaps = 26/279 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS----KLRDSLESYSK 116
            + D++  A S    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQLNSAQS----QGGALSTWYSLVAQL---NNYVGSPTAGISTAITGYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I NA+ +      + ++   +R   + ++   +S +  + S++  +N  
Sbjct: 124 NASDPSVRQTAISNAQVLADQLKAAGQQYDALRQSVNTQLTSTVSQINTYTSQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 IAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNDSGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           ++     TVTS S+P  +   VVS     A P G  +AL
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGPNQAL 273


>gi|115353111|ref|YP_774950.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           AMMD]
 gi|115283099|gb|ABI88616.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           AMMD]
          Length = 665

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 128/279 (45%), Gaps = 26/279 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS----KLRDSLESYSK 116
            + D++  A S    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQLNSAQS----QGGALSTWYSLVAQL---NNYVGSPTAGISTAITGYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I NA+ +      + ++   +R   + ++   +S +  + S++  +N  
Sbjct: 124 NASDPSVRQTAISNAQVLADQLKAAGQQYDALRQSVNTQLTSTVSQINTYTSQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 IAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNDSGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           ++     TVTS S+P  +   VVS     A P G  +AL
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGPNQAL 273


>gi|144899352|emb|CAM76216.1| Flagellar hook-associated protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 939

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/320 (21%), Positives = 142/320 (44%), Gaps = 36/320 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M+L    N A +      +   ++ +N+ N + K YVR+            V+ Q S   
Sbjct: 1   MALTLGLNTALSGLLTNQRALDTVAQNVTNVNTKGYVRK------------VMNQESRVL 48

Query: 61  NMFD-----------------KVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
           N F                  K +   ++ +G+ ++  S+    + +  +   N+S +H 
Sbjct: 49  NGFGAGVQVGSVTRQINEGLLKDIRKQTAELGKLQVESSYYPRIDDLFGNVADNSSISHK 108

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           ++ L ++ E     + +  +  + +   ++V   F+    ++Q +R +AD+EIE  +  +
Sbjct: 109 LNDLYEAFELLGTQVDKPSIQWSSVQTGQDVADLFDRMTDQLQSLRLEADREIETTVQLI 168

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              LS++  +N  I   +A      D  D+RD  L  +++ I +    R +  M+VYT+ 
Sbjct: 169 NDKLSDIHDLNQKIVKNSAVATGTTDLEDKRDQALTDLAQYIDVQYYHRQDGSMIVYTNS 228

Query: 224 GTTLFETVPRDINF---EKMNSYTVTSES--NPIFIDGVVVSSNQGSAVPKGKIKALLQI 278
           G  L +   + +++    +++++   +    N I +DG   + +    V  GK++ALL +
Sbjct: 229 GEMLVDNQDQPLSYTANTRIDTWMTAAGGQFNKISVDG--GTDDLAPLVKGGKLRALLDM 286

Query: 279 RDSVVPIFQNQLDEMARVLI 298
           RD  V   Q  LDE A+ ++
Sbjct: 287 RDKTVTDLQASLDEAAQTML 306



 Score = 37.7 bits (86), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTV--GVNLQEELSFLIKV 454
           N +L EY   +I  + ++   S    ++ Q   +  S  + NT   GVNL EE+S +I  
Sbjct: 856 NYSLSEYGAATISLVTRDAEHSSK-QLEYQTALSQ-SLDFQNTSFSGVNLDEEVSAMIDF 913

Query: 455 EQSYNISNKLIMFTDKMLQTL 475
           +Q+Y+ + K+I    +ML+TL
Sbjct: 914 QQAYSATAKVITVLQEMLETL 934


>gi|209967001|ref|YP_002299916.1| flagellar hook-associated protein FlgK, putative [Rhodospirillum
           centenum SW]
 gi|209960467|gb|ACJ01104.1| flagellar hook-associated protein FlgK, putative [Rhodospirillum
           centenum SW]
          Length = 526

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 113/536 (21%), Positives = 227/536 (42%), Gaps = 74/536 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR---DTMTTISPENVTVVT--- 54
           MSL    + A +         A++ +N  N     Y R+         +P    V T   
Sbjct: 1   MSLSVAISSAISGLRATQNNIATVSQNTSNIQTPGYTRKFVTQEAQVHTPTTGGVRTGQV 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           QR+ ++ ++ ++L   S A   + +  +  +++++  + +    S +  ++ LRD     
Sbjct: 61  QRTFDQALYRELLQRESQAAHLETVSTTLSSIEKLQGSPES-QTSISARLADLRDDFIGL 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           +       L   V+++A+    + NT A  +   R++    I   I  +   L+++  ++
Sbjct: 120 AAKPESVELQADVVNSAQIFAASMNTVANAIIDKRSETQDAIVNTIDTVNGLLTDIAQLD 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I     ++    D  D+RD+ ++ +++++ +  + R +  M++ T  G TL + VP  
Sbjct: 180 RQIFQTQGTQQGTADLQDRRDLKIRDLAKLVDVVALERADGTMLLMTRGGATLLDRVP-- 237

Query: 235 INFEKMNSYTVTSES--NPIFIDGVVV----SSNQGSAVPK----GKIKALLQIRDSVVP 284
            N+   +   + + S  +P    G+        N G  + +    G++  LL++RD ++P
Sbjct: 238 -NYLSTSPSRIAASSYYDPSGAGGIAPIRLGDPNTGVDITQDLRGGQLGGLLELRDDILP 296

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFI---ADGIK---DLDNK-------LC 331
             Q +LDE+A ++   F  K       +  PGL +    DG+    D+          L 
Sbjct: 297 RMQAELDELAHMVAVRFKGK---TAPDDGAPGLTLFTDTDGVSIPGDVSGSVDYAPPILY 353

Query: 332 QGISETICVNPQYRSNPSFLR--DGGSV----------------SKKFLWN-VKNLAGYP 372
            G +  I V      N   +R  DGG+                 S  FL N V ++ G  
Sbjct: 354 VGFASRIRVGQAVMENAELVRYGDGGAPKVPPASGSSPPDPIAGSTIFLKNVVDHVFGTT 413

Query: 373 DLINHYCDSFN-KNFIFDP----VAGINTNVTLLEYARNSI-------GWLEKNRSDSHD 420
            L      +FN +    +P     + I  NV+L+++A++ +       GW +   +++  
Sbjct: 414 TLGGSNHIAFNTQGLGANPRRNLTSSIPANVSLIDFAQSVLVKQSSEAGWAKARATEAT- 472

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
             MK ++ F      YS+  GVNL EE+  L  +++SY  S+++I   ++M  +L 
Sbjct: 473 -AMKEELDFR-----YSDKTGVNLDEEVVMLTVLQRSYAASSRVITTVEQMYDSLF 522


>gi|126738558|ref|ZP_01754263.1| flagellar hook-associated protein K [Roseobacter sp. SK209-2-6]
 gi|126720357|gb|EBA17063.1| flagellar hook-associated protein K [Roseobacter sp. SK209-2-6]
          Length = 484

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 166/366 (45%), Gaps = 36/366 (9%)

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDF 190
           A+ VV+    +A  +  +R +A+  I  ++  L   L E+  +N  I    A+       
Sbjct: 133 ADLVVKTITHAADGLNALRVEAETSINSQVRTLNNSLKEIEKLNARIVVSEAAGTSTTAM 192

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT--VTSE 248
            DQRD L+ ++++II ++ + R+   + +Y+  G  L +    +I F+ + +    +T +
Sbjct: 193 QDQRDKLIDEVNKIIPVNVLSRSQGRVALYSEGGVALIDGRASEITFDALQTIEPHMTLD 252

Query: 249 S---NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK- 304
           +   N + ++G ++ ++    +  G + A   IRDS     QN LD +A+ L+  F +  
Sbjct: 253 NGLLNGLEVNGKLIDTSADGPLRGGTLAAQFDIRDSAAVEAQNDLDALAQDLVERFQDPA 312

Query: 305 -DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLW 363
            D   G ++   G+F  D     DN +    + T+ ++ +   N S    G + + +F  
Sbjct: 313 LDATLGATD--AGIFT-DAGGFFDNTVP---ANTVGLSARLELNSSVSLSGAAETWRFRD 366

Query: 364 NVKNLA----GYPDLINHYCDSF--NKNFIFDPVAGINTNVTLL------EYARNSIGWL 411
            +   +    G   L+  Y D     ++     +  I  ++  L       +AR+     
Sbjct: 367 GINAASQGDPGNASLLTAYSDRLAETRSVSTTKLGAITGSLNTLSASVMSRFARD----- 421

Query: 412 EKNRSDSHDLHMK-SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
               SD+ +  M  +   F+ +S++    +GV+   EL  L+ +E++Y  + K++   D+
Sbjct: 422 ----SDTANSTMSFAAASFSEMSKAKL-ALGVDSDAELQNLMIIERAYAANAKMLEAVDE 476

Query: 471 MLQTLL 476
           M+QTLL
Sbjct: 477 MMQTLL 482


>gi|254470337|ref|ZP_05083741.1| flagellar hook-associated protein, putative [Pseudovibrio sp.
           JE062]
 gi|211960648|gb|EEA95844.1| flagellar hook-associated protein, putative [Pseudovibrio sp.
           JE062]
          Length = 519

 Score = 71.2 bits (173), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 105/203 (51%), Gaps = 14/203 (6%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L S + + S     +  ++ AEE+ ++ NTSA++VQ++R DAD  I  ++S +   L E
Sbjct: 21  ALTSLATDPSSQSAQEVAVNAAEELSRSINTSAKQVQEMRRDADAAIADDVSEVNSILKE 80

Query: 170 LTVVNDAIKF-KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +  + D+I   ++A +  AH   DQ D  L+ ++E + +     N+  + + T  GTTL+
Sbjct: 81  IESLEDSIVLERSAGRETAH-LQDQMDRQLEALTEKMDVEIKQDNDGLLRISTKSGTTLY 139

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA-------VPKGKIKALLQIRDS 281
                ++ F    +  V    NPI      V S  G+        +  G I AL+++RD 
Sbjct: 140 NDRASELQFTPQPTLGVGVVGNPIE-----VKSQSGAVMELTSFDLKSGSIGALVELRDD 194

Query: 282 VVPIFQNQLDEMARVLIGSFSEK 304
           V+P  Q++LDE+A  +  S S++
Sbjct: 195 VLPETQSRLDELASQMALSLSQQ 217


>gi|160901877|ref|YP_001567458.1| flagellar hook-associated protein FlgK [Petrotoga mobilis SJ95]
 gi|160359521|gb|ABX31135.1| flagellar hook-associated protein FlgK [Petrotoga mobilis SJ95]
          Length = 818

 Score = 71.2 bits (173), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 134/296 (45%), Gaps = 35/296 (11%)

Query: 24  IVRNIENADNKNYVRRD-TMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQS 82
           +  NI N++ + + R+   + T +P N+T +       +         S+    QR+   
Sbjct: 27  VAHNISNSNTQGFSRQSPVIVTTNPINLTTIGSGGAALS-----FGTGSTVSDIQRVRDE 81

Query: 83  FEAL--KEMMSADDHYNN--SPTHYISKL---------RDSLESYSKNLSE-------DI 122
           F  L  +E  S  +++ N  S  HYI +L         R+  +SY  ++ E       + 
Sbjct: 82  FLDLQFRETSSRLNYWENIYSNVHYIEQLFGEPGETGLRNMYDSYWASIEELKTDPSNEA 141

Query: 123 LGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA 182
               V+  AEE+V         +++++ D + EI+L I  +  +L  +  +N  I   ++
Sbjct: 142 AKTQVVSRAEELVNTMKDLNYRLEELKNDINSEIKLRIDEINGYLKRIADLNQKILTSSS 201

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
                +D LD+RD LL K+SE+  I     +N  + +   D   L  +     +++++ S
Sbjct: 202 MSGSPNDLLDERDRLLDKLSELSNIRITSHSNGQISLSMGDKVVLNGS-----SYQEIRS 256

Query: 243 YTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            T+ +E+N  +     V SN       GK+ AL ++RD ++P +Q QLDE    L+
Sbjct: 257 LTI-AETNDAYY--AYVGSNL-LTFNDGKMSALFELRDEIIPSYQQQLDEFGLYLV 308



 Score = 37.0 bits (84), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 76/164 (46%), Gaps = 25/164 (15%)

Query: 320 ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYC 379
           AD +K +DN+L  GI   I V+   + NPS L                  GY D IN+  
Sbjct: 667 ADLLK-IDNEL--GIVNQISVSSNLKENPSLLATD--------------LGYYD-INYSP 708

Query: 380 DSFNKNFIFDPVAGI-------NTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
                  ++D ++ +       N  V    +  N +  +      +  + + S+++ + I
Sbjct: 709 TGAGNVSVWDEISKMYDNSVLDNGRVGFSNFLGNIVTDIGVKGETADKMRLNSEMLNSEI 768

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           S      +GV++ EE++ L+K +Q++N S ++I   ++M++T++
Sbjct: 769 SLEKERVMGVSIDEEMTNLVKYQQAFNASARVITAVNQMMETVI 812


>gi|171322357|ref|ZP_02911181.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           MEX-5]
 gi|171092319|gb|EDT37688.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           MEX-5]
          Length = 665

 Score = 70.9 bits (172), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 128/279 (45%), Gaps = 26/279 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS----KLRDSLESYSK 116
            + D++  A S    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQLNSAQS----QGGALSTWYSLVAQL---NNYVGSPTAGISTAITGYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I NA+ +      + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 124 NASDPSVRQTAISNAQVLADQLKAAGQQYDALRQSVNTQLTSTVSQINTYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 ITAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNDSGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           ++     TVTS S+P  +   VVS     A P G  +AL
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGPNQAL 273


>gi|240137460|ref|YP_002961931.1| putative flagellar hook-associated protein 1 FlgK [Methylobacterium
           extorquens AM1]
 gi|240007428|gb|ACS38654.1| putative flagellar hook-associated protein 1 FlgK [Methylobacterium
           extorquens AM1]
          Length = 632

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 134/315 (42%), Gaps = 44/315 (13%)

Query: 20  QFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAH--SSAIGQQ 77
           Q   + +NI N     YVRR    T++P     +T  S N  +    +     ++A+ Q 
Sbjct: 19  QIGVVSQNIANVGTAGYVRR----TLAP-----ITSGSGNAGVATGTVARALDAAALKQL 69

Query: 78  RLLQSFEALKEMMSAD----DHYNNSPTHYISKLRD-------SLESYSKNLSEDILGKT 126
           R   S  A   +MS      D     P    S L         SL++ + N +      T
Sbjct: 70  RAESSGAAYTSLMSKTRTQLDTLYGRPGDA-SALDGVFNNFTLSLQTLAANPTSTAARAT 128

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+  A ++     ++A  VQ +R+  + ++  +       L++L  +N  I    +    
Sbjct: 129 VLSAANDLATRIGSAANGVQALRSGLESQLATDTEKASGLLAQLAKLNTRIVATASGDAS 188

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTV 245
             +  DQRD  L  +S +I I+ + +++  + V TS G TL + +    + F+   + + 
Sbjct: 189 RPELEDQRDQALTSLSGLIDINAVPQSDGSVSVLTSSGVTLLDRSNAASLRFDARGTLS- 247

Query: 246 TSESNPIFID-------GVVVSSNQG---------SAVPKGKIKALLQIRDSVVPIFQNQ 289
              +N ++         G +V+S  G          A+  G I A +++RD+++P  Q Q
Sbjct: 248 ---ANALYATDPSQSGVGTIVASTPGGGKIDLLGSGAIRSGSIAAAIELRDTMLPQAQRQ 304

Query: 290 LDEMARVLIGSFSEK 304
           LD++A  L  + S++
Sbjct: 305 LDDLAAGLSRAMSDR 319


>gi|90422997|ref|YP_531367.1| flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
 gi|90105011|gb|ABD87048.1| Flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
          Length = 626

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 136/308 (44%), Gaps = 35/308 (11%)

Query: 24  IVRNIENADNKNYVRR--DTMTTISPENVTVVTQRSENKNMFDKV---LHAHSSAIGQQR 78
           +  N+ NA+   Y+R+  D +TT +    + V     N+ +   V   L   +S  G   
Sbjct: 24  VSSNVANAETPGYIRKSVDQVTTNTGSMGSGVNINGVNRELDSFVQTQLRTETSGAGYAS 83

Query: 79  L----LQSFEAL----KEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDN 130
           L    LQ  + L        + +D +N + T  +  L  S +S S  +        VI+ 
Sbjct: 84  LKSDFLQQLQGLYGNPDSSGTLEDAFN-ALTTAVQALGTSPDSQSARIG-------VINA 135

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF----KTASKHD 186
           A+ +    N  +  +Q +R  A+  I+  +SN    + ++  +N+ ++      T++   
Sbjct: 136 AQTIAGQLNAMSNGIQTLRGAAETGIKDAVSNANTLMKQIADINNKLQTNPLGGTSTDSS 195

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
               LDQRD  + ++S+++ I       N + V+T  G  L       ++F    + T  
Sbjct: 196 TAALLDQRDRYITQLSQLMDIRVTTNGANQVTVFTGAGVQLVGNEAATLSFNAQGTVTPA 255

Query: 247 S----ESNPIFIDGVVVS-SNQGS-----AVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
           +    +++   +  V VS SN GS     ++  G+I A +++RD ++   QNQLD+ A  
Sbjct: 256 TTWNADASKSSLGSVTVSYSNGGSINLTSSIKSGEIAAYIEVRDKIMVEAQNQLDQFAAT 315

Query: 297 LIGSFSEK 304
           L  S S+K
Sbjct: 316 LSSSLSDK 323



 Score = 39.7 bits (91), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 35/51 (68%)

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           VV N + + +S+  GVN+ EE++ L+ ++ +Y+ + +++   ++M QTL++
Sbjct: 574 VVLNTLQKKFSDVSGVNMDEEMAHLLSLQNAYSANARVMSTVNQMYQTLMQ 624


>gi|90422393|ref|YP_530763.1| flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
 gi|90104407|gb|ABD86444.1| Flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
          Length = 588

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 133/299 (44%), Gaps = 21/299 (7%)

Query: 20  QFASIVRNIENADNKNYVRRDT----MTTISPENVTVVTQ-RSENKNMFDKVLHAHSSAI 74
           Q +    NI NAD   Y  +      +        TV+T   S    +  K L    SA+
Sbjct: 20  QISVTSSNISNADTTGYTVKTANQAAVVNAGTGAGTVITGITSTVDKLLMKSLIQADSAL 79

Query: 75  GQQRL----LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDN 130
           G        L   +AL    + DD    S  + I+ L  ++ S S   S   L   V+  
Sbjct: 80  GAADTNNDYLDQLQALYGSTADDDSSGTSLANTIAALETAITSLSATSSSAALQANVVSA 139

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDF 190
            +++      ++  +Q +R++AD+EI   + ++   L  +  +N AIK   A+     D 
Sbjct: 140 LDDLATQLRDTSSGIQDLRSNADQEIATAVDDVNEQLQTIANLNAAIKLAAAAGQSTADL 199

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF--------EKMNS 242
            D+R+  +Q I+  + IS  + +  DM VYT+ G  L +T   +++F            S
Sbjct: 200 EDKRNTAVQDIATKMNISYFISSTGDMQVYTASGQALVDTRAHELSFTASSTVTASSSYS 259

Query: 243 YTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
            T +S  + + ++GV V++     +  G+I AL+ +RDS +P  Q QLD++A  L  S 
Sbjct: 260 ATSSSTLSGVTVNGVDVTAQ----ISSGEIGALIALRDSELPAAQAQLDQLATQLADSL 314



 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 56/113 (49%), Gaps = 1/113 (0%)

Query: 369 AGYPDLINHYCDSFNKNFIFDPVAGINTNV-TLLEYARNSIGWLEKNRSDSHDLHMKSQV 427
           AG   ++N    +   +  FD V G+ ++  +  +YA   +  +    S + D +   Q 
Sbjct: 473 AGSATVVNALYSALTDDITFDAVGGLGSSTGSFADYASTIVSAVAAKASTAEDTYTAKQT 532

Query: 428 VFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
             +  + + ++  GVNL EE + L  ++  Y+ +++LI   ++M  +LL+ V+
Sbjct: 533 AQSTFASALASQSGVNLDEETARLSTLQNQYSAASQLIQAINEMFSSLLQAVQ 585


>gi|170703622|ref|ZP_02894363.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           IOP40-10]
 gi|170131468|gb|EDT00055.1| flagellar hook-associated protein FlgK [Burkholderia ambifaria
           IOP40-10]
          Length = 665

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 128/279 (45%), Gaps = 26/279 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS----KLRDSLESYSK 116
            + D++  A S    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQLNSAQS----QGGALSTWYSLVAQL---NNYVGSPTAGISTAITGYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I NA+ +      + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 124 NASDPSVRQTAISNAQVLGDQLKAAGQQYDALRQSVNTQLTSTVSQINTYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 IAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNDSGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           ++     TVTS S+P  +   VVS     A P G  +AL
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGPNQAL 273


>gi|255263716|ref|ZP_05343058.1| flagellar hook-associated protein FlgK [Thalassiobium sp. R2A62]
 gi|255106051|gb|EET48725.1| flagellar hook-associated protein FlgK [Thalassiobium sp. R2A62]
          Length = 479

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/344 (23%), Positives = 151/344 (43%), Gaps = 30/344 (8%)

Query: 145 VQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEI 204
           +Q  R  AD  I   +  L   L+ +  ++D I     S  D    LDQR + +  +S+I
Sbjct: 150 IQTDRERADASIAANVDELNASLALIDKLSDDITTIRISGADISALLDQRQLAIDAVSKI 209

Query: 205 IGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT----VTSESNPIFIDGVVVS 260
           I +  + R+NN + + ++ G TL+++ P   +FEK ++ T    V +    +  +G  V+
Sbjct: 210 IPVQEVSRDNNQIALVSAGGGTLYDSQPAIFSFEKTSTITGELSVINGLGHLKFNGTSVN 269

Query: 261 SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFS--EKDPIAGNSENVPGLF 318
             + +    G ++    +RD      Q +LDE+A  LI  F   + DP   +   +P L 
Sbjct: 270 FLENNPFDGGILEGHFDVRDEFAVQAQTELDEIAASLIDRFQGDDVDPTQTDVLGIPALG 329

Query: 319 I-ADGIKDLDNKLCQGISETICVNP----QYRSNPSFLRDGGSVSKKFLWNVKNLA-GYP 372
           I  DG +   +    G++  I +N              RDG       L++      G P
Sbjct: 330 IFTDGGQAFSSGNEAGVAGRISINELVDVSQDGKSQLFRDG-------LYDEGGSELGDP 382

Query: 373 DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
             I ++  + +   + D      T+V    +++     L   R+ S +      +    +
Sbjct: 383 TQIQNWLGALSTP-LSDSALAEATDV----FSKIGSRRLISERNFSFENARYETLKQAEL 437

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           S+      GV+  +E+  L+ +EQ+Y+ + K+I   D+M+QTLL
Sbjct: 438 SD------GVDTDQEMQNLLLIEQAYSANAKVIQTVDEMMQTLL 475


>gi|107023946|ref|YP_622273.1| flagellar hook-associated protein FlgK [Burkholderia cenocepacia AU
           1054]
 gi|116691033|ref|YP_836656.1| flagellar hook-associated protein FlgK [Burkholderia cenocepacia
           HI2424]
 gi|170734367|ref|YP_001766314.1| flagellar hook-associated protein FlgK [Burkholderia cenocepacia
           MC0-3]
 gi|105894135|gb|ABF77300.1| Flagellar hook-associated protein [Burkholderia cenocepacia AU
           1054]
 gi|116649122|gb|ABK09763.1| flagellar hook-associated protein FlgK [Burkholderia cenocepacia
           HI2424]
 gi|169817609|gb|ACA92192.1| flagellar hook-associated protein FlgK [Burkholderia cenocepacia
           MC0-3]
          Length = 643

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 128/275 (46%), Gaps = 26/275 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS----LESYSK 116
            + D++  A +    Q   L ++ +L   +   ++Y  SPT  IS    S    +++ + 
Sbjct: 71  YLSDQLNGAQT----QGGALSTWYSLVTQL---NNYIGSPTAGISTAITSYFTGMQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           + S+  + +T + NA+ +      + ++   +R   + ++   ++ +  + +++  +N  
Sbjct: 124 SASDSSVRQTAMSNAQTLANQITAAGQQYDALRQSVNTQLTSTVTQINAYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ S GT L   V  D +
Sbjct: 184 IAAASSQGQPPNQLMDQRDLAVSNLSNLAGVQ-VVRNSDGYSVFMSGGTPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK 271
           ++     TVTS S+P  +   VVS     A P+G 
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGATPQGP 269


>gi|92116887|ref|YP_576616.1| flagellar hook-associated protein [Nitrobacter hamburgensis X14]
 gi|91799781|gb|ABE62156.1| Flagellar hook-associated protein [Nitrobacter hamburgensis X14]
          Length = 619

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 106/229 (46%), Gaps = 27/229 (11%)

Query: 93  DDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADA 152
           D    N+  ++ S L+ +L + S N +      +V++ A+ + Q  N +   +Q +R++A
Sbjct: 102 DGTLENALNNFTSALQ-ALSASSGNTAAQ---SSVLNAAQALAQQLNATTSGIQTLRSNA 157

Query: 153 DKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVR 212
           ++++ + +S     ++++  +N  ++  +A    A   +DQRD  + ++S ++ +  +  
Sbjct: 158 EQDLSVSVSQANAAMAQIAQINQKLQGMSAQDPAAATLMDQRDSAVDQLSRLMDVRAVTD 217

Query: 213 NNNDMVVYTSDGTTLFETV-PRDINFEKMNSYTVTSE-----------------SNPIFI 254
             N   V+T+ G  L   V    ++F   +S T  S+                  N   I
Sbjct: 218 GANQTSVFTTSGIQLVGGVQASTLSFNAQSSLTANSQWNADPSKSSVGTIICQLPNGAKI 277

Query: 255 DGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           D +   S     +  G+I A +Q+RD  +   QNQ+D+MA  L  + S+
Sbjct: 278 DMIATQS-----INSGQIAADVQLRDKTLVQAQNQVDQMAATLASALSD 321



 Score = 37.7 bits (86), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 65/160 (40%), Gaps = 31/160 (19%)

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD--- 389
           G++  I VN +  ++PS         K  ++N       P  +    D+   +FIFD   
Sbjct: 473 GLAGRIQVNAKLLADPS---------KLTIYNTS-----P--VTPAGDTTRSDFIFDQLT 516

Query: 390 -------PVAGINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
                  P  G+         TL  + +  +       + +  +     VV N + E ++
Sbjct: 517 SATYTYSPNTGLGAAAAPFKGTLPSFLQQFVSVQSSAATTAKQVAQGQDVVVNTLQEKFN 576

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
              GVN+  E++ LI ++ SY  +  ++     M+QTLL+
Sbjct: 577 AKAGVNIDTEMTNLIALQNSYAANAHVMSVVQSMMQTLLQ 616


>gi|78067830|ref|YP_370599.1| flagellar hook-associated protein FlgK [Burkholderia sp. 383]
 gi|77968575|gb|ABB09955.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 660

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 127/279 (45%), Gaps = 26/279 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +     NI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGNNISNAATPGY-SVQRPVYAEASSQYSGSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS----LESYSK 116
            + D++  A +    Q   L ++  L   +   ++Y  SPT  IS    S    L++ + 
Sbjct: 71  YLSDQLNTAQT----QGGALSTWYTLVAQL---NNYIGSPTAGISTGITSYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I NA+ +    N + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 124 NASDPSVRQTAISNAQTLANQLNAAGQQYDALRQSVNTQLTSTVSQINTYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ +  +S + GI  +VRN++   V+ S G  L   V  D +
Sbjct: 184 IAAASSQGQPPNQLLDQRDLAVSNLSGLTGIQ-VVRNDSGYSVFMSGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           ++      VTS S+P  +   VVS     A P+G  + L
Sbjct: 240 YQLA---AVTSPSDPSEL--TVVSQGIAGAKPQGPNQPL 273


>gi|254251198|ref|ZP_04944516.1| Flagellar hook-associated protein [Burkholderia dolosa AUO158]
 gi|124893807|gb|EAY67687.1| Flagellar hook-associated protein [Burkholderia dolosa AUO158]
          Length = 655

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 128/279 (45%), Gaps = 26/279 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVFAEASGQYTSSGYL----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + D++  A S    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQLNGAQS----QGGALSTWYSLVAQL---NNYIGSPTAGISTAITNYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I N + +    N + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 124 NASDPSVRQTAISNGQILADQLNAAGQQYDALRQSVNTQLTNTVSQINTYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           IK  ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 IKAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNDDGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           ++     TVTS S+P  +   VVS     A P G  + L
Sbjct: 240 YQLA---TVTSSSDPSEL--TVVSQGIAGANPPGPNQTL 273


>gi|149203101|ref|ZP_01880072.1| flagellar hook-associated protein K [Roseovarius sp. TM1035]
 gi|149143647|gb|EDM31683.1| flagellar hook-associated protein K [Roseovarius sp. TM1035]
          Length = 482

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 88/393 (22%), Positives = 161/393 (40%), Gaps = 26/393 (6%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE 157
           NS T  ++ L  +LE+ +    +      V+  A+++    N +A ++ ++R  AD++I 
Sbjct: 100 NSLTGRLATLEVALETAATRPEDTNRLDAVLSAAQDLTAGINDAAADIARLRTAADRDIA 159

Query: 158 LEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDM 217
             +  L   L E+  +N  I    +   D     DQR   +  +S I+ +  + R +  +
Sbjct: 160 TTVQELNAGLQEVAALNVQITTGQSRGTDITALEDQRQRTIDTLSLIVPLRQVPRGDASV 219

Query: 218 VVYTSDGTTLFETVPRDINFEKMNSYTV-----TSESNPIFIDG--VVVSSNQGSAVPKG 270
            + T+ G  L +     + F      T       ++ + I IDG  V + +++G  +  G
Sbjct: 220 ALVTTAGGMLLDGRAVKLTFAATPLVTPHMTHKEAQLSGIAIDGADVPIGADRGP-LQGG 278

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFI-ADGIKDLDNK 329
           ++ ALL IRD       ++LD +AR L+  F      A  +   PGL   A  I +  N 
Sbjct: 279 RLGALLDIRDRAAVEANSKLDALARDLVERFQAPGLDATRAPGAPGLLTDAGAIFEAGNA 338

Query: 330 LCQG--ISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI 387
           L     I+ T  V+P        LRDG   +           G   L+     +  +  +
Sbjct: 339 LGLAGRIAVTRLVDPSQGGALFRLRDGLGATD------GGPPGAGALLGALSHALTQTSV 392

Query: 388 FDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVF--NHISESYSN--TVGVN 443
                      +   +A   I  L + R     +  ++++ F     +E  +     GV+
Sbjct: 393 LPSGLLGGAARSAANHAATLISSLSQER-----VTTEARLSFATGQSAEFRAQELATGVD 447

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
              EL  L+ VEQ++  + ++I   D +L TLL
Sbjct: 448 SDAELQRLLLVEQAFGANARMIQTIDDLLDTLL 480


>gi|85706143|ref|ZP_01037238.1| flagellar hook-associated protein [Roseovarius sp. 217]
 gi|85669307|gb|EAQ24173.1| flagellar hook-associated protein [Roseovarius sp. 217]
          Length = 459

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 93/367 (25%), Positives = 159/367 (43%), Gaps = 28/367 (7%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V+  A+ +  + N +A E+ ++R+ AD++I   +  L   L ++  +N  I       
Sbjct: 104 QAVLREAQALGAHLNDAATEIARLRSAADRDIAETVVALNSGLQQVVALNIQIATNLTRG 163

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK--MNS 242
            D     DQR  ++  ++EI+ +  + R+N  + + T+ G  L +     ++F++  M +
Sbjct: 164 TDTATLEDQRQSVIDSLAEILPLRQVPRDNGAVALVTTAGGLLLDGRAVTLSFDRAPMVA 223

Query: 243 YTVTSESN---PIFIDGVVV--SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             +T E+     I IDG  V   S++G  +  G++ AL  IRD         LD +AR L
Sbjct: 224 AHMTLENGLLSGIAIDGTAVPTGSDRGP-LQGGRLGALFDIRDRTSVDTTADLDAIARDL 282

Query: 298 IGSFSEK--DPIAGNSENVPGLFIADGIKDL-DNKLCQGISETICVNPQYRSNPSFLRDG 354
           +  F +   DP  G  +   GLF   G  DL + +   GI+  I VN     +P  LR G
Sbjct: 283 VERFQQSGLDPTRGAGD--AGLFTDAG--DLFEAQNESGIARRIGVNQAV--DP--LR-G 333

Query: 355 GSVSKKFLWNVKNLAGYPD---LINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
           G + +         AG P    L+     +          A  +   +   +A   I  L
Sbjct: 334 GDLFRIRDGVAAQSAGPPGDGSLLVTLTRALTDTSPLSSGALGSGARSAAGHAATLISGL 393

Query: 412 EKNRSDSHDLH--MKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            + R  +  +      Q       E  +N  GV+   EL  L+ VEQ++  + ++I   D
Sbjct: 394 SQARVAAEQVQSFATGQATEFRTLE-LAN--GVDSDAELQRLLLVEQAFGANARMIQTID 450

Query: 470 KMLQTLL 476
            ML TLL
Sbjct: 451 DMLDTLL 457


>gi|259417223|ref|ZP_05741142.1| flagellar hook-associated protein FlgK [Silicibacter sp. TrichCH4B]
 gi|259346129|gb|EEW57943.1| flagellar hook-associated protein FlgK [Silicibacter sp. TrichCH4B]
          Length = 482

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 149/362 (41%), Gaps = 30/362 (8%)

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDF 190
           A E+  +   +A  V  +R  A+  I   +  L+  L  L  +N  I        D    
Sbjct: 133 AGELAMSIRNAAEGVSTLRNKAEDSIGALVEGLQTNLETLNDLNKKILAAEIRGQDPSGL 192

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP-RDINFEKMNSYTV---- 245
            DQRD L+  I+E+I +    R+NN   +YT+ G  L +     + +F++    T     
Sbjct: 193 EDQRDNLINAINEVIPVQVHKRDNNQTALYTNSGIKLIDGGSVAEFSFDETRLVTPYMSI 252

Query: 246 -TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              + + + IDG  + ++    +  G + A   +RD      Q  LD MA  LIG F + 
Sbjct: 253 DNGQLSGLEIDGRSIDTSINGKIGGGSLAAQFHVRDVASVQAQEDLDTMAADLIGRFQDP 312

Query: 305 --DPIAGNSENVPGLFI-ADGIKDLDNKLCQGISETICVNPQYRSNPSF----LRDGGSV 357
             DP  G ++  PG+F  A    D  N L  G +  I +N     + S     LRDG   
Sbjct: 313 AVDPTLGATD--PGIFTDAGAFFDPVNTL--GAANRIELNEVISMSGSAETWRLRDG--- 365

Query: 358 SKKFLWNVKNLAGYPD--LINHYCDSFNK-NFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                 N   +    D  ++N+Y ++    N I  P  G          A     + ++N
Sbjct: 366 -----LNATAIGDRGDTTILNNYAEAMEATNTITSPGLGSGDYSAYAIAANLMTNFTQEN 420

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
                +L   S  +++ I +S     GV+   EL  L+ +E  Y  + +++   D+M+Q 
Sbjct: 421 TWAEQELAYSS-AIYSDI-QSRELEQGVDTDAELQTLMMIETVYGANARMLQAIDEMMQE 478

Query: 475 LL 476
           L+
Sbjct: 479 LM 480


>gi|85715030|ref|ZP_01046015.1| hypothetical protein NB311A_11677 [Nitrobacter sp. Nb-311A]
 gi|85698227|gb|EAQ36099.1| hypothetical protein NB311A_11677 [Nitrobacter sp. Nb-311A]
          Length = 620

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 97/211 (45%), Gaps = 13/211 (6%)

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   +L++ S +        +V++ A+ + Q  N +   +Q +R++A++++ + +S    
Sbjct: 111 RFTSALQALSASSGNPAAQSSVLNAAQALAQQLNATTGGIQTLRSNAEQDLSVSVSQASA 170

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
            + ++  +N  ++  +     A   +DQRD  + ++S ++ I  +    N   V+T+ G 
Sbjct: 171 AMQQIAQLNQRLQSVSVQDPAAATLMDQRDAAIDQLSRLMDIRAVTDGANQTSVFTTSGV 230

Query: 226 TLFETV-PRDINFEKMNSYTVTSESN--PI----------FIDGVVVSSNQGSAVPKGKI 272
            L   V    + F   +S T  S+ N  P             +G  +       +  G+I
Sbjct: 231 QLVGGVYASTLTFNAQSSLTANSQWNADPAKSSVGTIICQLPNGAKIDMIASQGINSGQI 290

Query: 273 KALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
            A +Q+RD ++   QNQ+D+MA  L  + S+
Sbjct: 291 AADVQLRDKILVQAQNQVDQMAATLASALSD 321


>gi|99082780|ref|YP_614934.1| flagellar hook-associated protein FlgK [Ruegeria sp. TM1040]
 gi|99039060|gb|ABF65672.1| Flagellar hook-associated protein 1 (HAP1) [Ruegeria sp. TM1040]
          Length = 482

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 148/362 (40%), Gaps = 30/362 (8%)

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDF 190
           A E+  +   +A  V  +R  A+  I   +  L   L  L  +N  I        D    
Sbjct: 133 AGELAMSIRDAAEGVSSLRNKAEDSIAALVQGLETNLETLNDLNRKILAAEVRGQDPSGL 192

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP-RDINFEKMNSYTV---- 245
            DQRD L+  I+E+I +    R+NN   +YT+ G  L +     + +F++    T     
Sbjct: 193 EDQRDSLIDAINEVIPVQVHKRDNNQTALYTNSGIKLIDGGSVAEFSFDETRLVTPYMTL 252

Query: 246 -TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              + + + IDG  + ++    +  G + A   +RD      Q  LD MA  LI  F + 
Sbjct: 253 GNGQLSGLEIDGKQIDTSINGKIGGGSLAAQFHVRDVASVQAQEDLDTMAADLIQRFQDP 312

Query: 305 --DPIAGNSENVPGLFIADG-IKDLDNKLCQGISETICVNPQYRSNPSF----LRDGGSV 357
             DP  G ++  PG+F   G   D  N L  G++  I +N     + S     LRDG   
Sbjct: 313 AVDPTLGATD--PGIFTDQGAFFDPVNTL--GVANRIELNSIISMSGSAETWRLRDG--- 365

Query: 358 SKKFLWNVKNLA--GYPDLINHYCDSFNK-NFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                 N   +   G   ++N+Y ++    N I  P  G          A     + ++N
Sbjct: 366 -----LNATAIGERGDTTILNNYAEAMEATNTITSPGLGSGDYSAYAIAANLMTNFTQEN 420

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
                +L   S  +F+ I +S     GV+   EL  L+ VE  Y  + ++I   D+M+Q 
Sbjct: 421 TWAEQELAYSS-AIFSDI-QSRELEQGVDTDSELQTLMMVETIYAANARMIQAIDEMMQE 478

Query: 475 LL 476
           L+
Sbjct: 479 LM 480


>gi|316932791|ref|YP_004107773.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           DX-1]
 gi|315600505|gb|ADU43040.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           DX-1]
          Length = 623

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 127/310 (40%), Gaps = 21/310 (6%)

Query: 14  CNNASQQFASIVRNIENADNKNYVRR--DTMTTISPENVTVVTQRSENKNMFDKVL---H 68
            N AS    S   N+ NA+   YVR+  +   T+S +  T V     N+ + D VL    
Sbjct: 16  VNQASMSLVS--SNVANAETPGYVRKTVNQGVTVSGQTGTGVQVNGINRQLDDYVLAQLR 73

Query: 69  AHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVI 128
              S      L   F    + +  D +   +     + L  ++++ + +         V+
Sbjct: 74  TEISGASYASLRSDFLGQLQGLFGDPNSTGTLESSFNGLTTAMQALATSPDSTSARIGVL 133

Query: 129 DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF----KTASK 184
           + A+ +    N  +  +Q +R+  +  +   +      L ++  +N  I+      T++ 
Sbjct: 134 NAAQALAAGLNAMSNGIQTLRSGCEAGLTDAVGTANNLLKQIATINTQIRTNPQGGTSTD 193

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY- 243
                 LDQRD  + ++S+++ I  +    N + V+T  G  L       ++FE   +  
Sbjct: 194 AATAALLDQRDQAINQLSQLMDIRIVTNGANQVSVFTGSGVQLAGMEAATLSFEAQGTVN 253

Query: 244 -TVTSESNPIF--IDGVVVSSNQGSAV------PKGKIKALLQIRDSVVPIFQNQLDEMA 294
              T  SN +   +  V VS   GS +        GK+ A +++RD+ +   Q QLD+ A
Sbjct: 254 PGTTWSSNSMLSELGSVTVSYASGSTIDITSSLKSGKMAAYIELRDNTLVTAQTQLDQFA 313

Query: 295 RVLIGSFSEK 304
             L  S S+K
Sbjct: 314 ATLSSSLSDK 323



 Score = 42.0 bits (97), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 51/103 (49%), Gaps = 5/103 (4%)

Query: 382 FNKNFIFDPVAGINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESY 436
            N  + +    GI ++      +L  Y +  +     N + +  L     VV N + + +
Sbjct: 521 MNSKYYYSAATGIGSDTAPFKGSLQSYLQQFVSQQGSNAAAAKQLSEGQNVVLNTLQQKF 580

Query: 437 SNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           S + GVN+ EE++ L+ ++ +Y  + +++   ++M Q+L++ +
Sbjct: 581 SASSGVNMDEEMAHLLSLQNAYAANARVMSTINQMYQSLMQAI 623


>gi|206558976|ref|YP_002229736.1| flagellar hook-associated protein FlgK [Burkholderia cenocepacia
           J2315]
 gi|198035013|emb|CAR50885.1| flagellar hook-associated protein 1 (HAP1) [Burkholderia
           cenocepacia J2315]
          Length = 643

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 128/275 (46%), Gaps = 26/275 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     M    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYM----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS----LESYSK 116
            + D++  A +    Q   L ++ +L   +   ++Y  SPT  IS    S    +++ + 
Sbjct: 71  YLSDQLNGAQT----QGGALSTWYSLVTQL---NNYIGSPTAGISTAITSYFTGMQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           + S+  + +T + NA+ +      + ++   +R   + ++   ++ +  + +++  +N  
Sbjct: 124 SASDSSVRQTAMSNAQTLANQITAAGQQYDALRQSVNTQLTSTVTQINAYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ S GT L   V  D +
Sbjct: 184 IAAASSQGQPPNQLMDQRDLAVSNLSNLAGVQ-VVRNSDGYSVFMSGGTPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK 271
           ++     TVTS S+P  +   VVS     A P+G 
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGANPQGP 269


>gi|83593864|ref|YP_427616.1| hypothetical protein Rru_A2529 [Rhodospirillum rubrum ATCC 11170]
 gi|83576778|gb|ABC23329.1| Protein of unknown function DUF1078 [Rhodospirillum rubrum ATCC
           11170]
          Length = 452

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 144/361 (39%), Gaps = 47/361 (13%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+   E   ++ NT +  +Q  R  AD+ +  E+  +   L +L  +N       A+ + 
Sbjct: 132 VVATLETWTKSLNTLSSAIQSSRTAADQHVAEEVETINGLLGDLDKLNSEFSKAKAAGNP 191

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
             D  DQ+  LL  ++  + I+       ++ V+T  G +L  +    +  E        
Sbjct: 192 TADIEDQQRTLLTSLATHVDINYYTTATGELNVFTKGGKSLLTSSVHKLAAEPTGILKAG 251

Query: 247 SESNPIFIDG-VVVSSNQGSAVPK---GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFS 302
           +    I +DG  VV       + +   G + ALL +RD+ +P  Q  LD  A  L    +
Sbjct: 252 NPGAKITLDGQTVVDPTVDPPIKELTGGTLGALLTMRDTTLPALQKDLDAFATDLTTIIN 311

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFL 362
                       PGL          +    G SE I V     ++P+ +  G +   K L
Sbjct: 312 TV---------YPGLI---------STTPAGASE-IKV-----ADPTAITSGDTDKMKGL 347

Query: 363 WNVKNLAGYPDLINHYCD---SFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
           W   +    P   +   D     +K  +   V+ I  NV  L  A NS   L    +   
Sbjct: 348 WTALS---EPITFSASTDGTMGASKTTLISRVSAIVDNVADLSTAANSKASLSAKTA--- 401

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                       +S+ + NT GVN++EE + ++  +QS+ +++++I    +M  TL+  +
Sbjct: 402 ----------TALSDKFDNTYGVNVEEETAKMLVFQQSFQMTSQVITTAREMFNTLMSMM 451

Query: 480 K 480
           K
Sbjct: 452 K 452


>gi|295687866|ref|YP_003591559.1| flagellar hook-associated protein FlgK [Caulobacter segnis ATCC
           21756]
 gi|295429769|gb|ADG08941.1| flagellar hook-associated protein FlgK [Caulobacter segnis ATCC
           21756]
          Length = 571

 Score = 67.0 bits (162), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 140/310 (45%), Gaps = 23/310 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQ---RS 57
           MSL ++ + A      A  Q A    N+ NADN +Y R+   TT + + + V T    R+
Sbjct: 1   MSLTSILSSAGAALTTAQYQIAVSQTNVANADNASYSRKTVTTTATTQTLAVSTATVTRA 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRL----LQSFEA-LKEMMSADDHYNNSPTHYISKLRDSLE 112
            +  +  K +   ++A G+  +    LQS++A L  +   DD         +S L  + +
Sbjct: 61  ADAYLA-KTVDKTAAADGRDAVIDTYLQSYDASLGSVDGGDD---------VSSLLTAFQ 110

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAR---EVQKIRADADKEIELEISNLRRFLSE 169
           +   +L+      T            ++      ++Q +R+ A+ EI   +  +   L  
Sbjct: 111 TALSSLASSSTSATKASAVSAASSLASSIQSLSGDIQSLRSQANLEIGETVDTINSTLET 170

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +ND I   TAS  D  D  D+R   +  +S ++G+ST   ++N ++VY   G  L  
Sbjct: 171 IKTLNDQIVSTTASGGDVSDLEDRRAAAVTTLSSLMGVSTYKTSDNRVMVYAPGGEQLLG 230

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQN 288
                +++   +S +  +   P  I GV V+     +++  GK+  L+ +RD V+   Q+
Sbjct: 231 ASVAKLSYNPSSSLSADTV-YPGSISGVTVNGKDITTSLTSGKLGGLISLRDDVLVGEQD 289

Query: 289 QLDEMARVLI 298
            LD++A  LI
Sbjct: 290 ALDQLASTLI 299


>gi|222053739|ref|YP_002536101.1| flagellar hook-associated protein FlgK [Geobacter sp. FRC-32]
 gi|221563028|gb|ACM19000.1| flagellar hook-associated protein FlgK [Geobacter sp. FRC-32]
          Length = 479

 Score = 67.0 bits (162), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 109/488 (22%), Positives = 206/488 (42%), Gaps = 69/488 (14%)

Query: 27  NIENADNKNYVRRDTMTTISPENVT-----------VVTQRSENKNMFDKVLHAHSSA-- 73
           NI N +   Y R+  +    P N+            V  QRS +  +  ++++ +S+   
Sbjct: 27  NIANVNTPGYSRQRVIMESGPANIASGFPIGGGVEVVAVQRSYDNLLQTQLVNGNSTYQQ 86

Query: 74  -IGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILG----KTVI 128
            + +Q  LQ  E L         +N   T  + K  +S     ++LS +  G    + +I
Sbjct: 87  NLAKQTALQQVEPL---------FNEVSTDGLGKAMESFFGSWQDLSLNPQGAPERQALI 137

Query: 129 DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAH 188
             ++ +V  F+     +  +   AD+++    +++   L  + ++N  I        + +
Sbjct: 138 ARSQILVDTFHQMNTNLNAVITSADQDLVSITADVSDKLGNIALLNQQIMTTQGMGGNVN 197

Query: 189 DFLDQRDVLLQKISEIIGISTIVRNNNDMVV-YTSDGTTL-----FETV--PRDINFEKM 240
           +  DQRD+L+Q+++  +GI+T  ++N  + V  T  G TL     + TV    D    + 
Sbjct: 198 EMKDQRDLLVQELAGKVGITTSEQSNGTLTVSLTLGGQTLVSGNQYSTVYTSPDGGTPQR 257

Query: 241 NSYTVTSESNP-----IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
           N   VT   NP        D  V ++  G     G+I   LQ+RD +VP +  +LDE+A 
Sbjct: 258 NDIYVTPLGNPPPANTPATDTDVTATIGGLNNGYGEIGGTLQVRDQIVPGYLAKLDELAS 317

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP---QYRSNPSFLR 352
            +I S + +     +     G+    G    D      +S TI  +P      +NP F+ 
Sbjct: 318 KIITSVNTQHTAGADLAGGAGVAFFTGTSSAD----IAVSGTITSDPTRIAAAANP-FVG 372

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
            G + +   + ++KN +      N     F   F+ +   GI+                 
Sbjct: 373 PGDNRNALLIADIKNSSLAFSTGNSTVADFFNAFVSN--VGIDVQKA------------- 417

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           KN +   +  +K     N + ES +   GV+L EEL+ L+K ++++  + +L+    +M+
Sbjct: 418 KNTAAQGEAFLKQ---LNTLRESNA---GVSLDEELTNLLKYQRAFEGAARLVTTGSEMM 471

Query: 473 QTLLEGVK 480
            T+L  V+
Sbjct: 472 DTILAMVR 479


>gi|209884510|ref|YP_002288367.1| flagellar hook-associated protein FlgK [Oligotropha carboxidovorans
           OM5]
 gi|209872706|gb|ACI92502.1| flagellar hook-associated protein FlgK [Oligotropha carboxidovorans
           OM5]
          Length = 624

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 125/290 (43%), Gaps = 19/290 (6%)

Query: 21  FASIVRNIENADNKNYVRRD----TMTTISPENVTVVTQRSENKNMF--DKVLHAHSSAI 74
            A +  N+ N +   YVR+       TT +  +  +VT  +   N++   +VL   S A 
Sbjct: 21  LALVASNVSNIETPGYVRKSLNQAQTTTGTGSSGVIVTGVNRELNVYVQKQVLTETSGAS 80

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
               +  + + L+ +   D   N +     + L  +L++ S          T ++ A+ +
Sbjct: 81  YATTMSNALQRLQGIY-GDPGSNTTLEAAFNALTAALQALSVTSDSPAARSTAVNAAQSL 139

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
            Q  N+++  +Q +RADA+  I+  +      + ++  +N+ +   T     A   LDQR
Sbjct: 140 AQMLNSTSAGIQSLRADAESAIKSSVDAANNAMRQIATINNQLLGTTGDDAAAASLLDQR 199

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSE--SNP- 251
           D  + ++S+++ I  +    N + V+T+ G  L  +    I+F+   + T  +   S+P 
Sbjct: 200 DQYITQLSQLMDIRVLTNERNQVTVFTNSGVQLVGSEASTISFDAQGTVTPNTAWNSDPS 259

Query: 252 ---------IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                     F  G  +      ++  G I A L++RD  +   Q Q+D+
Sbjct: 260 ISTLGTLTLTFPHGGDIDLIATRSIRSGAIAANLELRDETLVQAQAQIDQ 309


>gi|221215578|ref|ZP_03588541.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           CGD1]
 gi|221164566|gb|EED97049.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           CGD1]
          Length = 698

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 125/275 (45%), Gaps = 26/275 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V TV  QR  ++
Sbjct: 55  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVNTVTVQRQYSQ 109

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + D++  A +    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 110 YLSDQLNTAQT----QSGALSTWYSLVAQL---NNYIGSPTAGISTAITNYFTGLQNVAN 162

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++  + +T I NA+ +      + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 163 NAADPTVRQTAISNAQTLADQITAAGQQYDALRQSVNTQLTSTVSQINTYTAQIAQLNQQ 222

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 223 IAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNSDGYSVFLAGGQPL---VVADKS 278

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK 271
           ++     TVTS S+P  +   VVS     A P G 
Sbjct: 279 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGP 308


>gi|75675293|ref|YP_317714.1| hypothetical protein Nwi_1100 [Nitrobacter winogradskyi Nb-255]
 gi|74420163|gb|ABA04362.1| Protein of unknown function DUF1078 [Nitrobacter winogradskyi
           Nb-255]
          Length = 622

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 97/221 (43%), Gaps = 17/221 (7%)

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   +L++ S +        +V++ A+ +    N +   +Q +R++A++ +   +S    
Sbjct: 111 RFTSALQALSASSGNPAAQSSVLNAAQALAHQLNATTSGIQTLRSNAEQSLSASVSQANA 170

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
            + ++  +N  ++   A    A   +DQRD  + ++S ++ I  +    N   V+T+ G 
Sbjct: 171 AMQQIAQLNQRLQSMGAQDPAAATLMDQRDAAIDQLSGLMDIRAVTDGANQTSVFTTAGV 230

Query: 226 TLFETV-PRDINFEKMNSYTVTSESN--PI----------FIDGVVVSSNQGSAVPKGKI 272
            L   V    + F   +S T +S+ N  P             +G  +       +  G+I
Sbjct: 231 QLVGGVYASTLTFNAQSSLTASSQWNADPAKSSVGTIICQLPNGARIDMIASQGINSGQI 290

Query: 273 KALLQIRDSVVPIFQNQLDEMARVLIGSFSE----KDPIAG 309
            A  Q+RD ++   QNQ+D+MA  L  + S+      P+ G
Sbjct: 291 AADAQLRDKILVQAQNQVDQMAATLASALSDVTTSGAPVTG 331


>gi|293605009|ref|ZP_06687405.1| flagellar hook-associated protein 1 [Achromobacter piechaudii ATCC
           43553]
 gi|292816614|gb|EFF75699.1| flagellar hook-associated protein 1 [Achromobacter piechaudii ATCC
           43553]
          Length = 557

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 139/326 (42%), Gaps = 40/326 (12%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-----------VT 54
           ++  A    N A    A+   NI NA    Y R+  +T+ +    T              
Sbjct: 3   LYKTALGGLNAAQAGLATTSHNINNATTVGYNRQRVLTSTAGAQATANGYIGRGVQVDTI 62

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEM--MSADDHYNNSP--THYISKLRDS 110
           +RS +  ++ +++ A  S     +L   F  + ++  + AD     +P  T + + + ++
Sbjct: 63  ERSYDSFLYKQLVGAQGSGA---QLQTQFAQVSQINNLFADRTVGIAPGLTDFFTSM-NT 118

Query: 111 LESYSKNLSE--DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           + S   + +   D+LGK     A  +     ++  E+Q +R   + +I   +  +  +L 
Sbjct: 119 VASKPADPAARADLLGK-----ANSLTTQIRSAYSEMQNLREGLNTQISTTVEQVNSYLG 173

Query: 169 ELTVVNDAIKFKT--ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD--- 223
            +  +N  I      A+    +D LDQRD  + ++++++GI+T  + N   +  T     
Sbjct: 174 RIDDLNTQISLAAGKANGSPPNDLLDQRDQAVMELNQLVGITTYEQGNKINISLTKGGQS 233

Query: 224 ---GTTLF--ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQI 278
              GTTL+  + VP      K  S TV + + P      V      S V  G +  LLQ 
Sbjct: 234 LLSGTTLYPLQAVPS----SKDASRTVVAYTLPAGSGKTVAVEMPDSDVTGGSLGGLLQF 289

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSEK 304
           R + +   QNQL +MA  L  SF+E+
Sbjct: 290 RATSLDTLQNQLGQMAVGLALSFNEQ 315


>gi|157363535|ref|YP_001470302.1| flagellar hook-associated protein FlgK [Thermotoga lettingae TMO]
 gi|157314139|gb|ABV33238.1| flagellar hook-associated protein FlgK [Thermotoga lettingae TMO]
          Length = 841

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 122/299 (40%), Gaps = 43/299 (14%)

Query: 24  IVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQS 82
           +  NI N+    Y R R  + T SP  +  +TQ S        +L   S     QR+   
Sbjct: 4   VAHNIANSSTDGYSRQRPVIQTTSPIPLATLTQPS-----IPLMLGTGSQVTDVQRVRDL 58

Query: 83  FEALKEMMSA------DDHYNNSPTHYISKL---------RDSLESYSKNLSEDILGKT- 126
           F  ++   ++      D  Y+N   HYI +L         R   +S+     E I   T 
Sbjct: 59  FLDIQYRQTSNRYSYFDTIYSN--LHYIEQLFSEPGDSGIRSLYDSFLSAAEEIITDPTN 116

Query: 127 ------VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
                  I  AEE+V N       +Q++R D ++EI     ++   +  L  +N+ I+  
Sbjct: 117 VAAKREFISRAEELVTNIKDLYTRLQQLREDINQEIYQTTDDINSMVERLAQINEQIRIS 176

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            A     +D LD+RD +L ++S+   IS    ++   ++   D   L  +V  +I     
Sbjct: 177 VAFGTTPNDLLDERDRILDELSQYANISYYETSDGQTILMFGDQVVLSGSVQTEIR---- 232

Query: 241 NSYTVTSESNPIFIDGV--VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
                 +E  P +  G   + + N    V  GK+KAL  +RD  +  + N LDE A  L
Sbjct: 233 ------AEQRP-YAKGFFELFAGNSKITVSDGKLKALFDLRDGGIVKYMNYLDEFALSL 284


>gi|91976147|ref|YP_568806.1| flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB5]
 gi|91682603|gb|ABE38905.1| Flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB5]
          Length = 623

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 129/321 (40%), Gaps = 43/321 (13%)

Query: 14  CNNASQQFASIVRNIENADNKNYVRR--DTMTTI---SPENVTVVTQRSENKNMFDKVLH 68
            N AS    S   N+ NA+   YVR+  D +TT    S   V+++    E        L 
Sbjct: 16  ANQASMSLVS--SNVANAETPGYVRKTVDQITTTAGPSGSGVSIIGVNRELDAYLQSQLR 73

Query: 69  AHSSAIGQQRLLQSFEALKEMMSADDHYN---------NSPTHYISKLRDSLESYSKNLS 119
             +S      L   F  LK++     + N         NS T  +  L  S +S S  + 
Sbjct: 74  TETSGASYALLRSDF--LKQLQGLYGNPNSTGTLENAFNSLTAAVQALGTSPDSTSARIG 131

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                  V++ A  V    N ++  +Q +R+ A+  +   ++     L  +  +N+ I+ 
Sbjct: 132 -------VLNAARVVAGGLNATSNGIQSLRSGAETGLADSVNTANNLLQRIASINNNIRT 184

Query: 180 KTASKHDA----HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
             A            LDQRD  + ++S+++ I  +   +N   V+T  G  L       +
Sbjct: 185 NPAGGTSTDVATASLLDQRDAAISQLSQLMDIRVVTDGSNRATVFTGSGMQLVGMQAAKL 244

Query: 236 NFEKMNSYT---------VTSESNPI---FIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
           +F+   + T          TS+   +   + DG  +  +  S++  G I A +++RD  +
Sbjct: 245 SFDAQGTVTPSTTWSSNSATSQLGSVKITYADGGTI--DLTSSLKSGTIAAYIELRDKTL 302

Query: 284 PIFQNQLDEMARVLIGSFSEK 304
              Q QLD+ A  +  + S+K
Sbjct: 303 VQAQTQLDQFAASMASALSDK 323



 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 54/111 (48%), Gaps = 7/111 (6%)

Query: 372 PDLINHYCDSFNKNFIFDPVAGINT-----NVTLLEYARNSIGWLEKNRSDSHDLHMKSQ 426
           PD +     +    +++    GI +     N TL  Y +  +G    +   +  L     
Sbjct: 513 PDFLTKQLTT--SKYLYSAATGIGSTSAPYNGTLSSYLQQFVGQQGSDALAASQLAEGQS 570

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           VV N + + YS + GVN+ EE++ L+ ++ +Y+ + +++   ++M Q L++
Sbjct: 571 VVLNTLQQKYSTSSGVNMDEEMAHLLSLQNAYSANARVMSTVNQMYQALMQ 621


>gi|220932550|ref|YP_002509458.1| flagellar hook-associated protein FlgK [Halothermothrix orenii H
           168]
 gi|219993860|gb|ACL70463.1| flagellar hook-associated protein FlgK [Halothermothrix orenii H
           168]
          Length = 471

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 97/478 (20%), Positives = 212/478 (44%), Gaps = 59/478 (12%)

Query: 27  NIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNM-----FDKVLHAHSSAI-----G 75
           NI NA+ + Y R R   TT  P  V   T  +    +      ++++      I      
Sbjct: 27  NIANANTEGYSRQRAVHTTTDPYTVPGFTSPAGAGQVGTGVKIEQIVRLKDDFITSRINN 86

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPT-HYISKLRD----SLESYSKNLSEDILGKTVIDN 130
           + + L ++EA K+ +   +   N P+ + +  L D    S    S N   + +  TV + 
Sbjct: 87  ETQDLGAWEARKDNLHQIELIFNEPSENGLRNLMDLFWSSWHELSLNPESEGVRSTVREQ 146

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHD 189
           A+ +++ F ++  ++ +++ D + +I++ +  +     ++ ++N  I   ++  +  A+D
Sbjct: 147 AKTLIEGFKSTYNQLIQLKDDINHDIDVNVQRVNTLGEKIAMLNKRIVAVESDPQKRAND 206

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD-----GTTLFETVPRDINFEKMNSYT 244
             D+RD+L++K+++ I +        ++ +         G T  +    +I      SY 
Sbjct: 207 LRDKRDLLVKKLAKYINVQAHEDGQGNLNLSIGGVSFVTGDTFHKIELEEITLPGTTSYK 266

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           V     P++        N    +  GKIK  + +RD  +  + ++L+E+     G  +E 
Sbjct: 267 VVK---PVW-----SHINSDVTITSGKIKGAMDVRDKDIIQYIDKLNELVE---GIVTEV 315

Query: 305 DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL---RDGGSVSKKF 361
           + I  + E++ G     G+   D+   +  ++T+ ++    S+ + +   + GG V    
Sbjct: 316 NSIHSSGEDLNG---NTGVDFFDS--SKTTADTMSLDSAIESDLNAIAAAQTGGGVG--- 367

Query: 362 LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDL 421
             + +N     +L N    S NK+             T  E+  + I  L      ++ +
Sbjct: 368 --DGRNAEAIAELQNALTMSGNKS-------------TFNEFYTSIISGLGVEAEKANMM 412

Query: 422 HMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +   +V+ N++    ++  GV+L EE++ +IK +Q+YN + K++   D+ML TL+ G+
Sbjct: 413 YDNQEVMINNLENKQASISGVSLDEEMANMIKFQQAYNAAAKMVSKVDEMLNTLINGM 470


>gi|86750925|ref|YP_487421.1| flagellar hook-associated protein [Rhodopseudomonas palustris HaA2]
 gi|86573953|gb|ABD08510.1| Flagellar hook-associated protein [Rhodopseudomonas palustris HaA2]
          Length = 623

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 142/314 (45%), Gaps = 29/314 (9%)

Query: 14  CNNASQQFASIVRNIENADNKNYVRR--DTMTTISPENVTVVTQRSENKNMFDKVLHAH- 70
            N AS    S   N+ NA+   YVR+  + +TT+S  + + V+    N+ + D  L A  
Sbjct: 16  ANQASMSLVS--SNVANAETPGYVRKTVNQVTTLSGPSGSGVSITGVNREL-DAYLQAQL 72

Query: 71  ---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTV 127
              +S      L   F    + +  D + N +     + L  + ++ + +  +    +  
Sbjct: 73  RTETSGASYASLRSDFLQQLQGLFGDPNSNGTLEDAFNGLTAATQALATS-PDSTSARIG 131

Query: 128 IDNAEEVVQN-FNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA--SK 184
           + NA +VV    N+ +  +Q +R  A+  +   ++     L ++  +N+ I+   A  + 
Sbjct: 132 VLNAAQVVSGVLNSMSNGIQTLRTGAETGLTDAVNTANNLLQQIASINNNIRTNPAGGTS 191

Query: 185 HDAH--DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
            DA     LDQRD  + ++++++ I  +   +N + V+T  G  L       ++F+   +
Sbjct: 192 TDAATASLLDQRDAAINQLAQLMDIRVVTDASNQVTVFTGSGMQLVGMQAAQLSFDAQGT 251

Query: 243 YTVTSESNP------------IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            T ++  NP            ++ DG   +++  +++  GK+ A +++RD+ +   Q QL
Sbjct: 252 VTPSTTWNPNTSASELGSVRIVYPDG--STADLTNSLKSGKMAAYVELRDNTLVQAQTQL 309

Query: 291 DEMARVLIGSFSEK 304
           D+ A  +  + S+K
Sbjct: 310 DQFAAAMASALSDK 323



 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 17/155 (10%)

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAG---YPDLINHYCDSFNKNFIFD 389
           G+++ I VNP   ++PS L         +       AG    PD I     S    +++ 
Sbjct: 478 GLAQRISVNPALVTDPSRL-------VVYSTTPPTAAGDTTRPDFITKQLTS--SKYLYS 528

Query: 390 PVAGINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
              GI +N      TL  + +  +     N   +  L     VV N + + Y+   GVN+
Sbjct: 529 ATTGIGSNAAPYNGTLESFLQQFVSQQGSNAQAATQLASGQSVVLNTLQQKYATNSGVNM 588

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            EE++ L+ ++ +Y+ + +++   ++M QTL++ +
Sbjct: 589 DEEMAHLLSLQNAYSANARVMSTVNQMYQTLMQAM 623


>gi|221199746|ref|ZP_03572789.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           CGD2M]
 gi|221208649|ref|ZP_03581649.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           CGD2]
 gi|221171460|gb|EEE03907.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           CGD2]
 gi|221179985|gb|EEE12389.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           CGD2M]
          Length = 698

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 125/275 (45%), Gaps = 26/275 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V TV  QR  ++
Sbjct: 55  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVNTVTVQRQYSQ 109

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + D++  A +    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 110 YLSDQLNTAQT----QSGALSTWYSLVAQL---NNYIGSPTAGISTAITNYFTGLQNVAN 162

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++  + +T + NA+ +      + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 163 NAADPTVRQTAMSNAQTLADQITAAGQQYDALRQSVNTQLTSAVSQINTYTAQIAQLNQQ 222

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 223 IAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNSDGYSVFLAGGQPL---VVADKS 278

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK 271
           ++     TVTS S+P  +   VVS     A P G 
Sbjct: 279 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGP 308


>gi|161526179|ref|YP_001581191.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           ATCC 17616]
 gi|189349105|ref|YP_001944733.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           ATCC 17616]
 gi|160343608|gb|ABX16694.1| flagellar hook-associated protein FlgK [Burkholderia multivorans
           ATCC 17616]
 gi|189333127|dbj|BAG42197.1| flagellar hook-associated protein 1 [Burkholderia multivorans ATCC
           17616]
          Length = 659

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 125/275 (45%), Gaps = 26/275 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + D++  A +    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQLNTAQT----QSGALSTWYSLVAQL---NNYIGSPTAGISTAITNYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++  + +T + NA+ +      + ++   +R   + ++   +S +  + +++  +N  
Sbjct: 124 NAADPTVRQTAMSNAQTLADQITAAGQQYDALRQSVNTQLTSTVSQINTYTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 IAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQ-VVRNSDGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK 271
           ++     TVTS S+P  +   VVS     A P G 
Sbjct: 240 YQLA---TVTSPSDPSEL--TVVSQGIAGANPPGP 269


>gi|221635454|ref|YP_002523330.1| flagellar hook-associated protein FlgK [Thermomicrobium roseum DSM
           5159]
 gi|221158038|gb|ACM07156.1| flagellar hook-associated protein FlgK [Thermomicrobium roseum DSM
           5159]
          Length = 468

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 100/476 (21%), Positives = 190/476 (39%), Gaps = 61/476 (12%)

Query: 27  NIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHA-----HSSAIGQQRLL 80
           NI NA+   + R R ++    P  V    +      +   VL A       S    Q  +
Sbjct: 26  NIANANTPGFARQRVSLVPSMPYTVPAFNRSGLAGQVGTGVLVASITRVRESVFDLQYRV 85

Query: 81  QSFEALKEMMSADDHYN------NSPTHYISKLRDSLESYSK------NLSEDILGKT-V 127
           QS +AL E  +  D Y       N PT   + L   L+ + +      N  ED+  +  +
Sbjct: 86  QS-QALGEASTLVDAYAQIEAVFNEPTE--AGLGTLLDRFWRAWQAVGNQPEDLAARAAL 142

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           + +A  +  N N   R++ +++AD   ++ L++S +      L  +N  I    A+    
Sbjct: 143 VQDATTLATNLNRMRRQLTELQADTVTKLTLQVSEVNSIAERLASLNQQIVAALATGQTP 202

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTS 247
           +D +DQRD+LL K++   G +     N  + +Y       +  V +D  F    S  V+ 
Sbjct: 203 NDLMDQRDLLLDKLARFTGATIRPLPNGAVNIYLGG----YPLVDQDQWFPL--SVQVSG 256

Query: 248 ESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPI 307
            +  +   G    +    A+ +G ++ALL + ++V+P    +L+++          +D +
Sbjct: 257 GTASVLWQG----TTSPVALERGSLQALLHLHNAVLPGLVQKLEDI----------RDAL 302

Query: 308 AG--NSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNV 365
           A   N+ ++ G     G+ DL           I    +    PS + D   ++     + 
Sbjct: 303 ANEVNTLHMTGY----GLSDLPGPPPGRPFFRITAGGELEVEPSLVADPQLIAAA---DA 355

Query: 366 KNLAGYPDLINHYCDSFNKNFIFDPVAGINT--NVTLLEYARNSIGWLEKNRSDSHDLHM 423
               G   +     +  +K  +    A IN   N  + E     +G   +    + D   
Sbjct: 356 PGEPGNNAIARQIAELRSKLVLNSGTATINDFYNTLVAE-----VGGASQTAQVTRD--- 407

Query: 424 KSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             + +   I       + V+L EE++ LIK +Q+Y  + + I   D+ML  ++ G+
Sbjct: 408 NQRALVEAIDRQRQEIMAVSLDEEMANLIKYQQAYGAAARAITAVDEMLDRIINGM 463


>gi|317052131|ref|YP_004113247.1| flagellar hook-associated protein FlgK [Desulfurispirillum indicum
           S5]
 gi|316947215|gb|ADU66691.1| flagellar hook-associated protein FlgK [Desulfurispirillum indicum
           S5]
          Length = 569

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 87/173 (50%), Gaps = 4/173 (2%)

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
           TVI++A  ++     + +++  ++A     ++  ++++   L  L  +N  I   +A  +
Sbjct: 140 TVIESANFLINTIQGTYQQLNDLQAQYTGRVDSMVNDVNSQLQSLATLNTQIAKTSAHGN 199

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV 245
            AHD LDQRD++L K++E I I   +       V+  DG TL   V RD   + +N  T 
Sbjct: 200 PAHDLLDQRDMILNKLAEYIDIKVDIDPQGQATVFF-DGKTL---VDRDYAAKLINKRTG 255

Query: 246 TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              S  +F      +S   +    G+I A +++RD  +P +  +LD+++R +I
Sbjct: 256 EFSSELLFESTSGHTSKITNFSNNGQIGAYMEMRDKTIPGYIEKLDDLSRTII 308


>gi|253996313|ref|YP_003048377.1| flagellar hook-associated protein FlgK [Methylotenera mobilis JLW8]
 gi|253982992|gb|ACT47850.1| flagellar hook-associated protein FlgK [Methylotenera mobilis JLW8]
          Length = 657

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 109/228 (47%), Gaps = 15/228 (6%)

Query: 86  LKEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSA 142
           L +M S +D  +NS       + D   +++  S N S+    ++++  A+ +   F T+ 
Sbjct: 90  LSQMTSINDMLSNSTAGLNPAMSDFFGAVQKLSANPSDIPTRQSMLSYAQSLASRFQTTN 149

Query: 143 REVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKI 201
             + +IR   + ++   +  +  +  ++  +ND I K  +A+    +D +DQRD L+ ++
Sbjct: 150 NRLNEIRDSVNTQLTSSVGLVNTYAKQIASLNDVIEKSISANGSTPNDLMDQRDQLVLEL 209

Query: 202 SEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS 261
           S+ I  + + +      VY  +G      +P  +  E  N  T  S ++P  ++    SS
Sbjct: 210 SKQIKTTVVSQGQGGYNVYVGNG------LPLVVGKETFNLLTTPSPTDPSRLEVAYQSS 263

Query: 262 NQ-----GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           ++      +++P G I  LLQ R   +   QNQ+ ++A VL  +F+ +
Sbjct: 264 SKTTVLGANSLPGGVIGGLLQFRAESLDAVQNQIGQIAVVLGNTFNSQ 311


>gi|134297191|ref|YP_001120926.1| flagellar hook-associated protein FlgK [Burkholderia vietnamiensis
           G4]
 gi|134140348|gb|ABO56091.1| flagellar hook-associated protein FlgK [Burkholderia vietnamiensis
           G4]
          Length = 655

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 124/273 (45%), Gaps = 26/273 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSENK 60
           +L  +    QNI N A+  + S+ R +   ++  Y     +    P+ V TV  QR  ++
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEESGQYTASGYL----PQGVNTVTVQRQYSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + D+ L+A  S  G Q    S      +++  ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSDQ-LNAAQSQGGAQSTWYS------LVAQLNNYVGSPTAGISTAITNYFTGLQNVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N S+  + +T I NA+ +      + ++   +R   + ++   +S +  + S++  +N  
Sbjct: 124 NASDPSVRQTAISNAQILADQLKATGQQYDALRQSVNTQLTSTVSQINTYTSQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ +  +S + G+  +VRN++   V+ + G  L   V  D +
Sbjct: 184 IGAASSQGQPPNQLLDQRDLAVSNLSSLAGVQ-VVRNDSGYSVFLAGGQPL---VVADKS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK 269
           ++      V S S+P  +   VVS     A PK
Sbjct: 240 YQLA---AVASSSDPSEL--TVVSQGIAGANPK 267


>gi|152980141|ref|YP_001353117.1| flagellar hook-associated protein FlgK [Janthinobacterium sp.
           Marseille]
 gi|151280218|gb|ABR88628.1| FlgK flagellar hook-associated protein [Janthinobacterium sp.
           Marseille]
          Length = 647

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 13/186 (6%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           + ++  AE +V  F +   ++  +RA  + EI   ++N+  +  ++  +NDAI K +  S
Sbjct: 132 QAMLSGAEALVSRFQSMDGQLSSMRAGVNNEITGAVTNINAYAKQIAQLNDAIAKAQNGS 191

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
               +D LDQRD+L+ ++++   +S IV+   D  V+  +G  L   V  + N++ +   
Sbjct: 192 GQPPNDLLDQRDLLVAELAKQTKVS-IVQQAGDYNVFIGNGQPL---VVGNSNYDLV--- 244

Query: 244 TVTSESNPIFIDGVVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           TVTS ++P  ++   VS+     +P+     G +  L + R   +   QN L  +A  L 
Sbjct: 245 TVTSPTDPGRLEVGYVSNGTTYTIPESSLTGGNLGGLFEYRSQSLDPIQNALGRIALGLA 304

Query: 299 GSFSEK 304
            +F+ +
Sbjct: 305 ATFNAQ 310


>gi|39936992|ref|NP_949268.1| flagellar hook-associated protein [Rhodopseudomonas palustris
           CGA009]
 gi|39650849|emb|CAE29372.1| possible flagellar hook-associated protein 1 FlgK [Rhodopseudomonas
           palustris CGA009]
          Length = 623

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 89/194 (45%), Gaps = 18/194 (9%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF----KTA 182
           V++ A+ +  N N+++  +Q +RA  +  I   ++     + ++  +N  I+      T+
Sbjct: 132 VLNAAQAISSNLNSTSNGIQTLRAGCETGIADAVTTANNLMQQIANINTHIQTNPLGGTS 191

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
           +       LDQRD  + ++S+++ I  +    N + V+T  G  L       + F    +
Sbjct: 192 TDAATSAMLDQRDQAINQLSQLMDIRVVTNGANQVTVFTGSGVQLVGMEAAKLTFNAQGT 251

Query: 243 YTVTSESNP------------IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            + T+  NP             + +G   SS+  S++  GK+ A +++RD  +   Q QL
Sbjct: 252 VSPTTMWNPNTAISDLGSIRVGYANG--SSSDLTSSLKSGKLAAYVELRDKTLVQAQTQL 309

Query: 291 DEMARVLIGSFSEK 304
           D+ A  L  + S+K
Sbjct: 310 DQFAASLSSALSDK 323



 Score = 45.8 bits (107), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 386 FIFDPVAGINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTV 440
           +++    GI ++      TLL Y +  +     N + +  L     VV N + + +S + 
Sbjct: 525 YLYSAKTGIGSDAAPYKGTLLSYLQQFVSQQGSNAAAAQQLSEGQNVVLNTLQQKFSTSS 584

Query: 441 GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           GVN+ EE++ L+ ++ +Y  + +++   ++M Q+L++ +
Sbjct: 585 GVNMDEEMAHLLSLQNAYAANARVMSTINQMYQSLMQAI 623


>gi|192292820|ref|YP_001993425.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           TIE-1]
 gi|192286569|gb|ACF02950.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           TIE-1]
          Length = 623

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 89/194 (45%), Gaps = 18/194 (9%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF----KTA 182
           V++ A+ +  N N+++  +Q +RA  +  I   ++     + ++  +N  I+      T+
Sbjct: 132 VLNAAQAISSNLNSTSNGIQTLRAGCETGIADAVTTANNLMQQIANINTHIQTNPLGGTS 191

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
           +       LDQRD  + ++S+++ I  +    N + V+T  G  L       + F    +
Sbjct: 192 TDAATSAMLDQRDQAINQLSQLMDIRVVTNGANQVTVFTGSGVQLVGMEAAKLTFNAQGT 251

Query: 243 YTVTSESNP------------IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            + T+  NP             + +G   SS+  S++  GK+ A +++RD  +   Q QL
Sbjct: 252 VSPTTMWNPNTAISDLGSIRVGYANG--SSSDLTSSLKSGKLAAYVELRDKTLVQAQTQL 309

Query: 291 DEMARVLIGSFSEK 304
           D+ A  L  + S+K
Sbjct: 310 DQFAASLSSALSDK 323



 Score = 45.8 bits (107), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 386 FIFDPVAGINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTV 440
           +++    GI ++      TLL Y +  +     N + +  L     VV N + + +S + 
Sbjct: 525 YLYSAKTGIGSDAAPYKGTLLSYLQQFVSQQGSNAAAAQQLSEGQNVVLNTLQQKFSTSS 584

Query: 441 GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           GVN+ EE++ L+ ++ +Y  + +++   ++M Q+L++ +
Sbjct: 585 GVNMDEEMAHLLSLQNAYAANARVMSTINQMYQSLMQAI 623


>gi|167835119|ref|ZP_02462002.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           MSMB43]
          Length = 667

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/273 (20%), Positives = 128/273 (46%), Gaps = 28/273 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT QR  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVQRQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + D++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSDQLNAAQT----QGNALSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      ++++  ++R   + ++   +  +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAASQQYSQLRQSVNSQLTDSVKQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ +  +S++ G+  +V++N    V+ + G  L   V  +++
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSNLSQLAGVQ-VVQSNGSYSVFLAGGQPL---VVGNMS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQGS 265
           ++      V S+S+P    I  +G+  ++ QGS
Sbjct: 240 YQLA---AVASKSDPSELTIVSNGIAGANPQGS 269


>gi|148258439|ref|YP_001243024.1| putative flagellar hook-associated protein [Bradyrhizobium sp.
           BTAi1]
 gi|146410612|gb|ABQ39118.1| putative flagellar hook-associated protein [Bradyrhizobium sp.
           BTAi1]
          Length = 599

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 136/325 (41%), Gaps = 40/325 (12%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-TISPENVTVVTQRSENKNMFD 64
            FN A            ++ +N+ N+    Y RR   T +  P N  V   R +    FD
Sbjct: 5   AFNTATAGLQTLQVAIGTVSQNVANSGVAGYTRRVVSTESAGPGNSGVAVARIDRT--FD 62

Query: 65  KVLHAHSSAIGQQRL----LQSFEALKEMMSADDHYNNSPT------HYISKLRDSLESY 114
           ++      A+ Q RL         A  ++++  D  +  P         ++ L  SL + 
Sbjct: 63  EM------ALKQMRLESAHAAYASAKADILAQIDKLSGKPADSSALDARLNGLAKSLLAL 116

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + N +      TV+D A  +       A  +Q +R  A+K +  E+S     L+ +  +N
Sbjct: 117 ASNGASASSRSTVVDAASVLADKIRGMADALQAMRDGANKRLAAEVSAADGLLTSIADLN 176

Query: 175 DAIKFKTASKHDAH-DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVP 232
             IK  T +        LD+RD  + +++  + + +I + +  + + T+ G TL E    
Sbjct: 177 --IKATTVTDDATRVGILDRRDQQITELARYMEVKSIRQRDGGVTLMTASGLTLVERGAA 234

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQG--------SAVPKGKIKALLQIRDSVVP 284
             ++F          + +P    G +V++  G        SAV  G I A L+IRD+++P
Sbjct: 235 TKLSFI---------DRSPATGGGAIVATLPGGVGLELDASAVSSGSIAANLEIRDAILP 285

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAG 309
             Q +LD++A  L  +F+     AG
Sbjct: 286 RTQRRLDDLAFGLAQAFTNTTVTAG 310


>gi|327393477|dbj|BAK10899.1| flagellar hook-associated protein 1 [Pantoea ananatis AJ13355]
          Length = 546

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 139/324 (42%), Gaps = 46/324 (14%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFD 64
           ++ N A +  + A    ++   NI N     Y R+ T+  ++  N T+     + K+ + 
Sbjct: 3   SIINSAMSGLSAAQAALSTTSNNISNYTVAGYSRQTTI--LAEANSTL-----QGKSYYG 55

Query: 65  KVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY--ISKLRDSLESYSKNLSEDI 122
             ++      G QR   SF A  ++  +   YN + T Y  +S + D + + + NLS  I
Sbjct: 56  NGVNV----TGVQREYDSFIA-AQLRGSSATYNAANTQYSQVSNIDDLMSTSTTNLSTAI 110

Query: 123 LG------------------KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            G                  ++++ N++ +V  F T A+ +  ++   +  I  ++  + 
Sbjct: 111 QGFFSNMQNVVSNANDPAARQSMLSNSQGLVNQFQTQAQYLTNMQNSVNTNIASDVDQIN 170

Query: 165 RFLSELTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            F ++++ +N  I K  TA+    +D LDQRD L+  ++ I+G+ T+ + +    V  ++
Sbjct: 171 TFTTQISNLNQQIAKLSTANGATPNDLLDQRDQLVNGLNNIVGV-TVSQQDGSYTVSMAN 229

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQG------SAVPKGKIKALLQ 277
           G +L         F+      + S S+        V    G      S++  G +  +L 
Sbjct: 230 GLSLVN------GFQSTKLVAMPSSSDLTRTTVGYVDPQAGNVQLPESSITTGSLGGMLS 283

Query: 278 IRDSVVPIFQNQLDEMARVLIGSF 301
            R   + + QNQL ++A     SF
Sbjct: 284 FRSQDLDLAQNQLGQLAAAFTTSF 307


>gi|167561212|ref|ZP_02354128.1| flagellar hook-associated protein FlgK [Burkholderia oklahomensis
           EO147]
          Length = 668

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 107/231 (46%), Gaps = 18/231 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N+A+  + S+ R +    +  Y     +    P+ VT VT +R  N+
Sbjct: 16  ALWGITTTGQNISNSATPGY-SVERPVYAEASGQYTSSGYL----PQGVTTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + +++  A +    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYSLVAQL---NNYVGSPTAGISTAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T I NA+ +      + ++  ++R   + ++   ++ +  + +++  +N+ 
Sbjct: 124 NAADPSARQTAISNAQTLASQLVAAGQQYSQLRQTVNSQLTDTVTQINSYTAQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
           I   ++     +  LDQRD+ +  +S++ G+  +V  N    V+ S G  L
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSNLSQLAGVQ-VVPGNGSYSVFLSGGQPL 233


>gi|254258855|ref|ZP_04949909.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1710a]
 gi|254217544|gb|EET06928.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1710a]
          Length = 419

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 126/272 (46%), Gaps = 28/272 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S++ G+  +V++N +  V+ S G  L   V  + +
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSKLSQLAGVQ-VVQSNGNYSVFLSGGQPL---VVGNAS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQG 264
           ++     TV S S+P    I   GV  S+  G
Sbjct: 240 YQLA---TVASPSDPSELTIVSKGVAGSAQPG 268


>gi|76809667|ref|YP_331888.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1710b]
 gi|167892419|ref|ZP_02479821.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           7894]
 gi|167909135|ref|ZP_02496226.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           112]
 gi|76579120|gb|ABA48595.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1710b]
          Length = 667

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 126/272 (46%), Gaps = 28/272 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S++ G+  +V++N +  V+ S G  L   V  + +
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSKLSQLAGVQ-VVQSNGNYSVFLSGGQPL---VVGNAS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQG 264
           ++     TV S S+P    I   GV  S+  G
Sbjct: 240 YQLA---TVASPSDPSELTIVSKGVAGSAQPG 268


>gi|53717921|ref|YP_106907.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           K96243]
 gi|53724572|ref|YP_104805.1| flagellar hook-associated protein FlgK [Burkholderia mallei ATCC
           23344]
 gi|121601252|ref|YP_994298.1| flagellar hook-associated protein FlgK [Burkholderia mallei SAVP1]
 gi|124385698|ref|YP_001028053.1| flagellar hook-associated protein FlgK [Burkholderia mallei NCTC
           10229]
 gi|126448312|ref|YP_001082860.1| flagellar hook-associated protein FlgK [Burkholderia mallei NCTC
           10247]
 gi|126451511|ref|YP_001064571.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1106a]
 gi|167717670|ref|ZP_02400906.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           DM98]
 gi|167736711|ref|ZP_02409485.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           14]
 gi|167813810|ref|ZP_02445490.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           91]
 gi|167822327|ref|ZP_02453798.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           9]
 gi|167843917|ref|ZP_02469425.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           B7210]
 gi|167900916|ref|ZP_02488121.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           NCTC 13177]
 gi|242314954|ref|ZP_04813970.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1106b]
 gi|254174885|ref|ZP_04881546.1| flagellar hook-associated protein 1 [Burkholderia mallei ATCC
           10399]
 gi|254197004|ref|ZP_04903428.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           S13]
 gi|254359739|ref|ZP_04976010.1| flagellar hook-associated protein 1 [Burkholderia mallei
           2002721280]
 gi|52208335|emb|CAH34268.1| putative flagellar hook-associated protein [Burkholderia
           pseudomallei K96243]
 gi|52427995|gb|AAU48588.1| flagellar hook-associated protein 1 [Burkholderia mallei ATCC
           23344]
 gi|121230062|gb|ABM52580.1| flagellar hook-associated protein 1 [Burkholderia mallei SAVP1]
 gi|124293718|gb|ABN02987.1| flagellar hook-associated protein FlgK [Burkholderia mallei NCTC
           10229]
 gi|126225153|gb|ABN88693.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1106a]
 gi|126241182|gb|ABO04275.1| flagellar hook-associated protein FlgK [Burkholderia mallei NCTC
           10247]
 gi|148028953|gb|EDK86885.1| flagellar hook-associated protein 1 [Burkholderia mallei
           2002721280]
 gi|160695930|gb|EDP85900.1| flagellar hook-associated protein 1 [Burkholderia mallei ATCC
           10399]
 gi|169653747|gb|EDS86440.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           S13]
 gi|242138193|gb|EES24595.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1106b]
          Length = 667

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 126/272 (46%), Gaps = 28/272 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S++ G+  +V++N +  V+ S G  L   V  + +
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSKLSQLAGVQ-VVQSNGNYSVFLSGGQPL---VVGNAS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQG 264
           ++     TV S S+P    I   GV  S+  G
Sbjct: 240 YQLA---TVASPSDPSELTIVSKGVAGSAQPG 268


>gi|254182133|ref|ZP_04888730.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1655]
 gi|184212671|gb|EDU09714.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1655]
          Length = 714

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 127/273 (46%), Gaps = 28/273 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 63  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 117

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 118 YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 170

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 171 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 230

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S++ G+  +V++N +  V+ S G  L   V  + +
Sbjct: 231 IASASSQGQPPNQLLDQRDLAVSKLSQLAGVQ-VVQSNGNYSVFLSGGQPL---VVGNAS 286

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQGS 265
           ++     TV S S+P    I   GV  S+  G+
Sbjct: 287 YQLA---TVASPSDPSELTIVSKGVAGSAQPGA 316


>gi|115523523|ref|YP_780434.1| flagellar hook-associated protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517470|gb|ABJ05454.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
          Length = 629

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 140/318 (44%), Gaps = 37/318 (11%)

Query: 14  CNNASQQFASIVRNIENADNKNYVRR--DTMTTISPENVTVVTQRSENKNMFDKVLHAH- 70
            N AS    S   N+ NA+   YVR+  D +TT S    + V     N+ + D+ + A  
Sbjct: 16  ANQASMSLVS--SNVANAETPGYVRKTIDQVTTNSGSVGSGVRVYGVNRQL-DEYIQAQV 72

Query: 71  ---SSAIGQQRLLQSF-EALKEMMSADDHYN------NSPTHYISKLRDSLESYSKNLSE 120
              +S  G   L   F + L+ +    D+        N  T  I  L  S ES S  L  
Sbjct: 73  RTETSGAGYTTLKSDFLQQLQSIYGNPDNTGTLENAFNGLTTAIQALSTSPESQSARLG- 131

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF- 179
                 V++ A+ + Q  N+  + +Q +R   +  ++  ++     +S++ V+N+ ++  
Sbjct: 132 ------VLNAAQVMAQQLNSMTQGIQSLRNSCEIGLDDSVNYANNLMSQIAVINNNLQAN 185

Query: 180 ---KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
               T++  +    LDQRD  + ++S+++ I     + N + ++T  G  L       + 
Sbjct: 186 PLGGTSTTGEVAALLDQRDQYITELSQLMDIRVTFNSANQVTIFTPTGIQLVGNEAAHLE 245

Query: 237 FEKMNSY----TVTSESNPIFIDGVVVS-SNQGS-----AVPKGKIKALLQIRDSVVPIF 286
           F    +     T  + ++   +  V +S +N GS     ++  GKI A +++RD ++   
Sbjct: 246 FNAQGTVNPATTYDTTASKSTLGAVTISYANGGSIDLTNSIKSGKIAAYVELRDKLLVEA 305

Query: 287 QNQLDEMARVLIGSFSEK 304
           Q Q+D+ A  +  + S+K
Sbjct: 306 QTQVDQFAATMSSALSDK 323


>gi|167568430|ref|ZP_02361304.1| flagellar hook-associated protein FlgK [Burkholderia oklahomensis
           C6786]
          Length = 668

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 107/231 (46%), Gaps = 18/231 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N+A+  + S+ R +    +  Y     +    P+ VT VT +R  N+
Sbjct: 16  ALWGITTTGQNISNSATPGY-SVERPVYAEASGQYTSSGYL----PQGVTTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSK 116
            + +++  A +    Q   L ++ +L   +   ++Y  SPT  IS         L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYSLVAQL---NNYVGSPTAGISTAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T I NA+ +      + ++  ++R   + ++   ++ +  + +++  +N+ 
Sbjct: 124 NAADPSARQTAISNAQTLASQLVAAGQQYSQLRQTVNSQLTDTVTQINSYTAQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
           I   ++     +  LDQRD+ +  +S++ G+  +V  N    V+ S G  L
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSNLSQLAGVQ-VVPGNGSYSVFLSGGQPL 233


>gi|126441590|ref|YP_001057329.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           668]
 gi|134283597|ref|ZP_01770296.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           305]
 gi|217425071|ref|ZP_03456567.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           576]
 gi|226199842|ref|ZP_03795393.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810468|ref|YP_002894919.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           MSHR346]
 gi|238562529|ref|ZP_00440322.2| flagellar hook-associated protein FlgK [Burkholderia mallei GB8
           horse 4]
 gi|251767452|ref|ZP_02267340.2| flagellar hook-associated protein 1 [Burkholderia mallei PRL-20]
 gi|254188065|ref|ZP_04894577.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254201902|ref|ZP_04908266.1| flagellar hook-associated protein 1 [Burkholderia mallei FMH]
 gi|254207237|ref|ZP_04913588.1| flagellar hook-associated protein 1 [Burkholderia mallei JHU]
 gi|254295821|ref|ZP_04963278.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           406e]
 gi|126221083|gb|ABN84589.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           668]
 gi|134245006|gb|EBA45101.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           305]
 gi|147747796|gb|EDK54872.1| flagellar hook-associated protein 1 [Burkholderia mallei FMH]
 gi|147752779|gb|EDK59845.1| flagellar hook-associated protein 1 [Burkholderia mallei JHU]
 gi|157805698|gb|EDO82868.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           406e]
 gi|157935745|gb|EDO91415.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           Pasteur 52237]
 gi|217392091|gb|EEC32117.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           576]
 gi|225928193|gb|EEH24229.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506435|gb|ACQ98753.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           MSHR346]
 gi|238522496|gb|EEP85940.1| flagellar hook-associated protein FlgK [Burkholderia mallei GB8
           horse 4]
 gi|243062745|gb|EES44931.1| flagellar hook-associated protein 1 [Burkholderia mallei PRL-20]
          Length = 714

 Score = 61.6 bits (148), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 126/272 (46%), Gaps = 28/272 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 63  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 117

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 118 YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 170

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 171 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 230

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S++ G+  +V++N +  V+ S G  L   V  + +
Sbjct: 231 IASASSQGQPPNQLLDQRDLAVSKLSQLAGVQ-VVQSNGNYSVFLSGGQPL---VVGNAS 286

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQG 264
           ++     TV S S+P    I   GV  S+  G
Sbjct: 287 YQLA---TVASPSDPSELTIVSKGVAGSAQPG 315


>gi|225181620|ref|ZP_03735061.1| flagellar hook-associated protein FlgK [Dethiobacter alkaliphilus
           AHT 1]
 gi|225167728|gb|EEG76538.1| flagellar hook-associated protein FlgK [Dethiobacter alkaliphilus
           AHT 1]
          Length = 494

 Score = 61.6 bits (148), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 84/425 (19%), Positives = 178/425 (41%), Gaps = 41/425 (9%)

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPT-----HYISKLRDSLESYSKNLSEDILGKTVIDN 130
           +  +L ++E+ KE +S  +     P+       +S   DS +  S +         +++N
Sbjct: 82  EMHILGNWESRKEYLSQVEMIFMEPSDTGFNSVLSTFFDSWQELSLSPESSPARAALVEN 141

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDF 190
           A  +V +   +  +++ +RAD  K+IEL++++L     ++  +N  I   TA     +D 
Sbjct: 142 ANFLVNSIQHTYTQLESVRADITKDIELKVNDLNSLAEQIKDLNQQITTLTAKGDSPNDL 201

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESN 250
           +D+RD+LL  +++++     + +N  + ++      + + +        + +   T E N
Sbjct: 202 MDRRDLLLDNLAKMVNYDLHIADNGAVNIFIGGRPLVQQNI-----VNTLKTVEGTPEQN 256

Query: 251 PIFIDG--VVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPI 307
             ++ G  +V S ++  + +  G+I  L+  RD  +  +  + + MA  L+ S +E    
Sbjct: 257 SEWLPGPQIVWSRDERPTQINSGEIAGLIATRDDDLRKYMEEFESMAWGLVDSINE---Y 313

Query: 308 AGNSENVPG-----LFIADGIKDLD-NKLCQGISETICVNPQYRSNPSFLR-DGGSVSKK 360
             N  ++ G      F  D +K +  NK  Q     I       S P   R + GS    
Sbjct: 314 HNNGMDLTGEYGIDFFTGDHLKTIGVNKDIQNDLRKIAA-----STPPIPRGEDGSEEAP 368

Query: 361 F---------LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
           F            +  L      +N    +       D   G     T   + R++I  L
Sbjct: 369 FKPAPGDGSNAVQISQLRNSRITVNSDAKNLRGRLELDDEGG----TTFANFYRDTIARL 424

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
             +  +S  +      +   +S+   +  GV++ EE++ +++ + SY  S ++I   D++
Sbjct: 425 GVDSQESIRMATNQTSLVEMMSDRRDSISGVSIDEEMANMVQFQLSYQASARVITTLDEI 484

Query: 472 LQTLL 476
             TL+
Sbjct: 485 YDTLI 489


>gi|291617026|ref|YP_003519768.1| FlgK [Pantoea ananatis LMG 20103]
 gi|291152056|gb|ADD76640.1| FlgK [Pantoea ananatis LMG 20103]
          Length = 546

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 138/324 (42%), Gaps = 46/324 (14%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFD 64
           ++ N A +  + A    ++   NI N     Y R+ T+  ++  N T+     + K+ + 
Sbjct: 3   SIINSAMSGLSAAQAALSTTSNNISNYTVAGYSRQTTI--LAEANSTL-----QGKSYYG 55

Query: 65  KVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY--ISKLRDSLESYSKNLSEDI 122
             ++      G QR   SF A  ++  +   YN + T Y  +S + D + + + NLS  I
Sbjct: 56  NGVNV----TGVQREYDSFIA-AQLRGSSATYNAANTQYSQVSNIDDLMSTSTTNLSTAI 110

Query: 123 LG------------------KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            G                  ++++ N++ +V  F T A+ +  ++   +  I   +  + 
Sbjct: 111 QGFFSNMQNVVSNANDPAARQSMLSNSQGLVNQFQTQAQYLTNMQNSVNTNIASNVDQIN 170

Query: 165 RFLSELTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            F ++++ +N  I K  TA+    +D LDQRD L+  ++ I+G+ T+ + +    V  ++
Sbjct: 171 TFTTQISNLNQQIAKLSTANGATPNDLLDQRDQLVNGLNNIVGV-TVSQQDGSYTVSMAN 229

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQG------SAVPKGKIKALLQ 277
           G +L         F+      + S S+        V    G      S++  G +  +L 
Sbjct: 230 GLSLVN------GFQSTKLVAMPSSSDLTRTTVGYVDPQAGNVQLPESSITTGSLGGMLN 283

Query: 278 IRDSVVPIFQNQLDEMARVLIGSF 301
            R   + + QNQL ++A     SF
Sbjct: 284 FRSQDLDLAQNQLGQLAAAFTTSF 307


>gi|146341929|ref|YP_001206977.1| putative flagellar hook-associated protein FlgK [Bradyrhizobium sp.
           ORS278]
 gi|146194735|emb|CAL78760.1| putative flagellar hook-associated protein 1 (HAP1, FlgK protein)
           [Bradyrhizobium sp. ORS278]
          Length = 621

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 104/235 (44%), Gaps = 21/235 (8%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L+S S N S        +  A+ V Q  N + + +Q +R++ +++I   ++ +   L +
Sbjct: 115 ALQSLSNNPSNQSAQSVALSAAQGVAQQLNATTKGIQTLRSNVEQDIGDSVTQVNGALKQ 174

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N  ++  ++S   A    DQRD  +  +S+ + I  +  + N + V+T+ G  L  
Sbjct: 175 IATLNTQLQGLSSSDPLAATLQDQRDNAIDTLSKYVDIRVVPDSTNGISVFTNSGIQLVG 234

Query: 230 T-VPRDINFEKMNSYTVTSE--SNPI----------FIDGVVVSSNQGSAVPKGKIKALL 276
             +  +  F    +   TS+  SNP             +GV +     S +  G+I A L
Sbjct: 235 AGLTSEFTFSSPGTLDATSQYNSNPTKNGVGQLNIKLSNGVSLDVVANSLLNSGQIAADL 294

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEK--------DPIAGNSENVPGLFIADGI 323
           ++RD  +   Q Q+D++A     + S+K         P AG   +  GL   + I
Sbjct: 295 KLRDQTLVQAQTQVDQLAATFASALSDKTTAGTTVSGPPAGFDVSTTGLLAGNTI 349



 Score = 44.3 bits (103), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 11/139 (7%)

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAG---YPDLINHYCDSFNKNFIFDPVAGINTNV----- 398
           NP+ L D   +S  +  +    AG    PD I  +    +  F + P  G+ +       
Sbjct: 483 NPALLNDATKLST-YSTSPATAAGDSTRPDFI--FAQLTSATFSYSPTTGLGSAAQPFQG 539

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
           T+  Y +  +       + +  L     VV   + E + +T GVN+  E+S LI+V+ +Y
Sbjct: 540 TVSGYLQQFVSQQGSASTLATQLSQGQSVVVATLKEKFQSTAGVNMDSEMSNLIQVQNTY 599

Query: 459 NISNKLIMFTDKMLQTLLE 477
             +  ++     M+Q+LL+
Sbjct: 600 AANAHIMSVVQSMMQSLLQ 618


>gi|90423518|ref|YP_531888.1| flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
 gi|90105532|gb|ABD87569.1| Flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
          Length = 618

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 78/348 (22%), Positives = 139/348 (39%), Gaps = 43/348 (12%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--PENVTVVTQRSENK 60
           L   F+ A      A +    + +N+ NA    YVRR T+TT++  P N +V    + N+
Sbjct: 2   LTTAFSTAVAGLEAAQKAIRVVSQNVGNAGTAGYVRR-TVTTVASGPGNSSVAVG-TVNR 59

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKE----MMSADDHYNNSPTHYIS------KLRDS 110
              D  L        Q RL  S  A       ++S  D     P    +          S
Sbjct: 60  VFEDAALK-------QLRLEASGAAYSSTKSNVLSQLDKLFGKPGDATALDGRMNAFTQS 112

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L+  + + S      TV++ A  + +   + A  VQ++R+  +  +  ++      L  +
Sbjct: 113 LQGLATDPSSVASRSTVLNKAAALTERIRSLAGNVQELRSGIENRLGSDVGAANNLLKSI 172

Query: 171 TVVNDAIKFKTASKHDAH-DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N   K    S   A    LDQRD  + ++S  + + ++ + +  M + T+ G  L +
Sbjct: 173 ASLN--AKLAATSDDSAQAGLLDQRDQQITQLSSYLDVKSMQQRDGAMTLMTTSGVVLVD 230

Query: 230 TVPRDI----------NFEKMNSYTVTSESNPI------FIDGVVVSSNQGSAVPKGKIK 273
              RD           N    ++Y+    +  +         G V+      A+  G I 
Sbjct: 231 ---RDAAATLSFDGRGNLGPTSAYSTDPSARGVGTITATLPGGAVIDLGVRGALSSGSIA 287

Query: 274 ALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIAD 321
           A L++RD  +P+ Q +LD++A  L  S ++K  +   S     L +AD
Sbjct: 288 AQLELRDVALPLAQRRLDDLAFGLAQSLTDKSAVGTQSAAGVDLNLAD 335


>gi|78221659|ref|YP_383406.1| flagellar hook-associated protein [Geobacter metallireducens GS-15]
 gi|78192914|gb|ABB30681.1| Flagellar hook-associated protein [Geobacter metallireducens GS-15]
          Length = 477

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 80/371 (21%), Positives = 155/371 (41%), Gaps = 50/371 (13%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V+   +++V  F      +  ++ +A+K +E   S++   + ++  +ND IK      
Sbjct: 134 QAVLSMGQQLVDQFQRINGYLNDVKNEANKSLEGLTSDVNDKIGQIASLNDQIKQIEIQG 193

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL----------FETVPRD 234
             A++  DQRD+L++++S  +GI+ +   +  + V  + G  L           E  P +
Sbjct: 194 GHANELRDQRDLLVRQLSSKVGITYVENGDGTLSVSLTLGQPLVIGDKAAKLSLEPDPGN 253

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            ++ K+     TS      +D   ++   G+A  +G++   LQ+RD+++  F + LDE+A
Sbjct: 254 SSYYKI---MATSPGGNTAVDISTIAGGPGNA--QGEMGGALQVRDTLINGFLSDLDELA 308

Query: 295 RVLI--------GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
             L          S+        N  N P        K        GIS  I       +
Sbjct: 309 YNLANEVNSVHSASYGLTGTTGLNFFNPPAAMAGYSGKG-------GISLAISKTSDVAA 361

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV-AGINTNVTLLEYAR 405
             S    GG+ + K   ++ +                   I+D V A    N+TL  +  
Sbjct: 362 ADSDPLTGGTGNNKSASSIAS-------------------IYDKVLATSGGNLTLEGFFN 402

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           + +G +  +  D+     +S  +   +     +  GV+L EEL+ L+K +++Y  + KLI
Sbjct: 403 SLVGKVGVSVQDATRRADQSGGILKQLDNLRESNSGVSLDEELANLVKYQKAYEGAAKLI 462

Query: 466 MFTDKMLQTLL 476
                M+ T+L
Sbjct: 463 NVGSDMMDTIL 473


>gi|291326355|ref|ZP_06124197.2| flagellar hook-associated protein FlgK [Providencia rettgeri DSM
           1131]
 gi|291314693|gb|EFE55146.1| flagellar hook-associated protein FlgK [Providencia rettgeri DSM
           1131]
          Length = 562

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 143/323 (44%), Gaps = 42/323 (13%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV------VTQRSEN 59
           V N A +  N A    + I  N+ NA    Y R+  +   +P  +T        T  S  
Sbjct: 20  VMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYFSHV 79

Query: 60  KNMFDKVLHAHSSAIGQQRLLQS-FEA-LKEMMSADDHYNNSP---THYISKLRDSLESY 114
           +  FD+ ++A  S   Q R     +EA +K     DD   N     +  I     +L++ 
Sbjct: 80  RREFDEFINAQYS---QSRARSGDYEAYVKNCNKVDDLLTNDIEDISSNIGSFFTALDAA 136

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S + S+  L    + N+  ++  F  + R +Q++  D + +IE ++ ++  +  ++  +N
Sbjct: 137 SSDASDKTLIDVFLGNSNALLGQFKEADRRLQEMERDINHQIENKVKDINIYAEKIAGLN 196

Query: 175 DAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY-------TSDGTT 226
             I + ++ S  + +D LD RD L+ +++ ++G+  I +N N  V +       T +   
Sbjct: 197 QQISRIRSVSGSEPNDLLDVRDRLVNEVNSLVGVKVIEQNGNYNVTFANGLPLVTGEKAN 256

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP-----KGKIKALLQIRDS 281
             E VP             +S+ +  F  G V ++ Q   +P      G++  +L+ R  
Sbjct: 257 RLEAVP-------------SSKDDSRFSIGFVGANGQAREIPDESFRGGELSGILRSRQE 303

Query: 282 VV-PIFQNQLDEMARVLIGSFSE 303
           V+ P +Q +L+++A V    F+E
Sbjct: 304 VMDPAYQ-KLNKLALVFATKFNE 325


>gi|167917171|ref|ZP_02504262.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           BCC215]
          Length = 667

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 126/272 (46%), Gaps = 28/272 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAARQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S++ G+  +V++N +  V+ S G  L   V  + +
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSKLSQLAGVQ-VVQSNGNYSVFLSGGQPL---VVGNAS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQG 264
           ++     TV S S+P    I   GV  S+  G
Sbjct: 240 YQLA---TVASPSDPSELTIVSKGVAGSAQPG 268


>gi|212709498|ref|ZP_03317626.1| hypothetical protein PROVALCAL_00540 [Providencia alcalifaciens DSM
           30120]
 gi|212687836|gb|EEB47364.1| hypothetical protein PROVALCAL_00540 [Providencia alcalifaciens DSM
           30120]
          Length = 546

 Score = 60.5 bits (145), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 148/318 (46%), Gaps = 32/318 (10%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV------VTQRSEN 59
           V N A +  N A    + I  N+ NA    Y R+  +   +P  +T        T  S  
Sbjct: 5   VMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYFSHV 64

Query: 60  KNMFDKVLHAHSSAIGQQRLLQS-FEA-LKEMMSADDHYNNS---PTHYISKLRDSLESY 114
           +  FD+ ++A  S   Q R     +EA +K     DD   N     +  I     +L+S 
Sbjct: 65  RREFDEFVNAQYS---QSRARSGDYEAYVKNCNKVDDLLTNDIEDLSGSIGSFFTALDSA 121

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S + S+  L    +  +  +V  F  + R++Q++  D +++IE ++ ++  +  ++  +N
Sbjct: 122 SSDASDKTLIDVFLGQSNALVSQFKEADRQLQEMERDINRQIENKVKDINIYAEKIAGLN 181

Query: 175 DAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
             I + ++ S  + +D LD RD L+ +++ +IG+  I +N N  V + ++G  L      
Sbjct: 182 QQIARVRSVSGSEPNDLLDVRDRLVNEVNSVIGVKVIEQNGNYNVTF-ANGLPL------ 234

Query: 234 DINFEKMNSYTV--TSESNPIFIDGVVVSSNQGSAVP-----KGKIKALLQIRDSVV-PI 285
            +  EK N      +S+ +  F  G V +++Q   +P      G++  +L+ R  V+ P 
Sbjct: 235 -VTGEKANRLEAMPSSKDDSRFSIGFVGANDQVREIPDEAFKGGELSGVLRSRQEVLDPA 293

Query: 286 FQNQLDEMARVLIGSFSE 303
           +Q +++++A V    F+E
Sbjct: 294 YQ-KINKLALVFATKFNE 310


>gi|254478858|ref|ZP_05092223.1| flagellar hook-associated protein FlgK [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035220|gb|EEB75929.1| flagellar hook-associated protein FlgK [Carboxydibrachium pacificum
           DSM 12653]
          Length = 484

 Score = 60.1 bits (144), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 103/484 (21%), Positives = 197/484 (40%), Gaps = 68/484 (14%)

Query: 27  NIENADNKNYVRRDT-MTTISP---------------ENVTVVTQRSENKNMFDKVLHAH 70
           NI NA+   Y R+   M +I+P               E V +V  R       D      
Sbjct: 27  NIANANTPGYTRQVVDMASIAPPTTFGMYDQWGKAIGEGVKIVDIRQIRDQFLDNQYRRE 86

Query: 71  SSAIGQQRLLQSFEALKEMMSADDHYNNSP-----THYISKLRDSLESYSKNLSEDILGK 125
           +  +G+      +E   E++SA ++  N P     T  ++   +SL+  SKN     +  
Sbjct: 87  NKFLGE------WETKAEVLSAIENIFNEPSSSGITAVLNDFFNSLQELSKNPESLTVRA 140

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            V + A  +V  FNT  + +     + +  I+  I+ +  +   ++ +N  I     S  
Sbjct: 141 EVRERAIALVDTFNTVYQHLYDKLNELNSTIQSRIAEINSYAERISRLNGEIYRFELSGQ 200

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-----DGTTLFETVPRDINFEKM 240
            A+D  DQR++L+ ++S+++ I+T    N +  +         GTT F T+  D N   +
Sbjct: 201 VANDLRDQRNLLVDQLSKLVNITTYEDANGNFRIDIGGQALVSGTTAF-TMSMDKNGNVI 259

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS-------VVPIFQNQLDEM 293
              T  S  NP                  G +K LL +RD         +P +  Q +++
Sbjct: 260 WDLT-KSPVNP----------------SSGVLKGLLDMRDGDGTNGVKGIPYYMEQWNKL 302

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A  +  S +E        +   G  + +G    D         TI      + + + L  
Sbjct: 303 AYNIAKSINEVHSQGYGLDGSTGNLLFEG---FDTSSTSTYDRTIPYAQLVKVSSAILAS 359

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD-PVAGINTNVTLLEYARNSIGWLE 412
            G +    +   K+ A  P       ++ N   + D PV G++   T  ++AR+ I  L 
Sbjct: 360 DGLLK---IAAAKDPAALP---GDNRNALNLIALRDIPVQGLD-KATFDDFARSLIANLG 412

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            +   ++ +    +++   I  +  +T GV+L EE++ ++K ++SY    ++I   D+++
Sbjct: 413 VDAEQANVMKKNQEIMVKQIDLNRQSTSGVSLDEEMTNMLKYQKSYAACARVITAMDELI 472

Query: 473 QTLL 476
            T++
Sbjct: 473 DTII 476


>gi|183598623|ref|ZP_02960116.1| hypothetical protein PROSTU_02024 [Providencia stuartii ATCC 25827]
 gi|188020803|gb|EDU58843.1| hypothetical protein PROSTU_02024 [Providencia stuartii ATCC 25827]
          Length = 559

 Score = 60.1 bits (144), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 144/336 (42%), Gaps = 42/336 (12%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV------VTQRSEN 59
           V N A +  N A    + I  N+ NA    Y R+  +   +P  +T        T  S  
Sbjct: 18  VMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYFSHV 77

Query: 60  KNMFDKVLHAHSSAIGQQRLLQS-FEAL-KEMMSADDHYNNSP---THYISKLRDSLESY 114
           +  FD+ ++      GQ R     +EA  K     DD   N     +  I     +L++ 
Sbjct: 78  RREFDEFINQQ---YGQSRARSGEYEAYAKNSSQVDDLLTNDIEDISSNIGSFFTALDAA 134

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S + S+  L    +  +  +V  F  + R +Q++  D +++IE ++ ++  +  ++  +N
Sbjct: 135 SSDASDKTLIDVFLGKSNALVGQFKEADRRLQEMERDVNRQIETKVKDINTYAEKIAGLN 194

Query: 175 DAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY-------TSDGTT 226
             I + ++ S  + +D LD RD L+ +I+ +IG+  I +N N  V +       T +   
Sbjct: 195 QQIARVRSVSGSEPNDLLDVRDRLVSEINSLIGVKVIEQNGNYNVTFANGLPLVTGENAN 254

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-----GSAVPKGKIKALLQIRDS 281
             E VP             +S+ +  F  G V ++ Q       A   G++  +L+ R  
Sbjct: 255 RLEAVP-------------SSQDDSRFSIGFVGANGQVREIADDAFRGGELSGVLRSRKE 301

Query: 282 VV-PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPG 316
           V+ P +Q +L+++A V    F+E      ++   PG
Sbjct: 302 VIDPAYQ-KLNKLALVFASKFNEVHKKGFDANGNPG 336


>gi|296103605|ref|YP_003613751.1| flagellar hook-associated protein 1 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058064|gb|ADF62802.1| flagellar hook-associated protein 1 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 545

 Score = 60.1 bits (144), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 83/176 (47%), Gaps = 9/176 (5%)

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQ 193
           +   FN SA+ +  +    + +IE    ++  +  +L  VN  ++    +     D LDQ
Sbjct: 140 LANRFNASAKRLTALEKSTNTQIEQSAKDINSYTQQLAEVNKQLERAQGNGAPPADLLDQ 199

Query: 194 RDVLLQKISEIIGISTIVRNNNDMV-VYTSDGTTLFETVPRDINFEKMNSYTVTSESNPI 252
           RD LL+K+SE IGI+         V V  SDG  L   V RD  + K+ +    ++ N  
Sbjct: 200 RDALLEKMSEHIGITVTEDKTTGRVDVLLSDGRPL---VSRDRAY-KLQTSPSDADPNKT 255

Query: 253 FIDGVVVSSNQG----SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
            +  V  + N      S++ KG++  L + R+  + I + +LD++A  +    +E+
Sbjct: 256 IVSYVDANENASPLDESSITKGRLGGLFKFRNEDLTIARQELDQIAFTMANRMNEQ 311


>gi|294501824|ref|YP_003565524.1| flagellar hook-associated protein FlgK [Bacillus megaterium QM
           B1551]
 gi|294351761|gb|ADE72090.1| flagellar hook-associated protein FlgK [Bacillus megaterium QM
           B1551]
          Length = 507

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 89/438 (20%), Positives = 180/438 (41%), Gaps = 76/438 (17%)

Query: 82  SFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQ 136
           + E ++E+M       N PT        ++  +S++  + + SE      +I+ AE V  
Sbjct: 101 ALEKMEEIM-------NEPTEDGLSAVFNQFFESIQDVASHPSEAGARSVMIERAEAVGD 153

Query: 137 NFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDV 196
            F+  +  ++ ++ D   E ++ ++ +   L +++ VN  I+    + +  +D  D+RD 
Sbjct: 154 TFSYLSTSLKTVQGDLQNERDVAVTQVNSLLEQISNVNQQIQNVEPNGYLPNDLYDERDR 213

Query: 197 LLQKISEIIGISTIVRNNNDMVVYTSDG--TTLFETVPRDINFEKMNSYTVTSESNPIFI 254
           LL +IS+ + +S     ++     TS+G  T   +T    I      ++ V + S     
Sbjct: 214 LLDEISKFMPVSLEYTKSSGNASATSEGVVTVQLQTSQGPITLLDGKTHQVNAISLKTNQ 273

Query: 255 DGVVVSSNQGSAV------PKGKIKALLQI---------RDSVVPIFQNQLDEMARVLIG 299
           D  V   + G  +      P+GK+K L++          +  V     + LDEMA   + 
Sbjct: 274 DSYVTEIHIGDEIRNPESFPQGKLKGLIEASGYIDNSGNKTGVYASMIDDLDEMAYEFVN 333

Query: 300 SFSEK----------------DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
            F++K                + I+       G+ IAD IK   N +    S +      
Sbjct: 334 WFNDKHQQGVTLDGDTGMSFFNEISQKEGAAAGIVIADKIKQNTNNIAAASSASSG---- 389

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPD--LINHYCDSFNKNFIFDPVAGINTNVTLL 401
                    D G+  K    N + L+ +    LIN    +                V+L 
Sbjct: 390 ---------DDGTGRKGDGQNAQLLSQFRQKVLINSGSQA----------------VSLD 424

Query: 402 EYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
            + ++ IG +  +   ++ L   S+ +   + +   +T  V+L EE++ +I+ + +YN S
Sbjct: 425 GFYQSVIGQMSVDAQQANRLKSNSETLQGAVEQRRQSTSAVSLDEEMTNMIQFQHAYNAS 484

Query: 462 NKLIMFTDKMLQTLLEGV 479
            +++   D+ML  ++ G+
Sbjct: 485 ARMVTMIDEMLDKIVNGL 502


>gi|317406195|gb|EFV86444.1| flagellar hook-associated protein FlgK [Achromobacter xylosoxidans
           C54]
          Length = 558

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 139/312 (44%), Gaps = 30/312 (9%)

Query: 16  NASQQ-FASIVRNIENADNKNYVRRDTMTTISPENVTV-----------VTQRSENKNMF 63
           NASQ   A+   NI NA    Y R+  M + +    T               RS +  ++
Sbjct: 12  NASQAGLATTGHNINNATTVGYNRQRVMISTAGAQATTNGYIGRGVQVDTVVRSYDSFLY 71

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP--THYISKLRDSLESYSKNLS-- 119
            +++ A  S    Q  L     +  +  AD     +P  T++ + + +++ S   + +  
Sbjct: 72  KQLVGAQGSGAQLQAQLDQVSQVNNLF-ADRTVGIAPGLTNFFTSM-NTVASKPADPAAR 129

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +D+LGK     A  +     ++ +E+Q  R   + +I   +  +  +L+ +  +N  I  
Sbjct: 130 QDLLGK-----ANSLTTQIRSAYQEMQNQRLGLNTQITTTVEQVNSYLTRINDLNSQIST 184

Query: 180 K--TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF--ETV-P-R 233
               A  +  +D LDQRD  + +++++IG++T  + +   +   S G  L   +TV P +
Sbjct: 185 ARAKAGGNPPNDLLDQRDQAVSELNQLIGVTTYEQGDKLSISLASGGQALLSGDTVYPLQ 244

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA-VPKGKIKALLQIRDSVVPIFQNQLDE 292
            ++  K  S TV + + P    G  V+     A V  GK+  LLQ R + +   Q QL +
Sbjct: 245 AVSSAKDVSRTVIAYTLPAGSGGKTVAVELNDAEVTGGKLGGLLQFRATSLDFMQAQLGQ 304

Query: 293 MARVLIGSFSEK 304
           MA  L  SF+E+
Sbjct: 305 MAVGLALSFNEQ 316


>gi|261344136|ref|ZP_05971780.1| flagellar hook-associated protein FlgK [Providencia rustigianii DSM
           4541]
 gi|282567728|gb|EFB73263.1| flagellar hook-associated protein FlgK [Providencia rustigianii DSM
           4541]
          Length = 547

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 147/322 (45%), Gaps = 40/322 (12%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV------VTQRSEN 59
           V N A +  N A    + I  N+ NA    Y R+  +   +P  +T        T  S  
Sbjct: 5   VMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYFSHV 64

Query: 60  KNMFDKVLHAHSSAIGQQRLLQS-FEA-LKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
           +  FD+ ++A  S   Q R     +EA +K     DD   N     +  L  S+ S+   
Sbjct: 65  RREFDEFVNAQYS---QSRARSGDYEAYVKNCNKVDDLLTND----VEDLSSSIGSFFTA 117

Query: 118 L---SEDILGKTVID----NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L   S D   KT+ID     +  +V  F  + R +Q++  D + +IE ++ ++  +  ++
Sbjct: 118 LDTASSDASDKTLIDVFLGQSNALVSQFKEADRRLQEMERDINHQIENKVKDINIYADKI 177

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I + ++ S  + +D LD RD L+ +++ +IG+  I +N N  V + ++G  L  
Sbjct: 178 AGLNQQIARIRSVSGSEPNDLLDVRDRLVNEVNSVIGVKVIEQNGNYNVTF-ANGLPL-- 234

Query: 230 TVPRDINFEKMNSYTV--TSESNPIFIDGVVVSSNQGSAVP-----KGKIKALLQIRDSV 282
                +  EK N      +S+ +  F  G V S+ Q   +P      G++  +L+ R  V
Sbjct: 235 -----VTGEKANRLEAVPSSKDDSRFSIGFVGSNGQVREIPDEAFKGGELSGVLRSRQEV 289

Query: 283 V-PIFQNQLDEMARVLIGSFSE 303
           + P +Q +++++A V    F+E
Sbjct: 290 IDPAYQ-KINKLALVFATKFNE 310


>gi|170751912|ref|YP_001758172.1| flagellar hook-associated protein FlgK [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658434|gb|ACB27489.1| flagellar hook-associated protein FlgK [Methylobacterium
           radiotolerans JCM 2831]
          Length = 627

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 126/299 (42%), Gaps = 35/299 (11%)

Query: 24  IVRNIENADNKNYVRRDTMTTIS--PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQ 81
           + +N+ NA    YV+R T++T++  P N  V     +    FD      ++A+ Q RL  
Sbjct: 23  VSQNVANAGTAGYVKR-TLSTVANGPNNSGVAI--GQITRSFD------AAALNQLRLET 73

Query: 82  SFEALKEMMSA-----DDHYN--NSPTHY---ISKLRDSLESYSKNLSEDILGKTVIDNA 131
           S  A     S      D  Y    S T     ++   +SL+  + N +      TV+ NA
Sbjct: 74  SGAAYTSTKSGIATQLDALYGVPGSSTSLDGTLNTFTESLQELAANPTSAAARTTVLGNA 133

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             V    N++A  VQ +R   + ++  + S     LS +  +N  I+  T S     D  
Sbjct: 134 SAVASLINSAAGTVQNLRTGLEAQLGTDTSAASTILSNIATLNGKIQNTTDSTA-LTDLQ 192

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV-PRDINFEKMN--SYTVTSE 248
           DQRD  +  +S  + + T+ + +  + V T  G TL +      ++F+         T  
Sbjct: 193 DQRDQAINSLSSYMDVQTVPQRDGTVSVMTQSGVTLVDRGNAATLSFDGRGVLGPNATYS 252

Query: 249 SNPI-FIDGVVVSSNQGS-----AVP----KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           ++P     G + ++  G        P     G + A +++RD  +P  Q QLD++A  L
Sbjct: 253 TDPAQRTVGTITATLPGGGKIDLGAPGVLRSGSLAAEIEMRDQTLPQAQRQLDDLAAGL 311


>gi|118581855|ref|YP_903105.1| flagellar hook-associated protein FlgK [Pelobacter propionicus DSM
           2379]
 gi|118504565|gb|ABL01048.1| flagellar hook-associated protein FlgK [Pelobacter propionicus DSM
           2379]
          Length = 456

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 128/291 (43%), Gaps = 23/291 (7%)

Query: 26  RNIENADNKNYVRRDTMTTISP----------ENVTVVTQRSENKNMFDKVLHAHSSAIG 75
            NI N + + Y R+  +   SP            V + T      ++  + L   +SA G
Sbjct: 26  ENIANVNTEGYSRQRVILETSPPTTHNGFPLGTGVKISTVERYYDSLLQQQLVTANSASG 85

Query: 76  QQRLLQSFEALKEMM-SADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
              L    E L+++  S ++  N+     I+    + E  S N S     + ++  A+ +
Sbjct: 86  YDTLCS--EVLQQIEPSFNELTNDGIGSAITNYFQAWEDLSTNASGTTERQVLLSQAQVL 143

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
           V++FN+ +  +       D  +    +++   L+ +  +N  IK       +A++  DQR
Sbjct: 144 VESFNSVSTTLTDTIKAQDSSLTALTADINNKLTNIATLNAQIKQTELVSGNANEMRDQR 203

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV--TSESNPI 252
           D+L+++++E +GI      +    VY  D T     +   +   +  S TV  TS +  +
Sbjct: 204 DLLVKQLAEQMGIKYTENADGTTDVYVQDSTPATYYL---VQGNQAGSLTVGGTSPARTV 260

Query: 253 FIDGV-----VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            ID V      V S   +A   G + A LQ+RD ++P + +QLD++A  +I
Sbjct: 261 TIDSVSGATKTVDSTLYTAQDGGTLWATLQLRDVIIPDYIDQLDDLASTII 311


>gi|302037635|ref|YP_003797957.1| first flagellar hook-filament junction protein FlgK [Candidatus
           Nitrospira defluvii]
 gi|300605699|emb|CBK42032.1| First flagellar hook-filament junction protein FlgK [Candidatus
           Nitrospira defluvii]
          Length = 464

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 103/495 (20%), Positives = 202/495 (40%), Gaps = 71/495 (14%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD-TMTTISPEN---------VTVV 53
           LA F +A ++            +NI N     Y R++ T++   PEN         VT  
Sbjct: 15  LATFQRALSVTG----------QNIANVSTPGYSRQEITLSESLPENGQPGQIGTGVTAT 64

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEM-MSADDHYNNSPTHYISKLRDSLE 112
             R    +  ++ L + +  +GQ     S +AL ++ +  +D  +      +++   + +
Sbjct: 65  EIRRSVDSFVEQQLLSSNERVGQ--FGASHKALSQIQLVFNDANDQGIAAGLNEFFKAWQ 122

Query: 113 SYSKNLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
             + N   D+  +TV+   A+ + +  N +  ++   R   D +++  I+++    S++ 
Sbjct: 123 DVATN-PADLTARTVLLTKADGLTKLLNQADAQLSAQRTSLDGQVQSGINDVNALASKIA 181

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N  IK    S   A+D  DQR   L  ++ ++ IS+I      + V+   G  L    
Sbjct: 182 DLNSQIKLTEISGQQANDLRDQRGRFLNDLAGLVDISSIEDATGQVTVFVGIGQVLVA-- 239

Query: 232 PRDINFEKMNSYTVTSESNPI--------FIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
                 EK  +Y +T  +N          +  G   +++  SA+  G++K L+  RD+  
Sbjct: 240 ------EK-TAYRLTGVANIANNGLLDVRYDGGTGPNTDITSAISGGRLKGLIDARDTTA 292

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE-TICVNP 342
              Q  L+ +   L+   + +  +          +  DG    D     G +  TI +  
Sbjct: 293 AGLQTSLNTLTAQLVSQVNTQHRLG---------YGLDGSTTQDFFTASGTTAGTISM-- 341

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
                   L D     ++ +      AG P   N+       N     VAG+  N T   
Sbjct: 342 -------ALTD-----RQKIAASSTAAGVPG--NNVNALALSNLQTASVAGLG-NTTFQG 386

Query: 403 YARNSIGWLEKN-RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
           Y     G      +  + DL  + +++ + +    +   GV++ EEL  L+K ++++  +
Sbjct: 387 YYSAMAGSFGGTLQGATRDLQGQ-EILHDQLLAHRAEVSGVSMDEELINLLKYQRAFEAA 445

Query: 462 NKLIMFTDKMLQTLL 476
           +KLI  +D+MLQT+L
Sbjct: 446 SKLITTSDEMLQTIL 460


>gi|288960285|ref|YP_003450625.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
 gi|288912593|dbj|BAI74081.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
          Length = 469

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/506 (18%), Positives = 199/506 (39%), Gaps = 73/506 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--SPENVTVVTQRSE 58
           MSL A  N A             +  NI  A++ N  R     ++  S + ++   +R  
Sbjct: 1   MSLFAALNSATAGLRTVQTSVKLVSDNIAQANDPNRTRHTAQQSVDASGQVISTTYRREV 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP--THYISKLRDSLESYSK 116
           +  +  +V+   +   G Q      + L ++M      N +P    Y +K + ++++ S 
Sbjct: 61  DTALMGQVMDLTARDGGSQVTSTYMQQLGDLMRT---TNGTPLINDYANKFQAAIKTLST 117

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN-D 175
           +  ++     ++  AE   +     +  V+++  +   +I   +  +   L ++  +N D
Sbjct: 118 SPEDETAQYQLVQTAESFSREIRRVSEGVEQLDRNIKDDIGTSVDKVNDLLKQINQINND 177

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
           ++  +      A+   D+RD L++++S  +GI T+ R +  + ++T  G  L +    ++
Sbjct: 178 SVSLQ-GQGSAANAVADKRDGLVRELSGYMGIRTVERPDGRLAIFTPSGLALVDGQQANL 236

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD--------------- 280
            ++  N          + +   V S N   A   GK+ AL+Q+R                
Sbjct: 237 TYDGGNIN--------LQVGNQVTSINNHLAT--GKLGALIQMRKDGSTTEPPTPASGDP 286

Query: 281 --SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD--------NKL 330
              ++   ++QLDE A+   G     +P +           AD   D          N+ 
Sbjct: 287 TTEIIRKLRSQLDEYAKAFTGPTKPGEPTS----------FADAYDDASPAAAGEQPNQF 336

Query: 331 CQGISE-TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD 389
             G    TI +NP+   N + ++                +   D++    ++  ++F  D
Sbjct: 337 FTGNDRFTIAINPKLLDNTNKIKQ---------------SAIDDMVTA-INAPGRSFSAD 380

Query: 390 PVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELS 449
            +   +T  + +  A     W+   ++ S      ++     +SE Y +  GVN+ EE++
Sbjct: 381 GLQMKDTTYSAMGSAITGT-WMAAAKTAST-TSESNKASMQLLSERYQSQTGVNIDEEIA 438

Query: 450 FLIKVEQSYNISNKLIMFTDKMLQTL 475
            L +++ SY  S +++   + M   L
Sbjct: 439 QLQQLQTSYQASARVMQVANSMFDAL 464


>gi|291280513|ref|YP_003497348.1| flagellar hook-associated protein 1 FlgK [Deferribacter
           desulfuricans SSM1]
 gi|290755215|dbj|BAI81592.1| flagellar hook-associated protein 1 FlgK [Deferribacter
           desulfuricans SSM1]
          Length = 584

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 87/181 (48%), Gaps = 16/181 (8%)

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASK 184
           T+I+ +E ++Q  +   + ++++R  +D+ I+  +  +      +   N  I K +T   
Sbjct: 142 TLIEKSETLIQKIHDGYQSIEEVRNRSDENIKEYVKEINDLAENIAYYNFQIAKTETGGD 201

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-----DGTTL--FETVPRDINF 237
           H A+D  D+R++LL K+SE++ I T  R +  M V+       DG+T      V  D N 
Sbjct: 202 H-ANDMRDKRELLLNKMSELVNIKTFEREDGQMSVFIGGIAIVDGSTANSLYAVENDEND 260

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              + Y          ID   V  N    +  G++ A L+ RD V+  +QN LDE A+ L
Sbjct: 261 GHYDIYW-----GAHLIDKAQV--NITDKISSGRMYAELKARDDVLKGYQNTLDEFAKNL 313

Query: 298 I 298
           I
Sbjct: 314 I 314


>gi|302382561|ref|YP_003818384.1| flagellar hook-associated protein FlgK [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193189|gb|ADL00761.1| flagellar hook-associated protein FlgK [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 707

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 128/303 (42%), Gaps = 14/303 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           MSL ++ N A +    A QQ   +  N+ N +   YVR+    T+++ + V    + +  
Sbjct: 1   MSLNSILNIANSGLQAAQQQLRVVSDNVSNVNTPGYVRKIAEQTSLTTQGVGSGVEVTRI 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQS--FEALKEMMSA-DDHYNNSPTHYISKLRDSLESYSK 116
           +   D+ L A S + G +   Q   +E    + S   D   +S   + S++ +   S++ 
Sbjct: 61  RLATDRFLQAASLSAGAEAARQGVRYELYDRIQSLFGDPGGDS--GFFSQIDEVFSSFAA 118

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAR---EVQKIRADADKEIELEISNLRRFLSELTVV 173
           +  +   G    D   +    F+ + R   ++Q +R DAD  I+  I      L ++  +
Sbjct: 119 SAEDPTSGPRRQDALFKAQAVFDEATRISGQIQAVREDADGRIQSAIEKANGLLQQIETL 178

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I   T    DA     Q+  L+ ++S ++ +    R+   + + T  G  L      
Sbjct: 179 NTDIARATVLNGDASGAQTQQARLVDELSTLLDVQVTQRSVGGVSIRTGAGIQLAGNGAA 238

Query: 234 DINFEKMNSYTVTSESNPIFI---DGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            + + +  +    +  N I++    G   +   G  +  G+IK LL++RD+  P    +L
Sbjct: 239 TLEYHRAGTVNAETSFNDIYVTEKGGTPRALADG--LKSGEIKGLLELRDNEAPATAERL 296

Query: 291 DEM 293
            E+
Sbjct: 297 AEL 299



 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%)

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           YA    G +    + +      +Q +        SN  GVNL EEL  +   +Q++N S 
Sbjct: 630 YASELSGEIGGTAASAKTRQQSAQALATEADARQSNYEGVNLDEELVLMTTYQQAFNASA 689

Query: 463 KLIMFTDKMLQTLLEGVK 480
           +LI     M  TLL  V+
Sbjct: 690 RLIQAAQDMYDTLLGMVR 707


>gi|167579496|ref|ZP_02372370.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           TXDOH]
          Length = 667

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/273 (20%), Positives = 125/273 (45%), Gaps = 28/273 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S+  G+  +V  N    V+ + G  L   V  + +
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSKLSQFAGVQ-VVPTNGSYSVFLAGGQPL---VVGNAS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQGS 265
           ++      V S+S+P    I  +GV  ++ QGS
Sbjct: 240 YQLA---AVASKSDPSELTIVSNGVAGANPQGS 269


>gi|83720978|ref|YP_440808.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           E264]
 gi|167617593|ref|ZP_02386224.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           Bt4]
 gi|257140541|ref|ZP_05588803.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           E264]
 gi|83654803|gb|ABC38866.1| flagellar hook-associated protein 1 [Burkholderia thailandensis
           E264]
          Length = 667

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/273 (20%), Positives = 125/273 (45%), Gaps = 28/273 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y     +    P+ V+ VT +R  N+
Sbjct: 16  ALWGLTTTGQNISNAATPGY-SVERPVYAEASGQYTSSGYL----PQGVSTVTVERQYNQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + +++  A +    Q   L ++  L   +   ++Y  SPT      I+     L++ + 
Sbjct: 71  YLSNQLNAAQT----QGSSLSTYYTLVAQL---NNYVGSPTAGIATAITNYFTGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N ++    +T + NA+ +      + ++  ++R   + ++   ++ +  + S++  +N+ 
Sbjct: 124 NAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTSQIAQLNEQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   ++     +  LDQRD+ + K+S+  G+  +V  N    V+ + G  L   V  + +
Sbjct: 184 IASASSQGQPPNQLLDQRDLAVSKLSQFAGVQ-VVPTNGSYSVFLAGGQPL---VVGNAS 239

Query: 237 FEKMNSYTVTSESNP----IFIDGVVVSSNQGS 265
           ++      V S+S+P    I  +GV  ++ QGS
Sbjct: 240 YQLA---AVASKSDPSELTIVSNGVAGANPQGS 269


>gi|163856441|ref|YP_001630739.1| flagellar hook-associated protein FlgK [Bordetella petrii DSM
           12804]
 gi|163260169|emb|CAP42471.1| flagellar hook-associated protein 1 [Bordetella petrii]
          Length = 549

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 134/326 (41%), Gaps = 61/326 (18%)

Query: 16  NASQQFASIV-RNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAI 74
           NASQ    +   NI NA N  Y R+  +T+ +    T        +  F + +   +   
Sbjct: 12  NASQAGMEVTSHNINNAANAGYSRQRLVTSTAGATET-------GQGFFGRGVQVDTV-- 62

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHY--ISKLRD-----------SLESYSKNLS-- 119
             +R   SF   ++M+ A        THY  +S++ +           +LE++  +L+  
Sbjct: 63  --KRQYDSF-LYRQMVGAQGTGAQLATHYDQVSQINNLFGDRTVGITPALENFFASLNAG 119

Query: 120 ----------EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
                     +DILGKT       +V   NT+ RE+Q +R   + +I   +  +  +L  
Sbjct: 120 ASNPADPAVRQDILGKT-----NSLVTQINTAYRELQNLREGVNTQISTTVEQVNSYLER 174

Query: 170 LTVVNDAIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +  +N  I      S H  +D LDQRD  L ++++++G+    + N+  +   S  T L 
Sbjct: 175 INDLNKQIVVAQGKSGHAPNDLLDQRDQALSELNQLVGVRYYEQGNSLNITLQSGQTLLS 234

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFID-GVVVSSNQGSAV---------PKGKIKALLQI 278
            T    +         V S S+P  +     + +  GS V           GK+   LQ 
Sbjct: 235 GTTVYPL-------AAVQSASDPTRMALAYSLPAGSGSTVQVELSDSEISGGKLAGFLQF 287

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSEK 304
           R   +   Q+QL ++A  L  +F+ +
Sbjct: 288 RSQSLDAVQDQLGQLAIGLALAFNAQ 313


>gi|271500072|ref|YP_003333097.1| flagellar hook-associated protein FlgK [Dickeya dadantii Ech586]
 gi|270343627|gb|ACZ76392.1| flagellar hook-associated protein FlgK [Dickeya dadantii Ech586]
          Length = 638

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 103/202 (50%), Gaps = 14/202 (6%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N S+  + +TV+  A  +V  F  + + ++ + ++ + E+ + ++ +  +  ++
Sbjct: 117 LQNLTSNSSDSSVRQTVLGKANALVNQFKITDQYLRDMDSNINGELSVTVTQINTYAQQI 176

Query: 171 TVVNDAI-KFKTASKHDA-HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +ND I + K A+   A +D LDQRD L+  +++++G+   V++ N   V   +G TL 
Sbjct: 177 ADINDQIVRLKGANNGAAPNDLLDQRDSLVDSLNKLVGVDVAVQDGNMYNVSLKNGLTLV 236

Query: 229 ETVPRDINFEKMNSYTVTSESNPI-----FIDGVV-VSSNQGSAVPKGKIKALLQIRDSV 282
           +      +F  +     TS ++P      + D +  VS  + S +  G +  LL  R S 
Sbjct: 237 Q----GKSFNTL--VATTSSTDPTRTTIAYNDAIAGVSEVKESTITGGSLGGLLNFRTST 290

Query: 283 VPIFQNQLDEMARVLIGSFSEK 304
           +   +NQL +MA     +F+++
Sbjct: 291 LDSARNQLGQMALAFSDAFNQQ 312


>gi|295707173|ref|YP_003600248.1| flagellar hook-associated protein FlgK [Bacillus megaterium DSM
           319]
 gi|294804832|gb|ADF41898.1| flagellar hook-associated protein FlgK [Bacillus megaterium DSM
           319]
          Length = 507

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/428 (19%), Positives = 181/428 (42%), Gaps = 56/428 (13%)

Query: 82  SFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQ 136
           + E ++E+M       N PT        ++  +S++  + + SE      +I+ AE V  
Sbjct: 101 ALEKMEEIM-------NEPTEDGLSAVFNQFFESIQDVASHPSESGARSVMIERAEAVGD 153

Query: 137 NFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDV 196
            F+  +  ++ ++ D   E ++ ++ +   L +++ VN  I+    + +  +D  D+RD 
Sbjct: 154 TFSYLSTSLKTVQGDLQNERDVAVTQVNSLLEQISNVNQQIQNIEPNGYLPNDLYDERDR 213

Query: 197 LLQKISEIIGISTIVRNNNDMVVYTSDG--TTLFETVPRDINFEKMNSYTVTSESNPIFI 254
           LL +IS+ + +S     ++     TS+G  T   +T    I      ++ V + S     
Sbjct: 214 LLDEISKFMPVSLEYTKSSGNASATSEGVVTVQLQTSQGAITLLDGKTHQVNAISLKTNQ 273

Query: 255 DGVVVSSNQGSAV------PKGKIKALLQI---------RDSVVPIFQNQLDEMARVLIG 299
           D  V   + G  +      P+GK+K L++          +  V     + LDEMA   + 
Sbjct: 274 DSYVTEIHIGDEIRNPESFPQGKLKGLIEASGYIDNSGNKTGVYASMIDDLDEMAYEFVN 333

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR------- 352
            F++K       +   G+   + I        +G +  I +  + + N + +        
Sbjct: 334 WFNDKHQQGVTLDGDTGMSFFNEISQ-----KEGAATGIVIANKIKHNTNNIAAASSASS 388

Query: 353 -DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
            D G+  K    N + L+            F +  + +     N  V+L  + ++ IG +
Sbjct: 389 GDNGTGRKGDGKNAQLLS-----------QFRQQVLINSG---NQAVSLDGFYQSVIGQM 434

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
             +   ++ L   S+ +   + +   +T  V+L EE++ +I+ + +YN S +++   D+M
Sbjct: 435 SVDAQQANRLKSNSETLQGAVEQRRQSTSAVSLDEEMTNMIQFQHAYNASARMVTMIDEM 494

Query: 472 LQTLLEGV 479
           L  ++ G+
Sbjct: 495 LDKIVNGL 502


>gi|220927554|ref|YP_002504463.1| flagellar hook-associated protein FlgK [Clostridium cellulolyticum
           H10]
 gi|219997882|gb|ACL74483.1| flagellar hook-associated protein FlgK [Clostridium cellulolyticum
           H10]
          Length = 537

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 88/425 (20%), Positives = 181/425 (42%), Gaps = 71/425 (16%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           DSL+  SK+ S       V+  A  + + FN +A   ++ + D + +++ ++  +    S
Sbjct: 121 DSLQELSKDPSSGAARALVVQKATTLAKYFNNTATHFEQFQNDINDQVKTDVDQINIIAS 180

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI------VRNNNDMVVY-- 220
           ++ ++N  I     +   A+D  D R +L+ ++S++  I         + N  D + +  
Sbjct: 181 QIQLLNKQIYNYELTGGTANDLRDSRTLLVDQLSKLANIQAKEIPYGKLPNGEDDIHFQI 240

Query: 221 TSDGTTLFE--------TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T  G TL +         V R+I   K+N   + +  +  + DG  V+      +  G++
Sbjct: 241 TLSGKTLVDHFSATKLIVVQRNI---KLNEEDIGNLYDIKWEDGNSVN------ITGGEL 291

Query: 273 KALLQIRDS-----------VVPIFQNQLDEMARVLIGSFSEKDPIAGNSEN--VPGLFI 319
           + LL +RD             VP +Q +L+E  R    +F+E     G + N  +P  + 
Sbjct: 292 RGLLDVRDGKDGIDGTPIYKGVPYYQRKLNEFVRTFAINFNE-----GYTRNDALPDGYE 346

Query: 320 ADGIKDL-----DNKLCQ---GIS--ETICVNPQYRSNPSFLRDG---GSVSKKF-LWNV 365
            +G+  +     D+ L     GI     +CV     S  +F+      G ++ ++     
Sbjct: 347 HNGVGHIEGYGYDSDLTDAPTGIRFFTMLCVGDTPISGSAFIGTATSVGDIANQYNQITA 406

Query: 366 KNLAGYPDLINHY-------CDSFNKNF-IFDPVAGINTNVTLL------EYARNSIGWL 411
           KN +   D+I+          D  N N  I   + GI +N +L       ++ ++ +  +
Sbjct: 407 KNFSVSSDIIDDANRIATSDADGQNGNTNILKKLMGIRSNQSLFKEGAPEDFMKSLVAGM 466

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
             +   +       + +   +     +  GVNL EE++ ++K +QSYN + ++I+   ++
Sbjct: 467 GIDAQQAETFAKTQKALVRQVDNRRMSVSGVNLNEEMTNMVKFQQSYNAAARMIVTMGEI 526

Query: 472 LQTLL 476
             TL+
Sbjct: 527 YDTLI 531


>gi|148266109|ref|YP_001232815.1| flagellar hook-associated protein FlgK [Geobacter uraniireducens
           Rf4]
 gi|146399609|gb|ABQ28242.1| flagellar hook-associated protein FlgK [Geobacter uraniireducens
           Rf4]
          Length = 478

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 95/184 (51%), Gaps = 17/184 (9%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V+   +++V NF+     +  +++D +K +E ++S++   L+++  +N  IK      
Sbjct: 134 QAVLSQGQQLVDNFHRINSNLNDVKSDMNKSLEGQVSDINDTLNQIATLNLQIKQIEVQS 193

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
             A++  D+RD+LL+++S+ +GIS + + +  + V  + G +L   V +D     +    
Sbjct: 194 GPANEMRDKRDLLLRQLSQKVGISFVEQPDGMVDVSLTSGQSLV--VGKDAAALSL---- 247

Query: 245 VTSESNPIFIDGVVVSSNQGSAV-----------PKGKIKALLQIRDSVVPIFQNQLDEM 293
           + + +N  F D ++     G AV            +G+I   L +RD++V  + ++LDE+
Sbjct: 248 LPNAANSGFYDILLTPPGGGPAVNATAFIGGPGNTQGEIGGALLVRDTMVNNYLSELDEL 307

Query: 294 ARVL 297
           A  L
Sbjct: 308 ASTL 311


>gi|307131603|ref|YP_003883619.1| flagellar hook-associated protein flgK [Dickeya dadantii 3937]
 gi|306529132|gb|ADM99062.1| Flagellar hook-associated protein flgK [Dickeya dadantii 3937]
          Length = 640

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 101/197 (51%), Gaps = 4/197 (2%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N S+  + +TV+  AE +V  F  + + ++ + ++ + EI + ++ +  +  ++
Sbjct: 117 LQNLTSNSSDSSVRQTVLGKAEALVNQFKIADQYLRDMDSNINGEISITVTQVNTYAKQI 176

Query: 171 TVVNDAI-KFKTASKHDA-HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +ND I + K A+   A +D LDQRD L+  +++++G+   V++ +   V   +G TL 
Sbjct: 177 ADINDQIVRLKGANNGAAPNDLLDQRDNLVNDLNKLVGVDVAVQDGDVYNVSLKNGLTLV 236

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN-QGSAVPKGKIKALLQIRDSVVPIFQ 287
           +    +       S T  + +   + D +  +S  + S +  G +  LL  R S +   +
Sbjct: 237 QGKSYNT-LVATQSSTDPTRTTVSYNDAIAGASEVKESTITGGSLGGLLSFRTSTLDSAR 295

Query: 288 NQLDEMARVLIGSFSEK 304
           NQL +MA     +F+++
Sbjct: 296 NQLGQMALAFADAFNQQ 312


>gi|225849064|ref|YP_002729228.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644050|gb|ACN99100.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 483

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 107/505 (21%), Positives = 216/505 (42%), Gaps = 55/505 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSLL + + A        +   S  +NI NA  + Y R   +    P +   + +     
Sbjct: 1   MSLLGILSTAGQSLLTFQRGINSTNKNISNATTEGYNREVPVFQDFPRSGVFMNKIIR-- 58

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMS-ADDHYNNS-PTHYISKLRDSLESYSKNL 118
            +FD+ L   S  + QQ  L S  +  E++S  +  +N++  + + S L +   S +  L
Sbjct: 59  -VFDRSLFNRSIELNQQ--LNSDNSFSEILSNIETMFNDTLGSGFSSDLNNFFNSINDML 115

Query: 119 --SEDILGKT-VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
              +DI  ++  + NA+ +V    +    +   + D   ++  ++  + +   +L  +N 
Sbjct: 116 IKPDDIAARSQFLANAQTLVGKIRSINDSLDNQKQDITLKVRDQVKQINQITDQLAKLNQ 175

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL---FETVP 232
            IK KT      +++L++RD L++++S++I    +   +N + V+T+ G  L    ++ P
Sbjct: 176 TIKTKTLDIEANNEYLNERDRLIKQLSDLIDTKVVFNEDNTVNVFTAKGYGLVVGIQSTP 235

Query: 233 RDINFEKMNSYTVTSESNPIF-IDGVV-VSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                    S+   +  NP+   +GV  +++   +    G +K +  I D +     N+L
Sbjct: 236 L--------SFETDTNGNPVVKWNGVADITTEIQNGQLGGNLKGIKSINDQL-----NKL 282

Query: 291 DEMARVLIGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ---YR 345
           ++   V    F++  K     +       F  D  K         I   I  +P+     
Sbjct: 283 NDFTTVFATVFNKVHKKGYGLDGSTNLDFFTIDPSKSSTKIDASNIYLNIT-DPKKVALA 341

Query: 346 SNPSFLRDGGSVSKKFLW---NVKNLAGYPD-----------LINHYCDSFNKNFIFDPV 391
            N ++L    +  K  L    N++ L   P            L +   DS N  +I D  
Sbjct: 342 QNSTYLNSDNTNGKDLLGLKNNIRVLYTNPSQPVLTPAEEAALQSSLNDSTNYTYIKDHT 401

Query: 392 AGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFL 451
                N  L+    ++  ++++ + +       ++ +++ I+E   N  GVN+ EEL  L
Sbjct: 402 FAEFYNTKLVADISSTSSYIKQQQQN-------NKYLYDAITEKMKNIAGVNMDEELINL 454

Query: 452 IKVEQSYNISNKLIMFTDKMLQTLL 476
            K+++SY  S ++I  TD+++QT+L
Sbjct: 455 SKLQRSYQASARIITVTDELMQTIL 479


>gi|251789174|ref|YP_003003895.1| flagellar hook-associated protein FlgK [Dickeya zeae Ech1591]
 gi|247537795|gb|ACT06416.1| flagellar hook-associated protein FlgK [Dickeya zeae Ech1591]
          Length = 640

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 108/214 (50%), Gaps = 14/214 (6%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N S+  + +TV+  A  +V  F  + + ++ +  + + EI + +S +  +  ++
Sbjct: 117 LQNLTSNSSDSSVRQTVLGKASALVNQFKITDQYLRDMDTNINGEISVTVSQINTYAKQI 176

Query: 171 TVVNDAI-KFKTASKHDA-HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +ND I + K A+   + +D LDQRD L+  +++++GI   V++ +   +   +G TL 
Sbjct: 177 ADINDQIVRLKGANNGASPNDLLDQRDNLVNDLNKLVGIDVAVQDGDVYNISLKNGLTLV 236

Query: 229 ETVPRDINFEKMNSYTVTSESNPI-----FIDGVV-VSSNQGSAVPKGKIKALLQIRDSV 282
           +      NF  + +    S ++P      + D +  +S  + SA+  G +  LL  R S 
Sbjct: 237 Q----GKNFNTLAA--TPSSTDPTRTTVSYNDTIAGLSEVKESAITGGSLGGLLNFRTST 290

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPG 316
           +   +NQL +MA     +F+++  +  +  NV G
Sbjct: 291 LDSARNQLGQMALSFADAFNQQHKLGFDLNNVQG 324


>gi|148256817|ref|YP_001241402.1| putative flagellar hook-associated protein FlgK [Bradyrhizobium sp.
           BTAi1]
 gi|146408990|gb|ABQ37496.1| putative flagellar hook-associated protein 1 (HAP1, FlgK protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 611

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 105/238 (44%), Gaps = 27/238 (11%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L+S S N S        +  A+ + Q  N + + +Q +R++ +++I   ++     +S+
Sbjct: 105 ALQSLSNNPSNQSAQSVAMSAAQGLAQQLNATTKGIQTLRSNVEQDIGNSVTQANAAISQ 164

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N  ++    S   +    DQRD  +  +S+ + I  +   +N + V+T+ G  L  
Sbjct: 165 IATLNTQLQGLNTSDPLSATLQDQRDNAINTLSKYVDIRVVSDGSNGVSVFTNSGVQLVG 224

Query: 230 T-VPRDINFEKMNSYTVTSE--SNPI----------FIDGV---VVSSNQGSAVPKGKIK 273
             +     F    +   TS+  SNP             +GV   VVS+N    +  G+I 
Sbjct: 225 AGLSSQFTFSSPGTLDATSQYNSNPTKSGVGQLNIKLSNGVSLDVVSNN---LLNSGQIA 281

Query: 274 ALLQIRDSVVPIFQNQLDEMARVLIGSFSEK--------DPIAGNSENVPGLFIADGI 323
           A L++RD  +   Q Q+D++A  +  + S+K         P AG   +  GL   + I
Sbjct: 282 ADLKLRDQTLVQAQTQVDQLAATMASALSDKTTAGTAVAGPPAGFDVSTTGLLAGNTI 339



 Score = 44.7 bits (104), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 70/153 (45%), Gaps = 17/153 (11%)

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAG---YPDLINHYCDSFNKNFIFD 389
           G++  + VNP   ++P+ L         +  + +  AG    PD +  +    +  F + 
Sbjct: 465 GLAGRLNVNPALLNDPTKL-------STYSTSPQTAAGDSTRPDFL--FAQLTSATFTYS 515

Query: 390 PVAGINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
           P  G+ +       T+  Y +  +       + +  L     VV + + E +++T GVN+
Sbjct: 516 PKTGLGSAAQPFQGTVSGYLQQVVSQQGSASTLATQLSQGQSVVVSTLKEKFNSTAGVNM 575

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
             E+S LI+V+ +Y+ +  ++     M+Q+LL+
Sbjct: 576 DSEMSNLIQVQNTYSANAHIMSVVQSMMQSLLQ 608


>gi|251799725|ref|YP_003014456.1| flagellar hook-associated protein FlgK [Paenibacillus sp. JDR-2]
 gi|247547351|gb|ACT04370.1| flagellar hook-associated protein FlgK [Paenibacillus sp. JDR-2]
          Length = 518

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 165/415 (39%), Gaps = 67/415 (16%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTV-IDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
           IS   +S    SK   E   G+ V ++  + ++  FN +++++  +++D  +  ++ + N
Sbjct: 121 ISNFWNSWSDLSKT-PESADGRAVLVEQTKAMMDAFNYTSKQLADLKSDLTENAQINLDN 179

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           L+   S +  +N  I+       DA+D  DQRD L+ ++S +  I          V   S
Sbjct: 180 LKSISSTIANLNGQIQRIEGIGDDANDLRDQRDALVDELSGLANIK---------VSDLS 230

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
           DG T+      +++     S      S  + +D +  +   G  +  G I   +Q RD  
Sbjct: 231 DGYTI---TMGNVSLVAGKS---AEGSQGLTLDDMTAAIENGD-LNNGAIYGTMQSRDKY 283

Query: 283 VPIFQNQLDEMARVL----IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC---QGI- 334
           V  + +QL++MA  +    I     K  +      + G+  A   + L   L    QG+ 
Sbjct: 284 VQGYMDQLNQMANTIANGDIQVTIPKGSVLPEGTVLNGVTYAGANRTLAEDLTVTVQGLN 343

Query: 335 -----------------------------SETICVNPQYRSNPSFLRDGGSVSKKFLWNV 365
                                        +  I +NP+  ++P+ L    + S K  +N 
Sbjct: 344 GLHQLGYTMNGEQGEPLFTDANGNTDNLTAANIQLNPKIAADPTLL----ATSMKVTFND 399

Query: 366 KN----LAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDL 421
                 +AG   +      + +  F FD       N T+  + R  +G L     +   L
Sbjct: 400 DGTETVVAGNNSMAVLMSQARDTKFAFDAT----DNNTISGFFRAVVGQLGVQSKEMQRL 455

Query: 422 HMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
               Q + + +     +  GV+L EE+S L+K + +YN S +++   D+ L  ++
Sbjct: 456 QTNQQTIVDQVDSRRMSVSGVSLDEEMSDLVKFQHAYNASARVMTVIDETLDRII 510


>gi|326389602|ref|ZP_08211168.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994317|gb|EGD52743.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 482

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 106/494 (21%), Positives = 202/494 (40%), Gaps = 90/494 (18%)

Query: 27  NIENADNKNYVRRDT-MTTISP---------------ENVTVVTQRSENKNMFDKVLHAH 70
           NI NA+   Y R+   M +I+P               E V +   R       D      
Sbjct: 27  NIANANTPGYTRQVVDMASIAPPTTFGMYDQWGKAIGEGVKIQDIRQIRDQFLDNQFRRE 86

Query: 71  SSAIGQQRLLQSFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGK 125
           +  +G+      +E   ++++A +   N P+       ++   +SL+  SKN     +  
Sbjct: 87  NKFLGE------WETKAQVLAAVEDIFNEPSDSGINTVLNDFFNSLQELSKNPESLTVRA 140

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            V + A  +   FNT  + +     + +  I+  IS +  +   ++ +N+ I     +  
Sbjct: 141 EVRERAIALADTFNTVYQHLYDKLNELNSTIQSRISEINSYADRISKLNNEIYRFELTGQ 200

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-----DGTTLFETVPRDINFEKM 240
            A+D  DQR++L+ ++S+++ I+T   +N +  +  +     DG+T F            
Sbjct: 201 TANDLRDQRNLLVDQLSKLVNITTYEDSNGNFRIDIAGQALVDGSTAF------------ 248

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAV--PKGKIKALLQIRDS-------VVPIFQNQLD 291
              T++ +S      G VV    G++V    G +K LL +RD         VP + N+ +
Sbjct: 249 ---TMSMDST-----GNVVWDLTGTSVNPSSGILKGLLDMRDGDGTNGIKGVPYYINEWN 300

Query: 292 EMARVL---IGSFSEKDPIAGNSENVP--GLFIADGIKDLDNKLCQGISETICVNPQYRS 346
           ++A  +   I +  E       S ++P  G F   G  D   +  Q     I V+ Q  +
Sbjct: 301 KLAYSIAKEINAVHESGYGLDGSHDIPLFGGFDTTGAYDSKVQYAQ----LIKVSSQILA 356

Query: 347 NPSFLRDGGSVSKKFL----WNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
           +    +   +     L     N   L G  D+               P+ G+N   T  +
Sbjct: 357 SDGLQKIAAASDPNALPGDNTNALQLIGLRDI---------------PIQGLN-GATFDD 400

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           +AR+ I  L  +   ++ +    QV+   I  +  +  GV+L EE++ ++K ++SY  S 
Sbjct: 401 FARSLISNLGVDAQQANMMQQNQQVMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYVASA 460

Query: 463 KLIMFTDKMLQTLL 476
           ++I   D++L TL+
Sbjct: 461 RVITVMDELLDTLI 474


>gi|270262395|ref|ZP_06190666.1| flagellar hook-associated protein FlgK [Serratia odorifera 4Rx13]
 gi|270043079|gb|EFA16172.1| flagellar hook-associated protein FlgK [Serratia odorifera 4Rx13]
          Length = 548

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 61/319 (19%), Positives = 139/319 (43%), Gaps = 31/319 (9%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRR----------DTMTTISPENVTVVT 54
           ++ N A +  N A    +++  NI N +   Y R+           TM+      VTV +
Sbjct: 4   SLINTAMSGLNAAQVALSTVSNNISNYNVAGYNRQTAILAQNGGMSTMSGFIGNGVTVTS 63

Query: 55  -QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  N+ +  ++  A S A  Q    +    +  ++++     N+ +  +     +L++
Sbjct: 64  VNREYNQFITSQLRGAQSQAGAQNAYFEKISQIDNLLASK---TNTLSTNMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   +TV+  A  +V  FN + + ++ + +  ++++      +  +  ++  +
Sbjct: 121 LVSNAGDDAARQTVLGKANGLVNQFNNTDKYLRDMDSGVNQQLSDSAQQINSYSQQIAKL 180

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N+ I     S  + +  LDQRD L+  +++++G+    ++ +   V  ++G TL      
Sbjct: 181 NEEITRLRGSGGEPNALLDQRDQLVTDLNKVVGVQVTQQDGDAYTVSFANGLTL------ 234

Query: 234 DINFEKMNSYTVTS---ESNPIFIDGVVVSSNQGSAVPKGKI-----KALLQIRDSVVPI 285
               +  N+Y V +     +P  +       N  S +P+G+I       +L+ R   +  
Sbjct: 235 ---VQGNNAYQVAAVPTSGDPSRLTMGYDRGNGASEIPEGQITGGSVSGVLKFRSESLDS 291

Query: 286 FQNQLDEMARVLIGSFSEK 304
            +NQL ++A  +  SF+++
Sbjct: 292 ARNQLGQLALAMADSFNQQ 310


>gi|330818578|ref|YP_004362283.1| flagellar hook-associated protein FlgK [Burkholderia gladioli BSR3]
 gi|327370971|gb|AEA62327.1| flagellar hook-associated protein FlgK [Burkholderia gladioli BSR3]
          Length = 661

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 126/306 (41%), Gaps = 31/306 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVT-QRSENK 60
           +L  +    QNI N A+  + S+ R +    +  Y         SP  VT VT QR  ++
Sbjct: 16  ALWGINTTGQNISNQATPGY-SVERPVFAESDGQYTPNG----FSPSGVTTVTVQRQFSQ 70

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH----YISKLRDSLESYSK 116
            + D++  A+++A      L S+ AL   +   ++Y  +P+      IS     L++ + 
Sbjct: 71  YLSDQLNSANTTA----SALSSYSALVATL---NNYVGNPSAGIGAAISSYFSGLQTVAN 123

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N       +T +   + +    N +  +   +R   +++++  ++++    +++  +N  
Sbjct: 124 NAGNQSTQQTALAAGQTLASQINAAGAQFDALRTQVNQQLQSSVTSVNALTAQIAQLNQQ 183

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------F 228
           I    +     +  LDQRD  +  +S+ +G+  + + N +  V   +G  L         
Sbjct: 184 ISAAGSQGQPPNQLLDQRDQAVASLSQYVGVQ-VTQVNGNYNVSIGNGQPLVVGNNSYQL 242

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
            T P   +  ++ S TV    N      VV      S+V  G I   LQ R   +   + 
Sbjct: 243 STAPSAADPSEL-SLTVQGTVNGAATTTVVPD----SSVTGGSIGGALQFRTQTLDPAEA 297

Query: 289 QLDEMA 294
           QL  +A
Sbjct: 298 QLGAIA 303


>gi|304317611|ref|YP_003852756.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779113|gb|ADL69672.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 478

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 114/501 (22%), Positives = 205/501 (40%), Gaps = 85/501 (16%)

Query: 17  ASQQFASIV-RNIENADNKNYVRRDT-MTTISPE---------------NVTVVTQRSEN 59
           ASQQ  ++   NI NA+   Y R+   ++ I+P                 V V   R   
Sbjct: 16  ASQQALNLTGHNISNANTPGYTRQVIDLSAIAPPTTYGMADQWGKAIGGGVNVDGYRQIR 75

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP-----THYISKLRDSLESY 114
               D+     ++ +G+      +E   + +SA +   N P     T  I    +SL+  
Sbjct: 76  DQYLDQQYRRENTTLGE------WETKSDTLSAIEGILNEPSDTGITTVIDNFFNSLQEL 129

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           SKN     +   V +N   +    N+  + +     + +  IE  +  +  +   ++ +N
Sbjct: 130 SKNPESLEVRAVVRENGVSLTDTINSVYQHLDDKENELNSTIESRVQEINSYADRISKLN 189

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
           + I     +   A+D  DQR++L+ K+SEI+ I+T   +N +  +  S G  L       
Sbjct: 190 NEIYRFELTGQTANDLRDQRNLLVDKLSEIVNITTYEDSNKNFRIDIS-GQAL------- 241

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKI-KALLQIRDS-------VVPI 285
              +  N+YT++ +S      G V     G+ V P G I K LL +RD         +P 
Sbjct: 242 --VDGSNAYTMSVDST-----GTVKWDLAGTPVNPTGGILKGLLDMRDGDGTNGVKGIPY 294

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGL---FIADGIKDLDNKLCQGI--SETICV 340
           ++ QL+++A  +   F+ +       +   G+    I D   D   +  + I  S  I  
Sbjct: 295 YKEQLNKLAYNIATVFNAQHAAGYGIDGSTGVNFFNITDSTYDPTAEYAKNIKVSSDILA 354

Query: 341 NPQYR-----SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
           +   +     S+P+ L    +       N+ NL    D         N     D V+ + 
Sbjct: 355 DDGLQKIAAASDPNSLPGDNT-------NILNLISLRD---AKISGLNGGTFDDFVSSLI 404

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           +N+ +     N    ++ N+S      M  QV +N  S S     GV+L EE++ ++K +
Sbjct: 405 SNLGVDAQQAN---MMQTNQS-----AMVKQVDYNRQSVS-----GVSLDEEMTNMLKYQ 451

Query: 456 QSYNISNKLIMFTDKMLQTLL 476
           +SY  S ++I   D++L TL+
Sbjct: 452 KSYEASARMITVMDELLDTLI 472


>gi|238788320|ref|ZP_04632114.1| Flagellar hook-associated protein 1 [Yersinia frederiksenii ATCC
           33641]
 gi|238723566|gb|EEQ15212.1| Flagellar hook-associated protein 1 [Yersinia frederiksenii ATCC
           33641]
          Length = 550

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 145/312 (46%), Gaps = 25/312 (8%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQRS 57
            N A +  + A    +++  NI N     Y R++T+      T+SP     N   VT  +
Sbjct: 1   MNTAMSGLSAAQYALSTVSNNISNYQVAGYNRQNTIFAQSGGTLSPAGFVGNGVAVTGVN 60

Query: 58  ENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
              N F  +++  A + + G     Q    +  ++S   + +N+ +  +     +L++  
Sbjct: 61  REYNSFITNQLRSAQTQSSGLTTYYQQVSQIDNLLS---NTSNNISTTMQDFFSNLQNLV 117

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            N  +D   KTV+  AE +V  F  + + ++ +    +++I   +S +  +  ++  +ND
Sbjct: 118 SNADDDAARKTVLGKAEGLVNQFQNADKYLRDMDNGVNQKITESVSQINNYADQIAKLND 177

Query: 176 AI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
            I + + +S  + +  LDQRD L+ ++++I+G++   ++ +   V  ++G  L +  P  
Sbjct: 178 QITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVSFANGLPLVQG-PSS 236

Query: 235 INFEKMNSYTVTSESNPIFI-----DGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            + E + S   ++++  + I      G  +  ++ S +  G +   L+ R   +   +NQ
Sbjct: 237 YHVEAIPS---SADATRLAIGYKYGSGTTLEVDE-SRLMTGSLGGTLKFRSEALDSARNQ 292

Query: 290 LDEMARVLIGSF 301
           L ++A V+  SF
Sbjct: 293 LGQLALVMADSF 304


>gi|297538902|ref|YP_003674671.1| flagellar hook-associated protein FlgK [Methylotenera sp. 301]
 gi|297258249|gb|ADI30094.1| flagellar hook-associated protein FlgK [Methylotenera sp. 301]
          Length = 650

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 105/207 (50%), Gaps = 12/207 (5%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           IS   +S+   + N S+    ++++  A+ +V    ++   + ++R+D + ++   ++ +
Sbjct: 110 ISDFFNSVSDLAANPSDIPTRQSMLSYAQSLVNRLQSTNSSLNEVRSDVNTQLTGSVNLV 169

Query: 164 RRFLSELTVVNDAIKFKTAS-KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
             +  ++  +N++I+   +S  +  +D +DQRD L+ ++S+ +  + + +      +Y  
Sbjct: 170 NTYAKQIASLNNSIETAISSDGNPPNDLMDQRDQLVTELSKQVKTTVVPQGQGSYNIYVG 229

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQG-----SAVPKGKIKALLQ 277
           +G      +P  I    M+  T +S ++P  ++    SS +      S++P G I  LLQ
Sbjct: 230 NG------LPLVIGKSVMSLTTASSPTDPTRLEVSYQSSGKSTVLGTSSLPGGVIGGLLQ 283

Query: 278 IRDSVVPIFQNQLDEMARVLIGSFSEK 304
            R   +   QNQ+ ++A VL  +F+++
Sbjct: 284 FRAESLDSVQNQIGQVALVLGDTFNKQ 310


>gi|302390139|ref|YP_003825960.1| flagellar hook-associated protein FlgK [Thermosediminibacter oceani
           DSM 16646]
 gi|302200767|gb|ADL08337.1| flagellar hook-associated protein FlgK [Thermosediminibacter oceani
           DSM 16646]
          Length = 465

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 87/380 (22%), Positives = 156/380 (41%), Gaps = 50/380 (13%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +++   +LE  SKN     + +TV + A  +    N  A ++ +I  D +  I +++  +
Sbjct: 121 LTQFWQALEELSKNPEAIEIRETVKERAVTLADTVNHVATKLTEILDDINFRISVKVDEV 180

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
                ++  +N  I+    +   A D  D+RDVLL  +S+++ I+T   + N +      
Sbjct: 181 NTLARQIADLNAQIQQMEITGITASDLRDKRDVLLDDLSKLVNINT-YEDENGVFTVNVG 239

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVS---SNQGSAVPKGKIKALLQIRD 280
           G  L           K + Y V S       DG  +     N    + KG++K LL++RD
Sbjct: 240 GAILV----------KGSDYEVMS------FDGADIKWQVYNTPVNIAKGELKGLLELRD 283

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPG--LFIADGIKDLDNKLCQGISETI 338
             V  + + +   A+ L G F++      +    PG   FI       +N L   I    
Sbjct: 284 QKVKTYLDSIKTFAQTLAGEFNKIHKSGYDLMGDPGEDFFI------YNNSLSGSIL--- 334

Query: 339 CVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNV 398
                            SV++  L +VK +A   D      D+ N   + D      T +
Sbjct: 335 -----------------SVNQSILNDVKKIAAAQDPDAVPGDNRNALKLADLKYMKLTTL 377

Query: 399 --TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
             TL EY  + I  L  +   S  +    + + + + E       V+L EE+S +I  + 
Sbjct: 378 GGTLDEYYGSLIARLGIDSQQSIRMTESQEFMVSQLDEQRKAVSSVSLDEEMSRMIMYQH 437

Query: 457 SYNISNKLIMFTDKMLQTLL 476
           +YN + ++I   D+ML T++
Sbjct: 438 AYNAAARMITAIDEMLDTIV 457


>gi|58039489|ref|YP_191453.1| flagellar hook-associated protein 1 FlgK [Gluconobacter oxydans
           621H]
 gi|58001903|gb|AAW60797.1| Flagellar hook-associated protein 1 FlgK [Gluconobacter oxydans
           621H]
          Length = 509

 Score = 56.6 bits (135), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 77/381 (20%), Positives = 148/381 (38%), Gaps = 33/381 (8%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
            TVI  A    Q+ NT A   Q  R  A   +   +S++   L+ +  ++  I    +  
Sbjct: 134 STVISAASTFAQSVNTLASAYQTQRQTAQDTVVSSVSDINTDLTTIGALSTKIMNLKSIG 193

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK----M 240
            D     +QR   L  +S  + +S     N DM + T++G TL     RD +  +     
Sbjct: 194 QDTAALENQRYTALSSLSSELSVSWSESANGDMTISTANGVTLPT---RDTSSTQGATVS 250

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPK--------------GKIKALLQIRDSVVPIF 286
           +++ +++ S  I +     +++  S++P               G + A + +RD+ +P  
Sbjct: 251 STWPLSTSSAQISVSSTYSATSADSSIPAITLNGRDVTADLTGGTLGANITLRDTTLPTM 310

Query: 287 QNQLDEMARVLIGSFSEKD-PI--AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
           Q QLD +   +    S++  P+  +G   +VPG        DL      G S+ + V+  
Sbjct: 311 QAQLDSLTSTVATRLSDQGMPLFTSGTDGDVPGTS----RTDLTPTGSVGFSQVMSVSST 366

Query: 344 YRSNPSFLRDGG-----SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNV 398
           Y  +PS L D       ++ K   +     +           S N         G   N 
Sbjct: 367 YSDDPSKLLDSSTSGTQTIQKVLSYGFGTTSDSAGTSQTAAPSTNLGLTGTLSTGYTGNQ 426

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
            ++  A +         SD+      SQ     ++ + S T  V++  E++ ++ ++ +Y
Sbjct: 427 GIISLATSLTAKQAATASDASSGLALSQTTQTSLTSNLSGTSTVSVDTEMANIVTLQNAY 486

Query: 459 NISNKLIMFTDKMLQTLLEGV 479
             + K++     M   LL  +
Sbjct: 487 AANAKVVSTVQTMFSALLSAI 507


>gi|95929883|ref|ZP_01312624.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95134179|gb|EAT15837.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 552

 Score = 56.6 bits (135), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 92/203 (45%), Gaps = 21/203 (10%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I +  D+ +  S N S ++    VI   E +  +FN+ AR++  +R++ +  +  EI ++
Sbjct: 112 IDRFFDAWQELSTNPSGEVERDIVIQRGELLASSFNSLARDLDNVRSNINDTVASEIDDV 171

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              L+++  +N  I+   A+   A+ F DQRD+LLQ+++  +G+ +    N  + +    
Sbjct: 172 NLKLNQIAELNTQIQNIEANGKSANSFRDQRDLLLQELTYTLGVQSYEEPNGAINIQLPG 231

Query: 224 GTTL--------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
           G  L         E  PR  +     + T+    +   + G     N G     GK   L
Sbjct: 232 GLPLVQNGTALQLEATPRGEDL----TLTLNIGESSFEVKG----DNLG-----GKFNGL 278

Query: 276 LQIRDSVVPIFQNQLDEMARVLI 298
            ++RD  +P  +  LD  A  ++
Sbjct: 279 FELRDEFIPELKQNLDLTAYEMV 301


>gi|237757071|ref|ZP_04585515.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690770|gb|EEP59934.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 475

 Score = 56.6 bits (135), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 87/364 (23%), Positives = 167/364 (45%), Gaps = 35/364 (9%)

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           I NA+ +V    +S + ++ ++     ++  +I+ + +   +L  +N+ IK KT     +
Sbjct: 128 IANAKVLVGKIRSSDKALEDLKQQTVLKVRDQINQINQITEQLAKLNNLIKTKTLDVESS 187

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR-DINFEK-MNSYTV 245
           +++L++RD L+ ++S +I    +   +N + V+T+ G  L   +    + FE   N   V
Sbjct: 188 NEYLNERDRLITQLSNLIDTKVVFNEDNTVNVFTAKGFGLVVGITNTQLQFETDSNGNAV 247

Query: 246 TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKD 305
              +N   I   + +   G     G +KA+  I   +     N+L++ A VL   F++  
Sbjct: 248 IKWNNTNDITKEIQNGELG-----GNLKAIDAINGQL-----NRLNDFATVLANVFNKVH 297

Query: 306 PIAGNSENVPGL-FIADGIKDLDNKLCQGISETICV---NPQ---YRSNPSFLRDGGSVS 358
                 +   GL F   GI D ++ L +  +  I V   +P+     +N ++L    +  
Sbjct: 298 SQGYGLDGSTGLNFF--GI-DPNSSLSKIDASNIIVAIEDPKQVALATNTAYLNSDNT-- 352

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFN----KNFIFDP-VAGINTNVTLLEYARNSIGWLEK 413
                N KNL    D I     S      K+ + DP    I  N    EY  + +  +  
Sbjct: 353 -----NGKNLLALKDSIGGVLTSTEETALKSSLNDPNNYDIIKNSKFSEYYNSQLVAIIS 407

Query: 414 NRSDSHDLHMK-SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           + S      M+ +Q +++ I+E   +  GVN+ EEL  L K+++SY  + ++I  TD+++
Sbjct: 408 SESSRIKTQMENNQFLYDAITEKMKSLTGVNMDEELINLTKLQRSYQAAARIITVTDELM 467

Query: 473 QTLL 476
           QT+L
Sbjct: 468 QTIL 471


>gi|94969957|ref|YP_592005.1| flagellar hook-associated protein [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552007|gb|ABF41931.1| Flagellar hook-associated protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 458

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 87/412 (21%), Positives = 172/412 (41%), Gaps = 56/412 (13%)

Query: 77  QRLLQSF-EALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
           Q  LQS+  ++ ++  A    +      +S   +S+   S       L ++V+ +A  +V
Sbjct: 85  QSALQSYVSSMDQVQVAFSDASGGIGGALSAFFNSISQLSTQPDSTTLRQSVLSSANTLV 144

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
             F+T A  +  ++   D E++ +++ + R   ++  +N  I        D     DQ D
Sbjct: 145 NAFHTDASSLSSMQQGLDLEVKDQVNEVNRLTVQIASLNGRISAMQKLHQDPGTLSDQLD 204

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
             + ++S ++ +S + +  + + + T++G  L   V  D       S+ +T+ ++P   D
Sbjct: 205 QSVSELSNLLDVS-VTQTEDGISLTTANGVAL---VVGD------KSFGLTTAADP---D 251

Query: 256 GVVVSSNQG-----SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGN 310
             +     G     + + KG +  +L++RD  VP  Q+QLD++A  L  + +       +
Sbjct: 252 TGLSRVQAGEIDLTALLQKGSLGGVLRVRDEEVPSIQSQLDKLAAGLSTAMNAVHQTGFD 311

Query: 311 SENVPG--LFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNL 368
               PG  LF A      D K    +      +P   +       G +     L  +KN 
Sbjct: 312 LNGNPGGLLFSA---PPSDGKNAAALISLAISDPAQLAMSGNGAAGDNTVANELLQIKNQ 368

Query: 369 A--GYPDLINHYCD-SFN-KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMK 424
           A  G    I+ Y    FN  + I D  AG++T+ +LL+  ++  G L             
Sbjct: 369 AVVGNATPIDAYSQIVFNVGSDISDAQAGLDTSTSLLQQLQDQRGALS------------ 416

Query: 425 SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
                           GV+L EE + L++ ++ +  +  L+   D+M+QT++
Sbjct: 417 ----------------GVSLDEETANLLQFQRGFEAAAHLVSVVDEMMQTVI 452


>gi|295678051|ref|YP_003606575.1| flagellar hook-associated protein FlgK [Burkholderia sp. CCGE1002]
 gi|295437894|gb|ADG17064.1| flagellar hook-associated protein FlgK [Burkholderia sp. CCGE1002]
          Length = 664

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 97/233 (41%), Gaps = 22/233 (9%)

Query: 77  QRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILG----KTVIDNAE 132
           Q    S      M+S  ++   SPT  I+       +  +N++ D       +T I  A+
Sbjct: 80  QSWSSSLGTYNTMISQLNNLVGSPTGGIASAISGYFTGLQNVANDASSVSTRQTAISAAQ 139

Query: 133 EVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLD 192
            +    N + ++  ++RA  + ++   ++ +  F +++  +N  I   ++     +  LD
Sbjct: 140 TLANQINAAGQQYDQLRASVNTQLSDAVTQINTFTAQIASLNTQITQASSQGQPPNQLLD 199

Query: 193 QRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPI 252
           QRD+ +  +S++IG+S +V++N    ++ S+G       P  +     N  T TS  +P 
Sbjct: 200 QRDLAVSNLSQLIGVS-VVQDNGSYSLFMSNGQ------PLVLAGNSFNLGTATSSGDPS 252

Query: 253 FIDGVVVSSNQGSAVP-----------KGKIKALLQIRDSVVPIFQNQLDEMA 294
            +    +      A P            G +  LLQ R   +   + QL  +A
Sbjct: 253 ELSVQYLGQAGAKATPTPQTLSDTSVSGGTLGGLLQFRSQTLDPAEAQLGAIA 305


>gi|262273522|ref|ZP_06051336.1| flagellar hook-associated protein FlgK [Grimontia hollisae CIP
           101886]
 gi|262222500|gb|EEY73811.1| flagellar hook-associated protein FlgK [Grimontia hollisae CIP
           101886]
          Length = 464

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/369 (20%), Positives = 141/369 (38%), Gaps = 53/369 (14%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           +T+I  +E +V  FN  +++++  R   D ++E  ++     ++ L  +N +++    S+
Sbjct: 120 QTIISQSEAMVDRFNNLSQQLESQRKQVDGQLEASVNKANTLMANLASLNRSLREANGSE 179

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
            +    LD RD  L ++S ++ I+T   ++  + V    G  L          +  +   
Sbjct: 180 AEKASLLDARDATLTELSSMMDINTTYHSDGSVSVSLDQGQPLVNGASASQLMKNSDGGL 239

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           V       F  G         +   G I  +L  RD  +   + +LD MA      F+ +
Sbjct: 240 VLKRGESTFTLG---------SSAGGTIGGMLNYRDGHLQSLERELDVMAYSFATQFNAQ 290

Query: 305 DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV---NPQ---YRSNPSFLRDGGSVS 358
                +     G  +  G+  ++     G ++ + +   +P+   +  N +    G S +
Sbjct: 291 HTQGVDLNGKQGQPLFGGVDQIE-----GAAKNLTLLVSDPKALAFAGNGTVDEPGNSDN 345

Query: 359 KKFLWNVKN--------------LAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            + L  +KN              LA Y D I    D  N   +F    G+  +       
Sbjct: 346 LEALIGLKNAPITLDKAKLSETDLAQYGDTI----DKVNGKTLFTAYTGLCGD------- 394

Query: 405 RNSIGWLEKNRSDSHDL-HMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
                W  K      D+   +SQV   H   +  +  GVNL EE   L++  Q Y  + K
Sbjct: 395 -----WAIKTSQSKTDMASAESQV--KHAENARDSVSGVNLDEEAVSLMQFTQMYQANAK 447

Query: 464 LIMFTDKML 472
           +I    ++L
Sbjct: 448 VISTAQQLL 456


>gi|150020229|ref|YP_001305583.1| flagellar hook-associated protein FlgK [Thermosipho melanesiensis
           BI429]
 gi|149792750|gb|ABR30198.1| flagellar hook-associated protein FlgK [Thermosipho melanesiensis
           BI429]
          Length = 846

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 75/177 (42%), Gaps = 9/177 (5%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + ++  AEE V+N       ++++R D D EI   +  +   +  L  +N  ++   A K
Sbjct: 144 RELVSRAEEFVKNIKDLYFRLEQLREDLDYEISQRVEQINSMVKRLADINAKVRLSVALK 203

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
              +D LD+RD +L ++S +  I      +  + +   D   L      DIN  +     
Sbjct: 204 STPNDLLDERDRILDELSTLADIYYTEDASGQITLRIGDQIVL---TGSDINKLRALERP 260

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
                  IF+      SN    +  G IKA L +RD ++  + N+LDE    L   F
Sbjct: 261 YGKGFKEIFV------SNSKVDIHDGSIKAALDLRDKIIVKYMNRLDEFVLYLTDKF 311


>gi|89056665|ref|YP_512116.1| flagellar hook-associated protein FlgK [Jannaschia sp. CCS1]
 gi|88866214|gb|ABD57091.1| flagellar hook-associated protein FlgK putative [Jannaschia sp.
           CCS1]
          Length = 487

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 87/365 (23%), Positives = 151/365 (41%), Gaps = 28/365 (7%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
            +  A  +    N  +  +Q  R  AD  I + +  +   L  L  +N  I     S  D
Sbjct: 132 AVQGASAIADTLNELSSGIQTERKRADASIGIAVDQINGALESLAELNARILSVGYSGGD 191

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF---EKMNSY 243
               +D ++ L+ +++  + + T   NN  + VY+ DG  L      ++ F     M+ Y
Sbjct: 192 TAALVDAQNQLVDQVAPYVPLQTRRDNNGLLNVYSDDGHVLVNYRAAELGFVAKPTMDPY 251

Query: 244 TVTSES--NPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
                   + + +DG  +    +  A   G+++AL  +RDS  P  Q +LD +A  L   
Sbjct: 252 QSIGNGTLSGLTLDGRALRMDGEYPAFAGGQLRALFDVRDSQAPEAQTRLDGIALDLAER 311

Query: 301 FSEK--DP-IAGNSENVPGLFIADGI-KDLDNKLCQGISETICVNPQYRSNPSF----LR 352
           F     DP IA  S   P LF   GI  D  N+L  G++  I VN     N       LR
Sbjct: 312 FDAAGLDPSIAAGS---PSLFTDAGILVDGSNEL--GLASRIRVNAAVVPNEGGAVWRLR 366

Query: 353 DG-GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
           DG G+  +    N   L    + ++    + +  F     +G   +++ L     SI  L
Sbjct: 367 DGLGAAVEGPTGNATFLTAQIERLSTTQTTTSTAF-----SGAQRSMSELISENLSIVGL 421

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
            +  +++   ++ S    N   ++     GV+   EL  L+++EQ Y  + ++I    +M
Sbjct: 422 GRVTAET---NLSSASAQNTALKTAELAGGVDSDAELQRLLQIEQMYAANARVINVAGQM 478

Query: 472 LQTLL 476
           +  LL
Sbjct: 479 MDELL 483


>gi|23099962|ref|NP_693428.1| flagellar hook-associated protein FlgK [Oceanobacillus iheyensis
           HTE831]
 gi|22778193|dbj|BAC14463.1| flagellar hook-associated protein 1 [Oceanobacillus iheyensis
           HTE831]
          Length = 490

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 154/373 (41%), Gaps = 56/373 (15%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+     +   FN  +  +  IR D   +I+  + +    +  +  +N+ IK      +D
Sbjct: 143 VLQRGHALADTFNYISSSMSTIRTDLSNQIDTTVKDANSLIDNIDNLNEQIKNLETHGYD 202

Query: 187 AHDFLDQRDVLLQKISEIIGISTI-----VRNNNDMV----VYTSDG---TTLFETVPRD 234
           A+D  D+RDVLL ++S I+ I         +N  D V    V    G    TL + V   
Sbjct: 203 ANDLYDKRDVLLDELSGIVNIKVTYDNSHAKNRADGVATVEVLNDSGDSIATLVDGVEGT 262

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV--PKGKIKALLQI--------RDSVVP 284
           +N  +  +Y    E++   I+ + V+   G ++   KG +  L++         R    P
Sbjct: 263 VNHIEAPTYNEGEENDLTVIEDIQVN---GESILSSKGSLSGLVESYGYMEDGERVGDYP 319

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
              ++LDE+A  +  SF+E      +SE   G+     + D      +G +  I V    
Sbjct: 320 EMMSRLDELAYSIATSFNEI-----HSEGDSGVPFFGELTD-----EKGAAGAISV---- 365

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSF-NKNFIFDPVAGINTNVTLLEY 403
                 L D   ++          AG  DL +   D F N N + D  A IN      +Y
Sbjct: 366 -----ILEDYEDINAS----ADGEAGSGDLASDLADIFTNPNDLLDG-ASIN------DY 409

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
             + IG L      ++ +   +  + + +     +   V+L EE+S +IK + +YN + +
Sbjct: 410 FGSIIGDLGVKSEQAYTMQENTMTLQHQVENQRLSISAVSLDEEMSNMIKFQHAYNAAAR 469

Query: 464 LIMFTDKMLQTLL 476
            +   D+M+ T++
Sbjct: 470 GMTTMDEMIDTII 482


>gi|117928040|ref|YP_872591.1| flagellar hook-associated protein FlgK [Acidothermus cellulolyticus
           11B]
 gi|117648503|gb|ABK52605.1| flagellar hook-associated protein FlgK [Acidothermus cellulolyticus
           11B]
          Length = 463

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/358 (20%), Positives = 146/358 (40%), Gaps = 49/358 (13%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           +I +A+ +    N +A  +    A + + ++  +  +     ++  +N AI   T++ + 
Sbjct: 142 LIGDAQALASGLNVAAGALSAQWASSRQSLQSVVDQVNAAAQDIAALNKAIVAATSAGNQ 201

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
            +D  DQRDVL++K++ ++G++T  + +    V     + +  ++ R +   ++   T  
Sbjct: 202 PNDLEDQRDVLIRKLASLVGVTTKPKTDGSTDVLLGGSSLVSGSLARQL---QLGGGTAI 258

Query: 247 SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDP 306
            + +   +      +   +AV  G+  ALL   +  +P +  QLD +A  L+ + + +  
Sbjct: 259 DQVSTTPVTLTWTDTGTTAAVSSGQGAALLTALNVTIPSYAGQLDSVANQLVTTVNTQHQ 318

Query: 307 IA----GNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGGSVS 358
           +     GN+      F   G      K+   I++   V     P     PS   DGG   
Sbjct: 319 LGYDLNGNAGG--NFFDPTGTTAATIKVA--ITDPALVAASSVPPSAGQPSL--DGG--- 369

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                N + LA   ++     D+  +  I                   ++G  E N    
Sbjct: 370 -----NAQALA---NMSGTGADAAYRKMIV------------------ALG-SESNTIQQ 402

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
                +S V  N +  S  +  GV+L EE + LI  + +Y+ + K +   D +L TL+
Sbjct: 403 RTTTQQSVV--NQVEASRDSASGVDLDEEQTNLITFQHAYDAAAKYLSVIDSILDTLI 458


>gi|311105941|ref|YP_003978794.1| flagellar hook-associated protein FlgK [Achromobacter xylosoxidans
           A8]
 gi|310760630|gb|ADP16079.1| flagellar hook-associated protein FlgK [Achromobacter xylosoxidans
           A8]
          Length = 555

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/312 (21%), Positives = 129/312 (41%), Gaps = 28/312 (8%)

Query: 14  CNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-----------VTQRSENKNM 62
            N A    A+   NI NA    Y R+  M + +    T              +RS +  +
Sbjct: 11  LNAAQAGLATTSHNINNATTVGYNRQRVMVSTAGAQATSNGYIGRGVQVDTVERSYDSFL 70

Query: 63  FDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP--THYISKLRDSLESYSKNLS- 119
           + +++ A  S    Q       A+  +  AD     +P  T++ + + +++ S   + + 
Sbjct: 71  YKQLVGAQGSGAQLQTQYNQVSAINNLF-ADRTVGIAPGLTNFFTSM-NAVASKPADPAA 128

Query: 120 -EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
            +D+LGK     A  +     ++  E+Q  R   + +I   +  +  +L+ +  +N  I 
Sbjct: 129 RQDLLGK-----ANSLATQIRSAYTEMQNQRIGLNTQITTTVEQVNSYLTRIDDLNQQIS 183

Query: 179 FKT--ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET---VP- 232
             T  A     +D LDQRD  + ++++++G++T  + +   +   S G  L       P 
Sbjct: 184 LATGKAGGSPPNDLLDQRDQAVMELNQLVGVTTYEQGDKINITLASGGQALLSGNTIYPL 243

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
           + +   K    T  + + P      V      + V  G +  LLQ R + + + Q+QL +
Sbjct: 244 QAVASSKDVGRTTIAYTLPAGAGKTVAVELNDTEVTGGSLGGLLQFRATSLDVMQSQLGQ 303

Query: 293 MARVLIGSFSEK 304
           MA  L  SF+ +
Sbjct: 304 MAVGLALSFNAQ 315


>gi|78044505|ref|YP_359818.1| flagellar hook-associated protein FlgK [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996620|gb|ABB15519.1| flagellar hook-associated protein 1 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 473

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/384 (20%), Positives = 167/384 (43%), Gaps = 44/384 (11%)

Query: 102 HYISKLRDSLESYSKNLSEDILGKTVID-NAEEVVQNFNTSAREVQKIRADADKEIELEI 160
             + +  ++ +  SKN  E++  + V+   A+ +V+ FN    ++  ++ D D  ++  +
Sbjct: 117 QLMDRFWNAWQELSKN-PENLATRAVVQQTAKALVETFNHLRGQLDSLQNDFDFAVQANV 175

Query: 161 SNLRRFLSELTVVNDAIKFKT-ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVV 219
             +     ++  +ND I FKT   K +A+D +DQRD LL K++++I   T++ N +  + 
Sbjct: 176 EEINSIARQIRDINDQI-FKTNIVKFNANDLMDQRDELLNKLAKLIDF-TLIDNQDGTIS 233

Query: 220 YTSDGTTLFETVPRD-INFEKMNS---YTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
               G  L + +  D +  EK  S       S+  P+ I              KG++ A 
Sbjct: 234 IDIGGKKLVDGLTVDSLKVEKNASGFFEVFWSDDTPVTITS-----------QKGELAAN 282

Query: 276 LQIRDSVVPIFQNQLDEMARVLI---GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ 332
           L  RD  V   ++ LD +A+ LI    +   +  + G+    PG    DG          
Sbjct: 283 LAARDVDVQAMKDYLDSLAQTLIIETNNLHTQGYVLGSPMTNPGYNFFDGTD-------- 334

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA 392
             ++TI ++P+  +N + +    + S         +A   D +              P A
Sbjct: 335 --AKTIALSPEVSANLNNIAAAKTPSPGDGEIALAIAQLKDKLTMTLPGSTT-----PTA 387

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
             N      ++ R  I  L  +  ++  ++   Q++  +++     + GV++ EE++ +I
Sbjct: 388 TFN------DFYRTIISRLGVDAQEAERMYQNEQLLTKNLNNKRMESGGVSIDEEMANMI 441

Query: 453 KVEQSYNISNKLIMFTDKMLQTLL 476
             + +Y+ + +++   D+M+  ++
Sbjct: 442 LYQNAYSAAARIVTAIDEMMDIVI 465


>gi|30248328|ref|NP_840398.1| flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
 gi|30138214|emb|CAD84222.1| Flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
          Length = 466

 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 160/373 (42%), Gaps = 61/373 (16%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF--KTA 182
           + ++ NAE +   F    + + ++R   + +I   ++ +     ++  +N  I+    +A
Sbjct: 132 QAMLSNAEALTARFQQMDQRLSEMREGVNSQITGSVTEINSLAQQIAGLNMNIQAVESSA 191

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
           +   A+D LDQRD L++ +S II +  + +NN    V+  +G +L       +    M  
Sbjct: 192 NGQPANDLLDQRDALVRDLSRIINVDVVRQNNGHYNVFIGNGQSLV------VGSSAMTL 245

Query: 243 YTVTSESNPIFIDGVVVSSNQGSAV--PK-----GKIKALLQIRDSVVPIFQNQLDEMAR 295
             V S S+P  +  VV    QG  +  P+     G +  LL  R   +   QN  D++A 
Sbjct: 246 KAVPSSSDPQRL--VVAMDQQGGEIVLPEHQLQGGSLGGLLAFRSETLDSVQNSFDQLAW 303

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLD-NKLCQGISETICVNPQYRSNPSFLRDG 354
            +  +F+ +  +  + ++V G    +G    D ++  + I   I       S+P+     
Sbjct: 304 GIADTFNTQHQVGFDLQSVAGSNFFEGTDPSDPSQAARNIRVAI-------SDPA----- 351

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLL--------EYAR- 405
                K      N  G  + IN              +AG+ T  TL          YAR 
Sbjct: 352 -----KIAAADNNDGGVTNNINAL-----------KLAGLQTENTLQGGTASYQSAYARL 395

Query: 406 -NSIGWLEKNRSDSHDLHMKSQ-VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
            + +G    N++   ++  K+Q  + N   ++  +  GVNL+EE + L++ +Q +  S+K
Sbjct: 396 VSQVG----NKTRELEVTSKAQESMLNQTDQALQSLSGVNLEEEAANLLRYQQMFQASSK 451

Query: 464 LIMFTDKMLQTLL 476
           +I   + +  +LL
Sbjct: 452 VIEIGNSLFDSLL 464


>gi|186477704|ref|YP_001859174.1| flagellar hook-associated protein FlgK [Burkholderia phymatum
           STM815]
 gi|184194163|gb|ACC72128.1| flagellar hook-associated protein FlgK [Burkholderia phymatum
           STM815]
          Length = 657

 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 98/211 (46%), Gaps = 22/211 (10%)

Query: 99  SPTHYISKLRDS----LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADK 154
           SPT  IS    S    L++ + + S   + ++ I NA+ +    N +  +  ++R + + 
Sbjct: 102 SPTSGISSAITSYFTGLQNVANDASNPAMRQSAISNAQSLADQINAAGDQYDQLRTNVNT 161

Query: 155 EIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN 214
           ++   +  +  + S++  +N  I+  +A     +  LDQRD+ +  +S+++G+  +V+ +
Sbjct: 162 QLGDTVKQINTYSSQIAQLNAQIQSLSAQGQPPNQLLDQRDLAVSNLSQLVGVQ-VVQGD 220

Query: 215 NDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP--IFIDGVVVSSNQGSAVPK--- 269
               V+  +G  L   V  D +F   N  TVTS ++P    +    +SS  G+  P+   
Sbjct: 221 TGYSVFMGNGQPL---VVADKSF---NLTTVTSPADPTETAVAYAGLSSLAGTTTPQILP 274

Query: 270 ------GKIKALLQIRDSVVPIFQNQLDEMA 294
                 G+I  L+  R   +   + QL  +A
Sbjct: 275 DSTPLGGQIGGLMTFRSQTLDPAEAQLGAIA 305


>gi|296452609|ref|ZP_06894303.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP08]
 gi|296880979|ref|ZP_06904925.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP07]
 gi|296258570|gb|EFH05471.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP08]
 gi|296428000|gb|EFH13901.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP07]
          Length = 436

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 97/231 (41%), Gaps = 44/231 (19%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MTTISPE------------ 48
            L ++ N A +  N+  +   +I  NI N D + Y R+ T   T SP             
Sbjct: 3   GLFSILNTANSGMNSHQKAIQTISHNISNLDTEGYSRQRTEFATNSPMYMPSLSNSIGRG 62

Query: 49  ------NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYN----- 97
                 +VT VT R+ N + +D    A +   G+             +S  D+YN     
Sbjct: 63  QLGTGVHVTDVT-RARN-SFYDYQFRAEAHKYGK------------TVSKYDYYNTIETI 108

Query: 98  -NSPTHY-----ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRAD 151
            N P+ Y     I       ES SK+++ D     V++NA  +    + S +++ K++ D
Sbjct: 109 LNEPSDYGISAGIDDFFKGWESLSKDINSDSKKSLVVENASNLATLISESYKKLDKLKGD 168

Query: 152 ADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKIS 202
            D  I+ EI  +   L  L  +N +I   + S    +D LD+RD +L  +S
Sbjct: 169 IDSNIDTEIKQINEMLKSLEDLNKSIDIISGSGSMPNDLLDERDRILDNLS 219


>gi|224532252|ref|ZP_03672884.1| flagellar hook-associated protein FlgK [Borrelia valaisiana VS116]
 gi|224511717|gb|EEF82123.1| flagellar hook-associated protein FlgK [Borrelia valaisiana VS116]
          Length = 627

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 129/294 (43%), Gaps = 29/294 (9%)

Query: 23  SIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQ---- 77
           ++  N+ NA    Y R R TM T +P     + +  +   +   ++      +  +    
Sbjct: 24  TVGHNLSNATKPGYSRQRVTMKTTTPLYAPQLNRAKKQGQLGQGIMVQSIDRVKDELLNT 83

Query: 78  RLLQSFEALKEMMSAD-------DHYNNSPTHYISK-LRDSLESYSKNLSEDILG----K 125
           R+++    L    S D       D YN      I K L D  ES+ ++L+    G    K
Sbjct: 84  RIIEESHRLGYWTSKDKFISMLEDVYNEPEDQSIRKRLNDFWESW-QDLANQPQGLAERK 142

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            +++  +   +   +    +++I   A+ EI++       ++  +  +N  I    A K 
Sbjct: 143 IILERGKSFCEGIRSRFHSLERIYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKD 202

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYT 244
           + +D +D RD++++K+  +IGIS   + + +  +  S+G  L + ++  +   E  N  T
Sbjct: 203 NPNDLMDARDLMVEKLGNLIGISIENKQDPNEFLIHSEGRHLVQGSIANEFKLEATNGPT 262

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            T  +       ++ S+N    +  GK+ +LL IRD  +   +N++DE+  + +
Sbjct: 263 RTKWN-------ILWSNNDKVNLKTGKLGSLLHIRDEEI---KNEIDELNNIAV 306


>gi|42522141|ref|NP_967521.1| FlgK, flagellar hook-associated protein [Bdellovibrio bacteriovorus
           HD100]
 gi|39574672|emb|CAE78514.1| FlgK, flagellar hook-associated protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 469

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/389 (20%), Positives = 163/389 (41%), Gaps = 32/389 (8%)

Query: 93  DDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRAD 151
           ++  N     Y++   +S    S N  E +  +T++ +++  + ++F     +++ ++ D
Sbjct: 103 NEQNNKGLNQYMTDFFNSFRELSNN-PESLASRTMVRESSVALTKDFGRVVGQLKAVQED 161

Query: 152 ADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV 211
            D +I+  +  + +   E+  +N+ ++        A+D  D+RD+LL+K+ E I IS   
Sbjct: 162 LDGQIKTTVEEVNQLSKEIASLNEKVQMVEVQGTPANDERDRRDLLLKKLGEKIDIS-WA 220

Query: 212 RNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV-VVSSNQGSAVPKG 270
              + MV  T+  T +   V    + E     T   +   +F +G    S+N    +  G
Sbjct: 221 EGRDGMVTVTAGRTAIL--VSGIGSSELKARQTDARDRVEVFFEGSGSTSANITEQITGG 278

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
           +I   L +RD V+      +D MA  L    +       +     G+   D + D     
Sbjct: 279 RIGGALDVRDKVIEDLLGHVDNMAYTLAKEVNTAHIEGFDKSGRNGVLFFD-MPD----Q 333

Query: 331 CQGISETICVNPQYRSNPSFLRDG---GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI 387
            +G +  I +N    ++   +  G   G+     + NV +   Y  +++    + +  + 
Sbjct: 334 VKGAASVIGLNKTVFNDVGRIATGAQPGAAGDNTVANVISALQYRQVMDGGTSTLDDYY- 392

Query: 388 FDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEE 447
                  +T V         IG + +    + +          +I ES S   GV+L EE
Sbjct: 393 -------STQV-------GQIGAVTQRAVKAQESQKNVISQLTNIRESIS---GVSLDEE 435

Query: 448 LSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            + +I+ +++Y+ S +LI   D+M  T+L
Sbjct: 436 TTKMIEFQKTYDASARLIKTADEMFDTVL 464


>gi|330721146|gb|EGG99270.1| Flagellar hook-associated protein FlgK [gamma proteobacterium
           IMCC2047]
          Length = 604

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 85/180 (47%), Gaps = 20/180 (11%)

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIEL---EISNLRRFLSELTVVNDAIKFKTASK 184
           +  AE   Q F +   ++  IRAD  +++E    ++SNL R +++L   N  I   T + 
Sbjct: 64  LSTAENATQKFKSLQNQLLSIRADIGQQVEAVATQVSNLARDIADL---NSEISIATNNG 120

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
              +D LD+RD  L+++++++ IS +   NN + +    G  L       +  E     T
Sbjct: 121 GQPNDLLDKRDETLRELAKLMDISIVPLENNSLSISIGSGQPLV------VGNETFTLET 174

Query: 245 VTSESNPIFIDGVVVS-----SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             S ++P   + VV S     S  GS+V  G +  LL  +  V+    N L+ + RV +G
Sbjct: 175 AQSANDPEVKELVVRSPTGAISRVGSSVDGGMMSGLLSAQFGVI---DNALNNLGRVALG 231


>gi|320354350|ref|YP_004195689.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
 gi|320122852|gb|ADW18398.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
          Length = 465

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 83/381 (21%), Positives = 161/381 (42%), Gaps = 38/381 (9%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I+   D+ +  + N S  +    VI     + + F +   E+  +  + +  I  E+  L
Sbjct: 113 INDFFDAWQELTANPSGQVERDVVIQRGNLLGEAFRSITDELDTVEQNMNTAIIAEVEYL 172

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              ++E+  +ND I     S   A+   DQRD++++ +S+ +GI T   N   + V    
Sbjct: 173 NEKIAEIAKLNDRINLVEISGQTANAARDQRDLIIKDLSQTLGIQTYTDNRGMLCVQLPG 232

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
           G  L +          + + TV ++ N + ++ V V+ + G     GK K + ++RD  +
Sbjct: 233 GMPLVQGTMA----STVKTVTVGTDVN-LQLETVGVTLDIGLNNLGGKFKGMFEMRDVFI 287

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDL------DNKLCQGISET 337
              ++ L+ +A  L  + + +      S  + G    + I  L         +   I++T
Sbjct: 288 DNLRSDLNTLAIDLTSAVNAEHVTGYGSNGLSGYLFFNDISALPPGEIASRNVLVAITDT 347

Query: 338 ICVNPQYRSNPSFL-RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
             V      NPS    D  +  +     V +  G  +      D+F+ NF    VA +  
Sbjct: 348 TQVAAA--GNPSAAPGDNETALRIAQLEVTHKVGTTN------DTFD-NFFSQMVATVG- 397

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
               +E ARN +         + D  ++ Q    ++ + YS   GV+L+EE+  LI+ ++
Sbjct: 398 ----IEAARNDLAL-----QGAQDAAVQLQ----NLRDGYS---GVSLEEEMIDLIQYQR 441

Query: 457 SYNISNKLIMFTDKMLQTLLE 477
            +  S K +   D+M+  LL+
Sbjct: 442 GFESSAKFLATVDEMMNALLQ 462


>gi|194365674|ref|YP_002028284.1| flagellar hook-associated protein FlgK [Stenotrophomonas
           maltophilia R551-3]
 gi|194348478|gb|ACF51601.1| flagellar hook-associated protein FlgK [Stenotrophomonas
           maltophilia R551-3]
          Length = 626

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 123/303 (40%), Gaps = 32/303 (10%)

Query: 19  QQFASIVRNIENADNKNYVRRDT-MTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQ 77
           +  A+   N+ N +   Y R+     T  P+N    T  +  + + D    A   AI   
Sbjct: 17  RALATTSHNVANLNTPGYSRQKVNFATADPQNYGYGTVGNGTR-ITDIRRTADQLAI--S 73

Query: 78  RLLQS---FEALKEMMSADDHYN---NSPTHYISKLR----DSLESYSKNLSEDILGKTV 127
           RLL S      LK++ S  D  N   + P   +S +     DS+   S N +     + +
Sbjct: 74  RLLDSSGELARLKQLSSMADRVNALVSDPATNVSGVWSNFFDSVSGLSSNAAGTADRQNM 133

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           +D  + +   F      +  +  + +  +    + + R   E+  +N AI    A+   A
Sbjct: 134 LDGGKALANRFVQLNTHLNNLNGEVNNGLLAGATEVNRLAQEIAQINGAIGTNIANA--A 191

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY---- 243
            D LD+RD L+ ++    G + ++++   M VYT+ G  L             + Y    
Sbjct: 192 PDLLDRRDQLITQLIGYTGGTAVIQDGGIMNVYTAGGNALVVGTTATKVTTVADPYQPER 251

Query: 244 ---TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
               + ++ N I +D   V          G+I  LL+ RD+V+   Q +L ++A  L  S
Sbjct: 252 LQLALETQGNTIRLDPKAVG---------GQIGGLLEFRDTVLTPAQAELGKLAVGLAES 302

Query: 301 FSE 303
           F++
Sbjct: 303 FNQ 305



 Score = 43.5 bits (101), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 418 SHDLHMKSQVVFNHISESYSNTV-GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           S +  + +Q+V N  ++   + V GVNL EE + +++++Q+Y  +++LI   D M QT+L
Sbjct: 562 SAEYSLDAQLVINDKAQEARDEVSGVNLDEEAADMLRLQQAYQAASQLISTADSMFQTIL 621

Query: 477 EGVK 480
             V+
Sbjct: 622 GAVR 625


>gi|325524325|gb|EGD02427.1| flagellar hook-associated protein FlgK [Burkholderia sp. TJI49]
          Length = 599

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 105/225 (46%), Gaps = 20/225 (8%)

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL--- 107
           TV  QR  ++ + D++  A +    Q   L ++ +L   +   ++Y  SPT  IS     
Sbjct: 1   TVTVQRQYSQYLSDQLNTAQT----QGGALSTWYSLVAQL---NNYVGSPTAGISTAITN 53

Query: 108 -RDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               L++ + N ++  + +T + NA+ +      + ++   +R   + ++   +S +  +
Sbjct: 54  YFTGLQNVANNAADTSVRQTAMSNAQTLADQITAAGQQYDALRQSVNTQLTSTVSQINAY 113

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            +++  +N  I   ++     +  +DQRD+ +  +S + G+  +VRN++   V+ + G  
Sbjct: 114 TAQIAQLNQQIAAASSQGQPPNQLMDQRDLAVSNLSGLAGVQ-VVRNSDGYSVFLAGGQP 172

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK 271
           L   V  D +++      VTS S+P  +   VVS     A P G+
Sbjct: 173 L---VVADKSYQLA---AVTSPSDPSEL--TVVSQGIAGANPPGQ 209


>gi|291288372|ref|YP_003505188.1| flagellar hook-associated protein FlgK [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290885532|gb|ADD69232.1| flagellar hook-associated protein FlgK [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 584

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 136/294 (46%), Gaps = 29/294 (9%)

Query: 27  NIENADNKNYVR-RDTMTTISPE-NVTVVTQRSEN----KNMFDKVLHAHSSAIGQQRLL 80
           NI N + + Y R R  + T +PE N   V  R  +    + ++D +L   SS   +   L
Sbjct: 28  NISNVNTEGYSRQRVVLETANPEKNSQGVFGRGVSVETVERIYDDMLA--SSIRNESSDL 85

Query: 81  QSFEALKEMMSADDHYNNSPTHYISKLRDSLESY----------SKNLSEDILGK--TVI 128
             +E L+  +S    Y N      S L +++++Y          + + S++ L K  T++
Sbjct: 86  AYYETLQSALSKVTIYFNELEDG-SGLGEAMQNYFDAWGDLANTAPDESDEALIKRATLV 144

Query: 129 DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAH 188
           ++A  +      S   +++I+ +++  +   ++ +      +  +N  I    +    A+
Sbjct: 145 ESASVLADKIQASYASLEEIKNESNLLVSDYVNEINNISENIAYLNKEIARIESGGDTAN 204

Query: 189 DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSE 248
           DF DQR VLL +++EI  +S   R+N  + VY      + E    ++  E+ +     S+
Sbjct: 205 DFRDQRQVLLNRLAEISNMSVTERSNGQVAVYIGGNAIVDEATRFELKAEQADE---DSD 261

Query: 249 SNPIFIDGVVVSSNQ----GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              IF  G    SN+     +A   G+I   L +RD ++  +Q+QLDE+A V+I
Sbjct: 262 DVSIFW-GTEGQSNKLVDITNAFTSGEIAGELYVRDELIQGYQDQLDELANVMI 314


>gi|238764397|ref|ZP_04625347.1| hypothetical protein ykris0001_37640 [Yersinia kristensenii ATCC
           33638]
 gi|238697423|gb|EEP90190.1| hypothetical protein ykris0001_37640 [Yersinia kristensenii ATCC
           33638]
          Length = 338

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/315 (20%), Positives = 139/315 (44%), Gaps = 31/315 (9%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQRS 57
            N A +  + A    +++  NI N     Y R++T+      T+SP     N   VT  +
Sbjct: 1   MNTAMSGLSAAQYALSTVSNNISNFQVAGYNRQNTVFAQNGGTLSPAGFIGNGVAVTGVN 60

Query: 58  ENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
              N F  +++  + + + G     Q    +  ++S   + +N+ +  +    ++L++  
Sbjct: 61  REYNAFITNQLRASQTQSSGLTTYYQQISQIDNLLS---NTSNNISTTMQDFFNNLQNLV 117

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            N  +D   KTV+  AE +V  F  + + ++ +    +++I    + +  +  ++  +ND
Sbjct: 118 SNAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDNGVNQKISDSAAQINNYAEQIAKLND 177

Query: 176 AI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF------ 228
            I + + +S  + +  LDQRD L+ ++++I+ ++   ++ +   V  + G +L       
Sbjct: 178 QITRLRGSSGSEPNALLDQRDQLVTELNQIVAVTVTQQDGDAYNVSFAGGLSLVQGPNAY 237

Query: 229 --ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF 286
             E +P   +  ++        S+ I ID         S +  G +   L+ R   +   
Sbjct: 238 KVEAIPSSADATRLTLGYKHGTSDTIEIDE--------SRLTSGSLGGTLKFRSEALDSA 289

Query: 287 QNQLDEMARVLIGSF 301
           +NQL ++A V+  SF
Sbjct: 290 RNQLGQLALVMADSF 304


>gi|225166310|ref|ZP_03727999.1| flagellar hook-associated protein FlgK [Opitutaceae bacterium TAV2]
 gi|224799447|gb|EEG17987.1| flagellar hook-associated protein FlgK [Opitutaceae bacterium TAV2]
          Length = 469

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 78/364 (21%), Positives = 147/364 (40%), Gaps = 54/364 (14%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           +T++ NA  +V    T   ++ + + D D  I  +I  ++  L+++T +N  I +F+   
Sbjct: 142 QTLLANAAILVDRIRTLDADLAQAQTDLDDSINQDIGEVQDLLAKITELNQQIARFEIND 201

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNN----DMVVYTSDGT-----TLFETVPRD 234
              A    D+R   L+ +++ I   T     +    D+  + +DG      T     P  
Sbjct: 202 PGTALTLRDERQAALEDLAQNISFETRTSTAHPGQIDIYTHDTDGNEVPLITAGSPPPAT 261

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           + ++     T++++     +           A+  G I   L  RD  +   ++ +D +A
Sbjct: 262 LTYDPATG-TLSTDGGATTL-----------ALTGGTIHGSLAARDGAIKTLRDNIDTLA 309

Query: 295 RVLIGSFSEKDPIAGNSENVPG--LFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           R LI S ++    A N ++ PG   F   G  D+   L  G+  T+      R+  +   
Sbjct: 310 RQLITSVND----AYNPDSDPGHDFFTGTGAGDI--ALAPGL--TVAT---LRTTAT--- 355

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
            GG             AG  DLI    +  N    F    G   + TL  +  +++    
Sbjct: 356 -GG-------------AGDSDLITAVANLINTR--FSTADGALIDGTLTAHYTSAVSHFG 399

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           +  S +   H     +   I E   +T GV+L EE   L+  +++Y  S ++I   D +L
Sbjct: 400 QAVSSADTRHQSQYSIETLIREQRDSTSGVSLDEETINLVNYQRAYQASARVITILDDLL 459

Query: 473 QTLL 476
            T++
Sbjct: 460 NTVV 463


>gi|225851146|ref|YP_002731380.1| flagellar hook-associated protein FlgK [Persephonella marina EX-H1]
 gi|225645441|gb|ACO03627.1| flagellar hook-associated protein FlgK [Persephonella marina EX-H1]
          Length = 485

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 88/390 (22%), Positives = 161/390 (41%), Gaps = 52/390 (13%)

Query: 120 EDILGK-TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           +DI  + + +  AE +V     S   +  I+      I   ++ L     ++  VN  I+
Sbjct: 119 DDIAARYSALSKAEALVGRIRNSYETLTDIKEKTSLSIRDNLNRLNDLTGQIATVNKNIR 178

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
           F TA     +++LD+RD LL++IS +I +    R++  + + T  G  L       + F+
Sbjct: 179 FYTADPAKRNEYLDERDRLLKEISSLIDVKVTFRDDQTVDISTVKGHPL-------VIFD 231

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVP----KGKIKALLQ----IRDSVVPIFQNQL 290
           +    T  ++SN     G  V  ++G+ +     KGKI   LQ    I +S+     N+L
Sbjct: 232 RNIPLTYETDSN-----GDPVIRHEGTDITFLFDKGKIGGYLQGIKKINESI-----NKL 281

Query: 291 DEMARVLIGSFSEKDPIAG---NSENVPGLFIADGIKDLDN----KLCQGISETICVNPQ 343
           ++   VL      K   AG   N       F  D   + +N     +  GI++   +   
Sbjct: 282 NDFTTVL-AMVVNKQHRAGFDLNGNTGIDFFTIDPSSNKNNLDASNIVVGITDPESIAAA 340

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE- 402
             S+P++     +  KK +    ++ G   ++    ++         + GI   +   + 
Sbjct: 341 --SDPAYTNSDNTNIKKIIALKDDITG---VLTAAEETTLSTTGSLTIGGITYTLNSFDS 395

Query: 403 ------------YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSF 450
                       Y+   I  L    +   +L+ +  ++   +         VNL EEL  
Sbjct: 396 YTFIKNKSYSEFYSSEMIAPLGFEINRVENLYQEQNLILETVDSKMKEISSVNLDEELIN 455

Query: 451 LIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           L K++++Y  S K+I  TD++LQTLL  VK
Sbjct: 456 LTKLQRAYEASAKIINVTDELLQTLLGLVK 485


>gi|218660673|ref|ZP_03516603.1| flagellar hook-associated protein FlgK [Rhizobium etli IE4771]
          Length = 120

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 2/116 (1%)

Query: 42  MTTISPENVTVVT-QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP 100
           M T S     VV   R++   +  + L + S    QQ LL   E LK +M  +D Y  SP
Sbjct: 1   MLTTSLNGAQVVQINRAQEDALLRQYLKSSSQDSAQQTLLGGLEDLKSIMGGND-YETSP 59

Query: 101 THYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           + Y+   ++ L+++       +  +  I  A +V  + N +++ VQ +RA+ADKEI
Sbjct: 60  STYLGVFQEKLQAFRTTPGCTVAAQGAITAALDVANSLNNASQSVQDVRANADKEI 115


>gi|320107049|ref|YP_004182639.1| flagellar hook-associated protein FlgK [Terriglobus saanensis
           SP1PR4]
 gi|319925570|gb|ADV82645.1| flagellar hook-associated protein FlgK [Terriglobus saanensis
           SP1PR4]
          Length = 467

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 138/324 (42%), Gaps = 56/324 (17%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-------DTMTTI-----SPEN 49
           SL ++ + A+    N+     +   NI N     Y R+       DT+        S   
Sbjct: 3   SLTSLLSIARQALANSQTAIDATGTNISNQHTVGYTRKTAVFAESDTVDVGGSLLGSGAT 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEA-------LKEMMSADDHYNNSPTH 102
           VT+V+QR       D++L        +QR+ Q  +A       L  + S D  +  + + 
Sbjct: 63  VTIVSQR-------DRIL--------EQRMQQQTQADGQTSARLTALQSVDSIFQTTTSS 107

Query: 103 Y-ISKLRDSLESY-------SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADK 154
              S +  SL+++         N ++    + V+ +A+        ++ ++     D  +
Sbjct: 108 ADASGIGSSLDAFFNSFSALEANPTDGATRQAVLTSAQTFATAIQAASSQLTSQATDLGQ 167

Query: 155 EIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN 214
           ++   ++ + +  S++  +N  I   T+   DA D  DQR  L+ ++S ++G+S     N
Sbjct: 168 QVSGSVAQVNQLTSQIAALNGKIS-STSPDADAGDLEDQRQELITQLSGLVGLSQSSTAN 226

Query: 215 NDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSE----SNPIFIDGVVVSSNQGSAVPKG 270
           N + + T++GT L   V  +I      SY +T++    S  +F     VS++  SA+  G
Sbjct: 227 NGIALTTTNGTPL---VGGNI------SYNLTAQNVGGSVHVFGQQNGVSTDITSALSGG 277

Query: 271 KIKALLQIRDSVVPIFQNQLDEMA 294
            I   +Q RD  +   Q  LD +A
Sbjct: 278 SIAGDIQARDVDIASAQTSLDTLA 301


>gi|188995967|ref|YP_001930218.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931034|gb|ACD65664.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 475

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 171/367 (46%), Gaps = 41/367 (11%)

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           I NA+ +V    +S + ++ ++     ++  +I+ + +   +L  +N+ IK KT      
Sbjct: 128 IANAKVLVGKIRSSNKALEDLKQQTVLKVRDQINQINQITEQLAKLNNLIKTKTLDVESN 187

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR-DINFEKMNSYTVT 246
           +++L++RD L+ ++S +I    +   +N + V+T+ G  L   +    + FE        
Sbjct: 188 NEYLNERDRLITQLSNLIDTKVVFNEDNTVNVFTAKGFGLVVGMTNTQLQFE-------- 239

Query: 247 SESNPIFIDGVVVSSNQGSAVPK----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFS 302
           ++SN       ++  N  + + K    G++   L+  D++     N+L++ A VL   F+
Sbjct: 240 TDSNG----NAIIKWNNTNDITKEIQNGELGGNLKGIDAINGQL-NRLNDFATVLANVFN 294

Query: 303 EKDPIAGNSENVPGL-FIADGIKDLDNKLCQGISETICV---NPQ---YRSNPSFLRDGG 355
           +        +   GL F   GI D ++ L +  +  I V   +P+     +N ++L    
Sbjct: 295 KVHSQGYGLDGSTGLNFF--GI-DPNSSLSKIDASNIIVAIDDPKQVALATNNAYLNSDN 351

Query: 356 SVSKKFLWNVKNLAGYPDLINHYC----DSFNKNFIFDP-VAGINTNVTLLEYARNSIGW 410
           +       N KNL    D IN       ++  K+ + DP    I  N    EY  + +  
Sbjct: 352 T-------NGKNLLALKDSINGVLTPTEETALKSSLNDPNNYDIIKNSKFSEYYNSQLVA 404

Query: 411 LEKNRSDSHDLHMK-SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
           +  + S      MK +Q +++ I+E   +  GVN+ EEL  L K+++SY  + ++I  TD
Sbjct: 405 IISSESSRIKTQMKNNQFLYDAITEKMKSLTGVNMDEELINLTKLQRSYQAAARIITVTD 464

Query: 470 KMLQTLL 476
           +++QT+L
Sbjct: 465 ELMQTIL 471


>gi|190574257|ref|YP_001972102.1| flagellar hook-associated protein FlgK [Stenotrophomonas
           maltophilia K279a]
 gi|190012179|emb|CAQ45802.1| putative flagellar hook-associated protein [Stenotrophomonas
           maltophilia K279a]
          Length = 626

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 123/303 (40%), Gaps = 32/303 (10%)

Query: 19  QQFASIVRNIENADNKNYVRRDT-MTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQ 77
           +  A+   N+ N +   Y R+     T  P+N    T  +  + + D    A   AI   
Sbjct: 17  RALATTSHNVANLNTPGYSRQKVNFATADPQNYGYGTVGNGTR-ITDIRRTADQLAI--S 73

Query: 78  RLLQS---FEALKEMMSADDHYNN-------SPTHYISKLRDSLESYSKNLSEDILGKTV 127
           RLL S      LK++    D  N+       + +   SK  DS+   S N +     + +
Sbjct: 74  RLLDSSGELARLKQLSGMADRVNSLFSDAATNVSGVWSKFFDSVSGLSSNAAGTADRQNM 133

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           +D  + +   F      +  + ++ +  +    + + R   E+  +N AI    A+   A
Sbjct: 134 LDGGKALANRFVQLNTHLNNLNSEVNNGLLAGATEVNRLAQEIAQINGAIGTNIATA--A 191

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY---- 243
            D LD+RD L+ ++    G + ++++   M VYT+ G  L             + Y    
Sbjct: 192 PDLLDRRDQLITQLIGYTGGTAVIQDGGIMNVYTAGGNALVVGTTATKVTTVADPYQPER 251

Query: 244 ---TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
               + ++ N I +D   V          G+I  LL+ RD+V+   Q +L ++A  L  S
Sbjct: 252 LQVALETQGNTIRLDPKAVG---------GQIGGLLEFRDTVLTPAQAELGKLAVGLAES 302

Query: 301 FSE 303
           F++
Sbjct: 303 FNQ 305



 Score = 44.3 bits (103), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 418 SHDLHMKSQVVFNHISESYSNTV-GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           S +  +++Q+V N  ++   + V GVNL EE + +++++Q+Y  +++LI   D M QT+L
Sbjct: 562 SAEYSLEAQLVINDKAQEARDEVSGVNLDEEAADMLRLQQAYQAASQLISTADSMFQTIL 621

Query: 477 EGVK 480
             V+
Sbjct: 622 GAVR 625


>gi|220922288|ref|YP_002497590.1| flagellar hook-associated protein FlgK [Methylobacterium nodulans
           ORS 2060]
 gi|219946895|gb|ACL57287.1| flagellar hook-associated protein FlgK [Methylobacterium nodulans
           ORS 2060]
          Length = 623

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 135/308 (43%), Gaps = 34/308 (11%)

Query: 24  IVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSF 83
           + +N+ N     YV+R T+T +S      V           +VL A  +A  Q RL  S 
Sbjct: 23  VSQNVANQSTPGYVKR-TLTPVSQSGNAGV-----GTGTVTRVLDA--AAQKQLRLETSG 74

Query: 84  EALKEMMSA-----DDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
            A  +++++     D  Y    +       ++    SL+S + + S      TV+ +A  
Sbjct: 75  AAYTDLVASIHSQIDALYGTPGSEAALDGVVNAFAQSLQSLASDPSSAPNRSTVLSDAGR 134

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD---AHDF 190
           +    +  A  VQ++R   +  +  ++++  + LSE+  +N  I   T S      A + 
Sbjct: 135 LANRISDVANGVQELRTGLESRLGADVASASKLLSEIAALNVKIVGSTGSGGGDSLAAEL 194

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-----TVPRDINFEKMNSYTV 245
           LDQRD  + ++++ + + T    +  + V TS G TL +     T+  D   +   S   
Sbjct: 195 LDQRDQRITELAQSMDVQTNAVGDGSVTVLTSSGVTLVDHGSAATLAFDGRSQLGPSAVY 254

Query: 246 TSESNPIFIDGVVVSSNQGS--------AVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           +++++   +  +  ++  G+        A+  G I A L +RD  +   Q QLD++A  L
Sbjct: 255 STDASMRGVGTITATTPSGARIDLVADKAIRSGSIAAALTLRDDTLVQAQRQLDDLAAGL 314

Query: 298 IGSFSEKD 305
             + S+++
Sbjct: 315 SRAMSDRN 322


>gi|226314925|ref|YP_002774821.1| flagellar hook-associated protein 1 [Brevibacillus brevis NBRC
           100599]
 gi|226097875|dbj|BAH46317.1| flagellar hook-associated protein 1 [Brevibacillus brevis NBRC
           100599]
          Length = 495

 Score = 54.7 bits (130), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 84/424 (19%), Positives = 183/424 (43%), Gaps = 56/424 (13%)

Query: 80  LQSFEALKEMMSADDHYNNSPTHY-ISKLRDSLESYSKNLSEDILGKT----VIDNAEEV 134
           L++ E L+ +M       N P+   + K+ D +    ++L++D    +    V + ++ V
Sbjct: 99  LETLEKLEGIM-------NEPSDTGLQKVMDQMWQAWQDLAKDPTDTSARAVVRERSKAV 151

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
              FNT    +++++ D +  + ++   +     ++  +N+ I       +  +D  DQR
Sbjct: 152 ADTFNTLTNHIKEVQTDLNNVVNVKSMEINSLGQQIANLNNQIANVVPHGYQPNDLYDQR 211

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFI 254
           DVLL K+S+++ +    ++   MV  T +G      +          S  V +  NP   
Sbjct: 212 DVLLDKLSKLVEVRA-TQSTAGMVNVTIEGREFVTGI---------TSQPVATVQNP--A 259

Query: 255 DGVVVSSNQGSA-VP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSE 312
            G+   +  G+A VP  G +   LQ RD +VP    +LD +A  L    ++    AG S 
Sbjct: 260 TGMSDMTLGGAAFVPTTGYMAGTLQSRDQIVPGMLKRLDVLAVNLTKEINDLHR-AGRS- 317

Query: 313 NVPGLFIADGIKDLDNKLCQGI-----SETICVNPQYRSNPSFLRDGGSVSKKFLWNVKN 367
                     + D++N   Q +     + ++  NP  ++ P+    G  ++ + + ++  
Sbjct: 318 ----------LSDINNGTVQDLPFFVDANSLAANPASKNYPTSA-SGIVINPEIMKSLDA 366

Query: 368 LAGYPDLINHYCDSFNKNFIFDP-------VAGINTN-----VTLLEYARNSIGWLEKNR 415
           +A   +         NK+ +           AG   N      TL  Y R +I  L  + 
Sbjct: 367 IAAAQEEAGSTPVGNNKSALAIASIKFKVLAAGTGPNDLAESSTLDNYYRYTISQLGVDA 426

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
            ++    + S+++   +     +  GV++ +E++ ++K + +Y+ S +++   D++L  +
Sbjct: 427 QEAERNQLNSEMLVGTVDSQRQSVSGVSIDDEMAEMVKYQHAYSASARVMTSMDEILDKV 486

Query: 476 LEGV 479
           + G+
Sbjct: 487 INGM 490


>gi|308186399|ref|YP_003930530.1| Flagellar hook-associated protein 1 (HAP1) [Pantoea vagans C9-1]
 gi|308056909|gb|ADO09081.1| Flagellar hook-associated protein 1 (HAP1) [Pantoea vagans C9-1]
          Length = 550

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 90/187 (48%), Gaps = 15/187 (8%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           ++++ NA+ +V  F TSA+ +  ++   + +I   I  +    S++  +N  I K  TA+
Sbjct: 131 QSMLSNAQGLVSQFQTSAQYLNNMQNSVNADIGSSIKQVNTITSQIADLNQQIGKLSTAN 190

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
               +D LD+RD L+  ++ ++G++   ++     V  ++G TL       +N +K +  
Sbjct: 191 GAAPNDLLDKRDQLVNTLNNVVGVTVSQQDGGGYTVAMANGLTL-------VNGDKSHDL 243

Query: 244 -TVTSESNPIFIDGVVVSSNQGSA-VPK-----GKIKALLQIRDSVVPIFQNQLDEMARV 296
             + S S+P       V    G+  +P+     G +  LL  R   + + QNQL ++A  
Sbjct: 244 VAMNSSSDPTRTTIGYVDKQAGNVEIPEKLITTGSLGGLLAFRTQDLDLAQNQLGQLAAA 303

Query: 297 LIGSFSE 303
              SF++
Sbjct: 304 FTTSFND 310


>gi|85058017|ref|YP_453719.1| flagellar hook-associated protein 1 FlgK [Sodalis glossinidius str.
           'morsitans']
 gi|84778537|dbj|BAE73314.1| flagellar hook-associated protein 1 FlgK [Sodalis glossinidius str.
           'morsitans']
          Length = 556

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 141/320 (44%), Gaps = 28/320 (8%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQ-----RS 57
           +L ++  A +      Q  + I  N+ NA N  Y R++ +   +   VT         R 
Sbjct: 1   MLNLYYIASSGLQTGQQALSVIGNNLANATNPYYSRQNIILGAAGGRVTSTGHIGNGVRV 60

Query: 58  EN-KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADD----HYNNSPTHYISKLRDSLE 112
           E     FD+  +A+    G + LL++  A  + MS+ D      +N     ++ L ++L+
Sbjct: 61  EGVARAFDE--YANERVRGTETLLRASSAHYDKMSSLDLEFSRTDNGIDTKLNSLFNALK 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             S          +     +E+   FN  + E+ K     +++I   ++N+ +   +L  
Sbjct: 119 DISTVPKNSNYRSSAFTALKELTGRFNKLSDELSKQEQKNNQDIRQSVNNINQLTGQLAS 178

Query: 173 VNDAIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMV-VYTSDGTTLFET 230
           +N  I  + +     A+D LD+RD LLQ +S+  GI+T + +    V V  S+G  L   
Sbjct: 179 LNREISNRQSIDGGGAYDLLDRRDALLQALSQQTGINTQIDSRTGAVNVTLSNGHML--- 235

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP-------KGKIKALLQIRDSVV 283
               ++ +K N+  VT+++N      +     + + +P       KG +  LL   +  +
Sbjct: 236 ----VSGDKANALEVTTDNNNPGRQVIAYRDAENAIIPLQDSLLDKGVLGGLLAFHNQDL 291

Query: 284 PIFQNQLDEMARVLIGSFSE 303
           P  +++L+E+A  L   F++
Sbjct: 292 PEIRDRLNELALHLSNRFNQ 311


>gi|332161328|ref|YP_004297905.1| flagellar hook-associated protein FlgK [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318605248|emb|CBY26746.1| flagellar hook-associated protein FlgK [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325665558|gb|ADZ42202.1| flagellar hook-associated protein FlgK [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330861098|emb|CBX71365.1| flagellar hook-associated protein 1 [Yersinia enterocolitica
           W22703]
          Length = 554

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/323 (20%), Positives = 145/323 (44%), Gaps = 37/323 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQ 55
           ++ N A +  + A    +++  NI N     Y R++T+      T+SP     N   VT 
Sbjct: 4   SLMNTAMSGLSAAQYALSTVSNNITNFQVAGYNRQNTIFAQNGGTLSPAGFIGNGVSVTG 63

Query: 56  RSENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            +   N F  +++  + + + G     Q    +  ++S   + +N+ +  +     +L++
Sbjct: 64  VNREYNAFITNQLRASQTQSSGLTTYYQQISQIDNLLS---NTSNNISTTMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   KTV+  AE +V  F  + + ++ +    +++I    + +  +  ++  +
Sbjct: 121 LVSNAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKISDSATQINNYAEQIAKL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           ND I + + +S  + +  LDQRD L+ ++++I+ ++   ++ +   V  + G +L +   
Sbjct: 181 NDQITRLRGSSGSEPNALLDQRDQLVTELNQIVAVTVTQQDGDTYNVSFAGGLSLVQ--- 237

Query: 233 RDINFEKMNSYTVTSESNPIFIDG--VVVSSNQGSA---------VPKGKIKALLQIRDS 281
                   N+Y V  E+ P   D   + +  N+GS          +  G +   L+ R  
Sbjct: 238 ------GPNAYKV--EAIPSSADATRLTLGYNRGSGDTMEIDESRLTTGSLGGTLKFRSE 289

Query: 282 VVPIFQNQLDEMARVLIGSFSEK 304
            +   +NQL ++A V+  SF+ +
Sbjct: 290 ALDSARNQLGQLALVMADSFNTQ 312


>gi|123442778|ref|YP_001006755.1| flagellar hook-associated protein FlgK [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122089739|emb|CAL12592.1| flagellar hook-associated protein 1 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 554

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/323 (20%), Positives = 145/323 (44%), Gaps = 37/323 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQ 55
           ++ N A +  + A    +++  NI N     Y R++T+      T+SP     N   VT 
Sbjct: 4   SLMNTAMSGLSAAQYALSTVSNNITNFQVAGYNRQNTIFAQNGGTLSPAGFIGNGVSVTG 63

Query: 56  RSENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            +   N F  +++  + + + G     Q    +  ++S   + +N+ +  +     +L++
Sbjct: 64  VNREYNAFITNQLRASQTQSSGLTTYYQQISQIDNLLS---NTSNNISTTMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   KTV+  AE +V  F  + + ++ +    +++I    + +  +  ++  +
Sbjct: 121 LVSNAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKISDSATQINNYAEQIAKL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           ND I + + +S  + +  LDQRD L+ ++++I+ ++   ++ +   V  + G +L +   
Sbjct: 181 NDQITRLRGSSGSEPNALLDQRDQLVTELNQIVAVTVTQQDGDTYNVSFAGGLSLVQ--- 237

Query: 233 RDINFEKMNSYTVTSESNPIFIDG--VVVSSNQGSA---------VPKGKIKALLQIRDS 281
                   N+Y V  E+ P   D   + +  N+GS          +  G +   L+ R  
Sbjct: 238 ------GPNAYKV--EAIPSSADATRLTLGYNRGSGDTMEIDESRLTTGSLGGTLKFRSE 289

Query: 282 VVPIFQNQLDEMARVLIGSFSEK 304
            +   +NQL ++A V+  SF+ +
Sbjct: 290 ALDSARNQLGQLALVMADSFNTQ 312


>gi|281418802|ref|ZP_06249821.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           JW20]
 gi|281407886|gb|EFB38145.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           JW20]
          Length = 489

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 92/489 (18%), Positives = 190/489 (38%), Gaps = 72/489 (14%)

Query: 27  NIENADNKNYVRRDTMTTISPE----------NVTVVTQRSENKNMFDKVLHAHSSAIG- 75
           N+ N + K Y R+  M T  P             ++   R       D +    ++ +G 
Sbjct: 26  NVANVNTKGYARQQAMITTGPYLNLMRYQIGLGASIQETRQIRHLFLDNIYRNENTELGY 85

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
            +   ++F+ ++ ++   D   +   + +++  ++ +  SK      +   V   AE +V
Sbjct: 86  WETRSKTFQEIQTILG--DPMGDGLQNVLNQFWNAWQELSKEPDSLTVRALVRQRAEALV 143

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
              N    ++ K++ D +++I L I  +     ++  +N  I  +     +A+D+ DQR+
Sbjct: 144 HQINHLGAQLDKLQEDLNQQIVLTIKQINDITKQIAELNVKIMQEEVCGDNANDYRDQRN 203

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
           +LL ++S++         N D+ V T  G  L          E++N     S+ N +F  
Sbjct: 204 LLLDELSKLADFEFTEMQNGDVQV-TLGGYILV------TKGEQINLVAGKSDINKMFFV 256

Query: 256 GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
             +   N    V  G ++ LL+ R  V    +   D  A          +P+  ++  V 
Sbjct: 257 PKIEGENIEVPVKSGVLRGLLESRGDVSGSIEGITDPAA----------NPVPASANIVS 306

Query: 316 GLFIADGI----------------KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            L +   +                K L N    G    + +NP Y               
Sbjct: 307 DLKMRLNVLVNSLVTQVNNLHRSGKTLGNPPSDGEDFFVAINPAYPLE------------ 354

Query: 360 KFLWNVK---NLAGYPDLINHYCDSFNKNFIFDPVAGINTN---------VTLLEYARNS 407
             + N+K   NLA   +++     +   N I   +A +  N         V+L +Y +  
Sbjct: 355 --MGNIKLNDNLADLDNIVASKSGASGDNTIALAIANLRDNRVIADVSGMVSLDDYYQTI 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           I  +    S++       + + N       + +GV++ EE+S +++ + +Y+ S++ I  
Sbjct: 413 ILIVGTGGSEAKKTAENQRTLVNSAEAQRQSVMGVSMDEEMSNMMRYKFAYSASSRAINV 472

Query: 468 TDKMLQTLL 476
            D ML+T++
Sbjct: 473 IDDMLETII 481


>gi|325982365|ref|YP_004294767.1| flagellar hook-associated protein FlgK [Nitrosomonas sp. AL212]
 gi|325531884|gb|ADZ26605.1| flagellar hook-associated protein FlgK [Nitrosomonas sp. AL212]
          Length = 638

 Score = 54.3 bits (129), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 66/310 (21%), Positives = 128/310 (41%), Gaps = 35/310 (11%)

Query: 17  ASQQFASIVRNIENADNKNYVRRDT-MTTISPENV----------TVVTQRSENKNMFDK 65
           A  Q  +   NI N     Y R+   + T +P++           +   QR  N+ + ++
Sbjct: 16  AQNQLLTTSHNISNVATPGYNRQQVILNTNTPQSSGAGFVGRGVHSTTVQRIYNQFLVNQ 75

Query: 66  VLHAHSSAIGQQRLLQSFEALKEM--MSADDHYNNSPT--HYISKLRDSLESYSKNLSED 121
            L   + +   Q L   F  +K++  M  D     SP   ++ S L+D   + S   S  
Sbjct: 76  SLQIQTQS---QSLDSHFAQIKQLDDMLGDTTSGLSPALQNFFSALQDVASNPSVIPSR- 131

Query: 122 ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK- 180
              + +I N E +   F +  + + ++R D + ++   +  +     +L  +N  I    
Sbjct: 132 ---QAMISNGEALAARFQSMDQRMSQMREDINAQVTSIVVEVNSLAGQLAKINQQITLAE 188

Query: 181 -TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
             +    A+D LDQRD L+ ++S++I   TI  +N  + ++  +G  L       +  + 
Sbjct: 189 GASGGQPANDMLDQRDELINRLSKLINTDTIRESNGSVSIFVGNGQALV------VGSQV 242

Query: 240 MNSYTVTSESNPIFIDGVVVSSN-----QGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           ++   + S  +P  +   ++S N         +  G +  LL  R   +   QN L  +A
Sbjct: 243 LSLKAIQSPDDPSDLTLGLISRNNTIQIHEDQITGGVLGGLLSFRSETLDNAQNALGRIA 302

Query: 295 RVLIGSFSEK 304
             L  SF+E+
Sbjct: 303 ITLAHSFNEQ 312


>gi|255099395|ref|ZP_05328372.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-63q42]
 gi|255305252|ref|ZP_05349424.1| putative flagellar hook-associated protein [Clostridium difficile
           ATCC 43255]
          Length = 436

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 94/218 (43%), Gaps = 20/218 (9%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MTTISP------ENVTVVTQ 55
           L ++ N A +  N   +   +I  NI N D   Y R+ T   T SP       N     Q
Sbjct: 4   LFSILNTANSGMNAHQKAIQTISHNISNLDTDGYSRQRTEFATNSPMYMPSLSNSIARGQ 63

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYN------NSPTHY-----I 104
                ++ D V  A +S    Q   ++ +  K  +S  D+YN      N P+ Y     I
Sbjct: 64  LGTGVHVTD-VTRARNSFYDYQFRAEAHKYGK-TVSKYDYYNTIETILNEPSDYGISAGI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                  ES SK+++ D     V++NA  +    + S +++ K++ D D  I+ EI  + 
Sbjct: 122 DDFFKGWESLSKDINSDSKKSLVVENASNLATLISESYKKLDKLKEDIDSNIDTEIKQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKIS 202
             L  L  +N +I   + S    +D LD+RD +L  +S
Sbjct: 182 DMLKSLEDLNKSIDIISGSGSTPNDLLDERDRILDNLS 219


>gi|319790356|ref|YP_004151989.1| flagellar hook-associated protein FlgK [Thermovibrio ammonificans
           HB-1]
 gi|317114858|gb|ADU97348.1| flagellar hook-associated protein FlgK [Thermovibrio ammonificans
           HB-1]
          Length = 449

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 109/485 (22%), Positives = 193/485 (39%), Gaps = 81/485 (16%)

Query: 18  SQQFA--SIVRNIENADNKNYVRRD-TMTTISPENVTVVTQR------------SENKNM 62
           SQQ A  +  RN+ N +   Y R +     I    VTV T R            SEN+N 
Sbjct: 16  SQQIAVNTTNRNLSNVNTDGYSREEPVFADIPGGGVTVATLRRVFSSVLFKRFISENQN- 74

Query: 63  FDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDI 122
            +  L A S  + Q       E+L      +D   +  +  I+     +   + N ++  
Sbjct: 75  -NAYLKAKSEVLSQ------VESL-----FNDQMGSGLSQAINDFFSVMNDVAVNPADLA 122

Query: 123 LGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA 182
             + ++  A+ +V     S   +Q+I++   K++   +SNL + L +L  +N  I     
Sbjct: 123 ARQELLSKAQVLVGRIRDSYSALQEIKSTYSKQVAESVSNLNQLLEKLADINRNIPLFAD 182

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
           S    + +LD+RD  +++IS II       ++  + +YT+ G   F  V  D  F+    
Sbjct: 183 SPDRLNQYLDERDRTIKEISSIIDAKVQFNSDGTVNLYTAKG---FALVLGDRTFK---- 235

Query: 243 YTV--TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
            TV  T     +  DG  ++S+       G + AL     +VV     +L+ +   +   
Sbjct: 236 VTVKNTDSGVKVLADGRDITSDLSGGSVGGLVSAL-----NVVESAMERLNTLTSTI--- 287

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV----NPQ---YRSNPSFL-R 352
               + +    E    L+   GI    +   Q I  +  V    +P+     S+P++L  
Sbjct: 288 ---ANEVNAQHEQGYNLYGETGIDLFASDNGQPIDASNIVLAFNDPKKFAAASDPNYLDS 344

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI-GWL 411
           D G        NVK L    D              +  + G+    +  EY    I  W+
Sbjct: 345 DNG--------NVKALMALADK------------TYTQLNGL----SFAEYYGTQITSWI 380

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
            +    + +L   S    + I +      GVN  EEL  L + +++Y  + +++  TD++
Sbjct: 381 GQEVESNDNLLKNSDFQLDAIKQKVEELSGVNTDEELVNLTRYQRAYQAAARVVTVTDEL 440

Query: 472 LQTLL 476
           LQT+L
Sbjct: 441 LQTIL 445


>gi|330445355|ref|ZP_08309007.1| flagellar hook-associated protein FlgK [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489546|dbj|GAA03504.1| flagellar hook-associated protein FlgK [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 777

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 112/228 (49%), Gaps = 23/228 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           + MM  DD  + S  + ++ + D   S+ S S + ++    +TV+++A +   +FN S  
Sbjct: 91  QHMMMLDDFTSKSAVNTVNSMNDFYNSVRSLSDHPNDLGSRQTVLESANQAANSFNNSYE 150

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIK-FKTASKHDAHDFLDQRDVLLQKIS 202
            +  IR D ++++++ +  +     EL  +N +++      K+  HD LD++  L+ +++
Sbjct: 151 TLTNIRRDVNEQLDVTLERVNALGQELAAINTSLQELPDGDKN--HDLLDKQRGLINELA 208

Query: 203 EIIGISTIVRNNN--DMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVS 260
           +   ++ +    +  D V+  S G TL   V  + +  KM S     E   I I    V+
Sbjct: 209 KYTKVTVLADKGSLADKVIIGS-GDTLVSGV--EFSQLKMVSGDPDLEDKQIAI----VN 261

Query: 261 SNQGSAVPK----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
            NQ  A+      G + ++L IRD V+      LDEM R+ IG FS++
Sbjct: 262 GNQAKAIKSDHIGGGLGSMLSIRDDVI---DKSLDEMGRMAIG-FSKQ 305



 Score = 42.4 bits (98), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
           G ++ + L E     IG  + N   + +++   Q+ F+  SE  SN  GVNL EE + L+
Sbjct: 694 GKSSVIDLFEGLATDIGMQKSNADKTAEVN---QLDFDAASERVSNISGVNLDEEAANLM 750

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
           K +QSY  S++++    +   TL+  V
Sbjct: 751 KFQQSYMASSRIMSVAKETFDTLMRAV 777


>gi|125974729|ref|YP_001038639.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           ATCC 27405]
 gi|125714954|gb|ABN53446.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           ATCC 27405]
          Length = 489

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 92/489 (18%), Positives = 191/489 (39%), Gaps = 72/489 (14%)

Query: 27  NIENADNKNYVRRDTMTTISPE----------NVTVVTQRSENKNMFDKVLHAHSSAIG- 75
           N+ N + K Y R+  M T +P             ++   R       D +    ++ +G 
Sbjct: 26  NVANVNTKGYARQQAMITTAPYLNLMRYQIGLGASIQETRQIRHLFLDNIYRNENTELGY 85

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
            +   ++F+ ++ ++   D   +   + +++  ++ +  SK      +   V   AE +V
Sbjct: 86  WETRSKTFQEIQTILG--DPMGDGLQNVLNQFWNAWQELSKEPDSLTVRALVRQRAEALV 143

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
              N    ++ K++ D +++I L I  +     ++  +N  I  +     +A+D+ DQR+
Sbjct: 144 HQINHLGAQLDKLQEDLNQQIVLTIKQINDITKQIAELNVKIMQEEVCGDNANDYRDQRN 203

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
           +LL ++S++         N D+ V T  G  L          E++N     S+ N +F  
Sbjct: 204 LLLDELSKLADFEFTEMQNGDVQV-TLGGYILV------TKGEQINLVAGKSDINKMFFV 256

Query: 256 GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
             +   N    V  G ++ LL+ R  V    +   D  A          +P+  ++  V 
Sbjct: 257 PKIEGENIEVPVKSGVLRGLLESRGDVSGSIEGITDPAA----------NPVPASANIVS 306

Query: 316 GLFIADGI----------------KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            L +   +                K L N    G    + +NP Y               
Sbjct: 307 DLKMRLNVLVNSLVTQVNNLHRSGKTLGNPPSDGEDFFVAINPAYPLE------------ 354

Query: 360 KFLWNVK---NLAGYPDLINHYCDSFNKNFIFDPVAGINTN---------VTLLEYARNS 407
             + N+K   NLA   +++     +   N I   +A +  N         V+L +Y +  
Sbjct: 355 --MGNIKLNDNLADLDNIVASKSGASGDNTIALAIANLRDNRVIADVSGMVSLDDYYQTI 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           I  +    S++       + + N       + +GV++ EE+S +++ + +Y+ S++ I  
Sbjct: 413 ILIVGTGGSEAKKTAENQRTLVNSAEAQRQSIMGVSMDEEMSNMMRYKFAYSASSRAINV 472

Query: 468 TDKMLQTLL 476
            D ML+T++
Sbjct: 473 IDDMLETII 481


>gi|298507071|gb|ADI85794.1| flagellar hook-associated protein FlgK [Geobacter sulfurreducens
           KN400]
          Length = 477

 Score = 53.9 bits (128), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 173/410 (42%), Gaps = 46/410 (11%)

Query: 86  LKEMMSADDHYNNSPTHYISK-LRDSLESYSKNLSEDILGK----TVIDNAEEVVQNFNT 140
           L  M  A+  +N   T  + K L+D   ++ ++L+ +  G+     ++   +++   F  
Sbjct: 91  LASMTRAEQLFNEFTTDGLGKSLQDFFSAW-QDLTANPQGQPERQAILARGQQLADQFKR 149

Query: 141 SAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQK 200
               +  IR +A++ +E   +++   L ++  +N+ IK        A++  DQRD+ +++
Sbjct: 150 VNSYLNDIRTEANQSLEGVTADVNDKLRKIASLNEQIKQIEVQGARANELRDQRDLAVRQ 209

Query: 201 ISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDIN--FEKMNSYTVTSESN 250
           ++E +GI+ + + +  + V  S G  L            P   N  F ++ S T      
Sbjct: 210 LAEKVGITYMEQTDGTLNVSLSLGQPLVLGKDAAVLSLQPDAANSGFYRIYS-TAPGGKT 268

Query: 251 PIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGN 310
            + I  +V     G    +G++   LQ+RDS+V  F   LDE+A  L    +        
Sbjct: 269 AVHISSIVGGPGNG----QGEMGGTLQVRDSLVNGFLADLDELAYTLATEVNAVHSSGFG 324

Query: 311 SENVPGL-FIADGIKDLDNKLCQGISETICVN---PQYRSNPSFLRDGGSVSKKFLWNVK 366
                GL F +            GIS  I  +       ++PS +  G +       N K
Sbjct: 325 LTGSTGLDFFSTPATMAGYSGLGGISVAISNSNDIAAANADPSVVGTGNNT------NAK 378

Query: 367 NLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQ 426
           ++A   D I              P++G   N+TL  +  + +G +  +  ++      S+
Sbjct: 379 DIASLFDKIL-------------PLSG--GNMTLGGFYNSLVGKVGVSVQNAERSATLSE 423

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            V   +     +  GV+L EEL+ LIK ++++  + KLI    +M+  +L
Sbjct: 424 GVLKQLDNLRESQSGVSLDEELANLIKYQKAFEGAAKLINTGTEMMDVIL 473


>gi|256005260|ref|ZP_05430227.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 2360]
 gi|255990811|gb|EEU00926.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 2360]
 gi|316941863|gb|ADU75897.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 1313]
          Length = 489

 Score = 53.9 bits (128), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 92/489 (18%), Positives = 190/489 (38%), Gaps = 72/489 (14%)

Query: 27  NIENADNKNYVRRDTMTTISPE----------NVTVVTQRSENKNMFDKVLHAHSSAIG- 75
           N+ N + K Y R+  M T  P             ++   R       D +    ++ +G 
Sbjct: 26  NVANVNTKGYARQQAMITTGPYLNLMRYQIGLGASIQETRQIRHLFLDNIYRNENTELGY 85

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
            +   ++F+ ++ ++   D   +   + +++  ++ +  SK      +   V   AE +V
Sbjct: 86  WETRSKTFQEIQTILG--DPMGDGLQNVLNQFWNAWQELSKEPDSLTVRALVRQRAEALV 143

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
              N    ++ K++ D +++I L I  +     ++  +N  I  +     +A+D+ DQR+
Sbjct: 144 HQINHLGAQLDKLQEDLNQQIVLTIKQINDITKQIAELNIKIMQEEVCGDNANDYRDQRN 203

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
           +LL ++S++         N D+ V T  G  L          E++N     S+ N +F  
Sbjct: 204 LLLDELSKLADFEFTEMQNGDVQV-TLGGYILV------TKGEQINLVAGKSDINKMFFV 256

Query: 256 GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
             +   N    V  G ++ LL+ R  V    +   D  A          +P+  ++  V 
Sbjct: 257 PKIEGENIEVPVKSGVLRGLLESRGDVSGSIEGITDPAA----------NPVPASANIVS 306

Query: 316 GLFIADGI----------------KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            L +   +                K L N    G    + +NP Y               
Sbjct: 307 DLKMRLNVLVNSLVTQVNNLHRSGKTLGNPPSDGEDFFVAINPAYPLE------------ 354

Query: 360 KFLWNVK---NLAGYPDLINHYCDSFNKNFIFDPVAGINTN---------VTLLEYARNS 407
             + N+K   NLA   +++     +   N I   +A +  N         V+L +Y +  
Sbjct: 355 --MGNIKLNDNLADLDNIVASKSGASGDNTIALAIANLRDNRVIADVSGMVSLDDYYQTI 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           I  +    S++       + + N       + +GV++ EE+S +++ + +Y+ S++ I  
Sbjct: 413 ILIVGTGGSEAEKTAENQRTLVNSAEAQRQSIMGVSMDEEMSNMMRYKFAYSASSRAINV 472

Query: 468 TDKMLQTLL 476
            D ML+T++
Sbjct: 473 IDDMLETII 481


>gi|300722675|ref|YP_003711965.1| flagellar hook-filament junction protein 1 [Xenorhabdus nematophila
           ATCC 19061]
 gi|297629182|emb|CBJ89778.1| flagellar biosynthesis; hook-filament junction protein 1
           [Xenorhabdus nematophila ATCC 19061]
          Length = 546

 Score = 53.9 bits (128), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/324 (20%), Positives = 140/324 (43%), Gaps = 41/324 (12%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MT----TISPENVTVVTQRSE- 58
           ++ N A +  N A      +  NI N+ + +Y R+ T MT    T+SP            
Sbjct: 4   SLMNTAMSGINAAQVAMGVVGNNIANSKSADYNRQTTVMTQNNGTMSPVGFVGNGVVVSG 63

Query: 59  -NKNMFDKVLHAHSSAIGQQRLLQSFE----ALKEMMSADDHYNNSPTHYISKLRDSLES 113
            N+   + +   H++A  +   L++++     + ++++  D    S ++ I  L  SL +
Sbjct: 64  INREYSEFITQQHNAAQTKYAALKTYDQQITKINDLLADKD---TSLSNSIEDLFKSLGT 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +     TV+  AE ++  F  +   +++I    + +IE  +  + ++  E+  +
Sbjct: 121 VESNAEDSAARTTVLGKAEGLISRFKETDEYLRQIDNSINSQIEQNVQEINKYAEEIAKL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL----- 227
           ND I + +     +    LD+RD  + ++++++ ++ I ++     V    G TL     
Sbjct: 181 NDEIRRMRGTGNGEPLALLDKRDEAVNRLNQLVEVNVIQQDGGAYNVSFGGGMTLVSGNK 240

Query: 228 ---FETVPRDINFEKM-----NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIR 279
               E +P   +  ++     N  + T E +  F             V +G +   LQ+R
Sbjct: 241 PYQLEAIPSSTDSARITLGYNNGTSGTREIDERF-------------VSQGALGGALQVR 287

Query: 280 DSVVPIFQNQLDEMARVLIGSFSE 303
             VV   +N+L+++A V+   F++
Sbjct: 288 REVVDKTRNELNQLALVMADQFNQ 311


>gi|154250318|ref|YP_001411143.1| flagellar hook-associated protein FlgK [Fervidobacterium nodosum
           Rt17-B1]
 gi|154154254|gb|ABS61486.1| flagellar hook-associated protein FlgK [Fervidobacterium nodosum
           Rt17-B1]
          Length = 847

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 123/308 (39%), Gaps = 53/308 (17%)

Query: 24  IVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQS 82
           +  NI NA+   + R R  + T+ P  +T +TQ             A    IG    ++ 
Sbjct: 27  VAHNIANANTPGFSRQRPELLTMPPIPITSLTQ------------PAVPLQIGTGVYVRD 74

Query: 83  FEALKEMM------SADDHYN-----NSPTHYISKL---------RDSLESYSKNLSEDI 122
            + +++          ++ YN      S  H++ +L         R   +S+   + E I
Sbjct: 75  IKRVRDAFLDIQYRQTNNKYNYWDTITSNLHFVEQLFAEPSEAGIRYLFDSFWSGIEEVI 134

Query: 123 LGKT-------VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
              T       ++   EE+VQ+       ++++R D D EI      +   +  L  +N 
Sbjct: 135 TDPTNTAAKRGLVSRTEELVQHMQDLYTRLEQLRTDIDNEIAQRTQQINAMVKRLADINA 194

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            ++   + K+  +D LD+RD +L ++S++           D+  Y      +   +   I
Sbjct: 195 KVRTAVSLKYTPNDLLDERDRILDELSDLA----------DIYYYEDAAGQITLRLGNQI 244

Query: 236 NFEKMNSYTVTSESNPIFIDGV--VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                N   + +   P F  G   + + N   ++  GK+K+L  +RD V+  + N+LDE 
Sbjct: 245 VLTGQNVVDLRALERP-FGKGFKEIFAGNSIVSINDGKLKSLFDLRDEVLVRYMNRLDEF 303

Query: 294 ARVLIGSF 301
           A  L   F
Sbjct: 304 ALSLSDEF 311


>gi|119469956|ref|ZP_01612761.1| putative flagellar hook-associated protein [Alteromonadales
           bacterium TW-7]
 gi|119446666|gb|EAW27939.1| putative flagellar hook-associated protein [Alteromonadales
           bacterium TW-7]
          Length = 667

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 76/151 (50%), Gaps = 23/151 (15%)

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T ++ DA    ++RD  ++ +SE+I I T+   N + +V+   G  +   V ++ +F   
Sbjct: 181 TNNQADASSTYNERDKAIRDLSELIDIETLDGPNGEKLVFMGTGEAV---VMQNGSF--- 234

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP--------KGKIKALLQIRDSVVPIFQNQLDE 292
           N +++  + +P F + + +  N G AVP        KGKI  LL  RD V+   QNQ+ +
Sbjct: 235 NLFSMRGDPDPNFKE-LRLDVNGGKAVPLEVDVSKLKGKIGGLLAFRDDVLVPAQNQIGQ 293

Query: 293 MARVLIGSFSEKDP--------IAGNSENVP 315
           M   +  SF+E++         I GN  N+P
Sbjct: 294 MGLAIADSFNEQNKLGMDANGEIGGNIFNIP 324


>gi|290474980|ref|YP_003467864.1| flagellar hook-filament junction protein 1 [Xenorhabdus bovienii
           SS-2004]
 gi|289174297|emb|CBJ81087.1| flagellar biosynthesis; hook-filament junction protein 1
           [Xenorhabdus bovienii SS-2004]
          Length = 546

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 137/312 (43%), Gaps = 17/312 (5%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPENV--TVVTQRS 57
           ++ N A +  N A      +  NI N+ N  Y R+ T+      T+SP       V   S
Sbjct: 4   SLMNTAMSGINAAQVAMGVVGNNIANSKNVGYNRQTTVLTQNNGTLSPAGFIGNGVAVSS 63

Query: 58  ENKNMFDKVLHAHSSAIGQQRLL----QSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            N+   + +   HSSA  +   L    Q    + ++++  D    S ++ I +   SL +
Sbjct: 64  INREYSEFINQQHSSAQTKHAALTAYNQQITKINDLLADKD---TSLSNSIEEFFKSLGA 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +     TV+  AE +V  F  +   +++I    + +IE     + ++  E+  +
Sbjct: 121 AESNAEDSAARTTVLGKAEGLVSRFKEADEFLRQIDNSINSQIEQNAREINKYAEEVATL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           N+ I + +     +    LD+RD  + K+++++ ++   ++     V    G +L  +  
Sbjct: 181 NNEITRMRGTGTGEPLALLDKRDEAVNKLNQLVDVNVTQQDGGVYNVSFGGGMSLV-SGS 239

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSN-QGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
           +    E ++S T +S     + +G V +       + +G +   LQ+R  VV   +NQL+
Sbjct: 240 KSYRLEAISSSTDSSRITLGYNNGTVGTKEIDERFISQGTLGGALQVRREVVDSSRNQLN 299

Query: 292 EMARVLIGSFSE 303
           ++A V+   F++
Sbjct: 300 QLALVMADQFNQ 311


>gi|317047697|ref|YP_004115345.1| flagellar hook-associated protein FlgK [Pantoea sp. At-9b]
 gi|316949314|gb|ADU68789.1| flagellar hook-associated protein FlgK [Pantoea sp. At-9b]
          Length = 547

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 86/185 (46%), Gaps = 17/185 (9%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           ++++ NA+ +V  F T+A+ +  ++   + +I   +  +  + S++  +N  I K  T  
Sbjct: 131 QSMLSNAQGLVNQFQTTAQYLTNMQTSVNTDITSSVDQINTYTSQIANLNTQIAKLTTGD 190

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
               +D LDQRD L+  +++I+G+ T+ + +   +V  S G+T        +N  K  S 
Sbjct: 191 GTAPNDLLDQRDQLVSSLNDIVGV-TVSQQDGSYIV--SMGSTTL------VNGSKTTSL 241

Query: 244 -TVTSESNPIFIDGVVVSSNQGS------AVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
             + S S+P  I    V    G+       +  G +  LL  R   +   QNQL ++A  
Sbjct: 242 VAMPSSSDPSRITVGYVDKQAGNVEIAEKTLTTGSLGGLLAFRTQDLDTAQNQLGQLAAA 301

Query: 297 LIGSF 301
              SF
Sbjct: 302 FATSF 306


>gi|323706357|ref|ZP_08117922.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534319|gb|EGB24105.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 478

 Score = 53.5 bits (127), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 108/494 (21%), Positives = 206/494 (41%), Gaps = 71/494 (14%)

Query: 17  ASQQFASIV-RNIENADNKNYVRRDT-MTTISPE---------------NVTVVTQRSEN 59
           ASQQ  ++   NI NA+   Y R+   ++ I+P                 V V   R   
Sbjct: 16  ASQQALNLTGHNISNANTPGYTRQVIDLSAIAPPTTYGMADQWGKAIGGGVNVDGYRQIR 75

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP-----THYISKLRDSLESY 114
               D+     ++ +G+      +E   + +SA +   N P     T  +    +SL+  
Sbjct: 76  DQFLDQQYRRENTTLGE------WETKSDTLSAIEDILNEPSDTGITTVLDNFFNSLQDL 129

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           SKN     +   V +N   +    NT  + +       +  I+  +  +  +  +++ +N
Sbjct: 130 SKNPESLEVRAEVRENGISLTDTINTIYQHLDDQENQINSTIQSRVQQINSYADQISKLN 189

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
           + I     +   A+D  DQR++L+ ++SEI+ I+T   +N +  V  S G  L       
Sbjct: 190 NEIYRFELTGQTANDLRDQRNLLVDQLSEIVNINTYEDSNGNFRVDIS-GQAL------- 241

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV-PKGKI-KALLQIRDS-------VVPI 285
              +  N+YT++ ++      G +     G+ V P G I K LL +RD         +P 
Sbjct: 242 --VDGNNAYTMSIDNT-----GTIKWDLAGTPVNPTGGILKGLLDMRDGDGTNGVKGIPY 294

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP--Q 343
           ++ QL++ A  L   F+ +   AG      GL  + GI   +      I++T   NP  +
Sbjct: 295 YEQQLNQFAYNLATVFNAQHA-AG-----YGLDGSTGINFFN------ITDT-TYNPTAE 341

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP-VAGINTNVTLLE 402
           Y  N     D   ++   L  +   +    L     +  N   + D  ++G+N N T  +
Sbjct: 342 YAKNIQVSSD--ILADDGLQKIAAASSASSLPGDNTNVLNLIALRDTKISGLN-NGTFDD 398

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           +  + I  L  +   ++ +      +   +  +  +  GV+L EE++ ++K ++SY  S 
Sbjct: 399 FISSLISNLGVDAQQANQMQTNQSTMVKQVDYNRQSVSGVSLDEEMANMLKYQKSYEASA 458

Query: 463 KLIMFTDKMLQTLL 476
           ++I   D++L TL+
Sbjct: 459 RMITVMDELLDTLI 472


>gi|304397210|ref|ZP_07379089.1| flagellar hook-associated protein FlgK [Pantoea sp. aB]
 gi|304355359|gb|EFM19727.1| flagellar hook-associated protein FlgK [Pantoea sp. aB]
          Length = 549

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 91/187 (48%), Gaps = 16/187 (8%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           ++++ NA+ +V  F TSA+ +  ++   + ++   I  +    S++  +N  I K  TA+
Sbjct: 131 QSMLSNAQGLVSQFQTSAQYLNNMQNSVNADVGSSIKQVNTITSQIADLNKQIGKLSTAN 190

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
               +D LD+RD L+  ++ ++G+ T+ + +    V  ++G TL       +N +K +  
Sbjct: 191 GAAPNDLLDKRDQLVNTLNNVVGV-TVSQQDGGYTVSMANGLTL-------VNGDKSHDL 242

Query: 244 -TVTSESNPIFIDGVVVSSNQGSA-VPK-----GKIKALLQIRDSVVPIFQNQLDEMARV 296
             + S S+P       V    G+  +P+     G +  LL  R   + + QNQL ++A  
Sbjct: 243 VAMPSSSDPTRTTIGYVDKQAGNVEIPEKLITTGSLGGLLAFRSQDLDLAQNQLGQLAAA 302

Query: 297 LIGSFSE 303
              SF++
Sbjct: 303 FTTSFND 309


>gi|283780143|ref|YP_003370898.1| flagellar hook-associated protein FlgK [Pirellula staleyi DSM 6068]
 gi|283438596|gb|ADB17038.1| flagellar hook-associated protein FlgK [Pirellula staleyi DSM 6068]
          Length = 565

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 70/334 (20%), Positives = 140/334 (41%), Gaps = 34/334 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN----------- 49
           M+LL+    A N    +      +  NI NA+   Y+R+  + T +P             
Sbjct: 1   MTLLSTLQIANNSLIASQLGLQVVGNNIANANTPGYIRQQVVLTPAPTQRYGGLLLGLGV 60

Query: 50  -VTVVTQRSEN--KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
            V  V Q+++   +      L   +S   Q++     E+L   +S D   + + T +   
Sbjct: 61  EVQAVIQQTDRFLEERLRSALSDLASGEAQEKTYVQLESLLGELS-DTDLSTALTDFFGS 119

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
           ++D L       SE +    V+   + +  + +     V ++R D + +I+     +   
Sbjct: 120 VQDILNQPD---SESVRNLAVL-QGQSLAADISRMHERVGQLRTDINTQIDQTAVEINGH 175

Query: 167 LSELTVVNDAI---KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           ++E+  +N  I   +    S  DA    D+R ++L ++++I+ I+ I +   D+ VY   
Sbjct: 176 INEIAKLNVQILQAEGGGTSASDAVGLRDRRSIVLNELAQILDITAIEQPTGDVSVYVGG 235

Query: 224 GTTLFETVPRDINFEKMNSYTVT-SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
              +F+   R +  E+      T S    I  D  + SS+       GK+  L+  RD++
Sbjct: 236 DYLVFQGTARPVTIEQTTDRGQTVSRIKLIETDAPLFSSS-------GKLAGLVTSRDAI 288

Query: 283 VPIFQNQLDEMARVLIGSF----SEKDPIAGNSE 312
           +  F + L++ A  L+  F    S+   ++G S+
Sbjct: 289 LGGFLDSLNDFATTLVSEFNKVYSQGQGLSGYSQ 322


>gi|307823537|ref|ZP_07653766.1| flagellar hook-associated protein FlgK [Methylobacter tundripaludum
           SV96]
 gi|307735522|gb|EFO06370.1| flagellar hook-associated protein FlgK [Methylobacter tundripaludum
           SV96]
          Length = 612

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 87/187 (46%), Gaps = 19/187 (10%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIEL---EISNLRRFLSELTVVNDAIKFKT 181
           + ++  A+ + QNFNT   + ++IR   + +I     EI+ L   +++L V   A   KT
Sbjct: 131 QVLLSEADALAQNFNTIGGKFEEIRNLNNSDIGAKVNEINTLAAAIADLNVKIIANVGKT 190

Query: 182 ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMN 241
                 +D LD++D LL ++SE++ +S + + N    V+  +G  L       +N     
Sbjct: 191 QGLKQPNDLLDKQDALLSRLSEMVNVSVVPQKNGTSSVFIGNGQALV------LNGGAAT 244

Query: 242 SYTVTSESNPIFID-------GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
             T+ SE  P  ++       G +  +NQ   +  G +   L+ RD V+   Q +L ++A
Sbjct: 245 FTTLESELAPGKLEIGIQTANGTIDVTNQ---ISGGSLGGALRFRDEVLDPAQQKLGQVA 301

Query: 295 RVLIGSF 301
             L   F
Sbjct: 302 ASLAMEF 308


>gi|307945687|ref|ZP_07661023.1| flagellar hook-associated protein FlgK [Roseibium sp. TrichSKD4]
 gi|307771560|gb|EFO30785.1| flagellar hook-associated protein FlgK [Roseibium sp. TrichSKD4]
          Length = 617

 Score = 53.1 bits (126), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 86/194 (44%), Gaps = 6/194 (3%)

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           S+   SL S   + S      TV+ +AE +     TS  ++Q +R   D+E+  ++ ++ 
Sbjct: 111 SRFTTSLSSLINDPSSRTAQTTVVADAEALAYEIRTSYEQIQDLRQRTDRELAAQVEDIN 170

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS L  V   I+    +       LDQRD  L+ +S+ + ++  +  ++ + + T +G
Sbjct: 171 ALLSSLADVETDIRESNLADSSTAQLLDQRDRYLEDLSKYLDVNIKINVDDSLKITTRNG 230

Query: 225 TTLF-ETVPRDINFEKMNSYTVTSESNPIFI---DGVVVSSNQGSAVPKGKIKALLQIRD 280
             L  +     + F +       +   PI +    G      + SA   G I  L ++RD
Sbjct: 231 ELLLSDGQASKLTFTETPILKPGASGQPIMVRTPGGTEYDLVESSA--SGTIVGLAELRD 288

Query: 281 SVVPIFQNQLDEMA 294
            V    Q+QLD++A
Sbjct: 289 EVFIEAQDQLDQIA 302


>gi|126697802|ref|YP_001086699.1| putative flagellar hook-associated protein [Clostridium difficile
           630]
 gi|115249239|emb|CAJ67052.1| Flagellar hook-associated protein FlgK (or HAP1) [Clostridium
           difficile]
          Length = 436

 Score = 53.1 bits (126), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 94/230 (40%), Gaps = 44/230 (19%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MTTISPE------------- 48
           L ++ N A +  N   +   +I  NI N D   Y R+ T   T SP              
Sbjct: 4   LFSILNTANSGMNAHQKSIQTISHNISNLDTDGYSRQRTEFATNSPMYMPSLSNSIGRGQ 63

Query: 49  -----NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYN------ 97
                +VT VT R+ N + +D    A +   G              +S  D+YN      
Sbjct: 64  LGTGVHVTDVT-RARN-SFYDYQFRAEAHKYGN------------TVSKYDYYNTIETIL 109

Query: 98  NSPTHY-----ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADA 152
           N P+ Y     I       ES SK+++ D     V++NA  +    + S +++ K++ D 
Sbjct: 110 NEPSDYGISAGIDDFFKGWESLSKDINSDNKKSLVVENASNLATLISESYKKLDKLKGDI 169

Query: 153 DKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKIS 202
           D  I+ EI  +   L  L  +N +I   + S    +D LD+RD +L  +S
Sbjct: 170 DSNIDTEIKQINDMLKSLEDLNKSIDIISGSGSTPNDLLDERDRILDNLS 219


>gi|320353947|ref|YP_004195286.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
 gi|320122449|gb|ADW17995.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
          Length = 465

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 121/291 (41%), Gaps = 37/291 (12%)

Query: 27  NIENADNKNYVRRDTMTTISPENVTVVTQRS---ENKNMFDKVLHAHSSAIGQQRLLQS- 82
           NI NA  + Y R+    T S    T +TQ        +  D +  A+ + I +Q + QS 
Sbjct: 28  NITNAATEGYSRQTAHVTSS----TPLTQGGLTYGTGSAVDAIDRANDAFITRQLMAQSA 83

Query: 83  ----FEA----LKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
               +EA    L ++    D  +      I    D+ E  S N S     + V+  A ++
Sbjct: 84  TYGQYEAASTPLADIERILDIGDTGLASAIDSFFDAWEELSTNPSGVAERQQVVQEAADL 143

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
             + N  A+++ ++ +  +  IE  I +L   L ++  +N +I     +  DA+   DQR
Sbjct: 144 AYHCNQIAQQLDEVVSGINTSIESAIPDLNDQLRQIADLNQSIMRTELAGGDANTLRDQR 203

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDINFEKMNSYTVT 246
           D+L+Q+ SE  G +    +N  + +   +G  L        F T   D     +   ++T
Sbjct: 204 DLLVQQASETCGAAAYTDDNGMVCLQLQNGLPLVTGNVAASFSTAQVD----GLTQISLT 259

Query: 247 SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           S      +D      + G     G +K  L++RD  +P   + LD +A  +
Sbjct: 260 SAGTTFSLD----DQDFG-----GALKGWLEVRDVTLPELHSDLDRLAYTI 301


>gi|134095091|ref|YP_001100166.1| flagellar hook-associated protein FlgK [Herminiimonas
           arsenicoxydans]
 gi|133738994|emb|CAL62042.1| putative flagellar hook-associated protein 1 FlgK-like
           [Herminiimonas arsenicoxydans]
          Length = 659

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 86/189 (45%), Gaps = 19/189 (10%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           + ++  AE +V  F +   ++  +R   + EI   ++N+  +  ++  +NDAI K +  S
Sbjct: 131 QAMLSGAEALVARFQSLDGQLTGMRNGVNSEIAGAVTNINAYAKQIGQLNDAISKAQNGS 190

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDI 235
               +D LDQRD+L+ ++++   + T+V+ + +  V+  +G  L           VP   
Sbjct: 191 GQPPNDLLDQRDLLIGELAKQSKV-TLVQQDGNYNVFIGNGQPLVVGLSTYELTAVPSST 249

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
           +  +M    + +    I  +         S++  G +  L + R   +   QN L  +A 
Sbjct: 250 DPGRMQVGYIANGKTVILPE---------SSLTGGNLGGLFEYRSKTLDPIQNSLGRIAL 300

Query: 296 VLIGSFSEK 304
            L  +F+E+
Sbjct: 301 GLASTFNEQ 309


>gi|150388562|ref|YP_001318611.1| flagellar hook-associated protein FlgK [Alkaliphilus
           metalliredigens QYMF]
 gi|149948424|gb|ABR46952.1| flagellar hook-associated protein FlgK [Alkaliphilus
           metalliredigens QYMF]
          Length = 493

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 85/391 (21%), Positives = 170/391 (43%), Gaps = 51/391 (13%)

Query: 110 SLESYSKNLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
             E  SKN  E I  +TV+ +         N + ++++K+  D + +I   +S++  +  
Sbjct: 122 GFEELSKN-PESITARTVVRERGIAFTNTMNQTYKQLEKLAKDVNSDINATVSSINSYAD 180

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND------MVVYTS 222
           ++  +N  I    A    A+D  D+R++L+  +S+++ +   VR+ ND      MVV  +
Sbjct: 181 QIAELNKQIYRFEADGSSANDLRDRRNLLIDDLSKLVNVE--VRDVNDGYGSSKMVVQIN 238

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPI---FIDGVVVSSNQGSAVPKGKIKALLQIR 279
               +       ++     S T   E N     + +G VV  NQ S   KG++ ALL +R
Sbjct: 239 GQPLVNHDQAYKLDATATKSSTFDDEINMTEIKWANGSVV--NQDSL--KGELGALLTLR 294

Query: 280 DSV------VPIFQNQLDEMARVLIGSFSEK-DPIAGNSENVPG----LFIADGIKDLDN 328
           D        +P +  QL++     +GSF++  + I  +  ++ G     F  DG     N
Sbjct: 295 DGTTKDNKGIPFYIEQLND----FVGSFAKAVNGIHEDGLDLDGDEGVAFFTDG-----N 345

Query: 329 KLCQGISETICVNPQYRSNPSFLRDG--GSVSKKFLWNVKNLAGYPDLINHYCDSF-NKN 385
              Q  ++ I ++ +   +P  +     G + +  + +  N     +L  H   SF N  
Sbjct: 346 TGDQITAKNIQISLEIDRDPRKIAAATMGELGEPVVGDGSNALRLTEL-RHAQMSFDNGE 404

Query: 386 FIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQ 445
           F   P           ++  + I  L  N  ++  +     ++ N I     +  GV+L 
Sbjct: 405 FKGTPE----------DFMISLIANLGVNTQEATRMASNQSILTNQIDRQRQSISGVSLD 454

Query: 446 EELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           EE++ +++ + +YN S +++   D+M+  ++
Sbjct: 455 EEMANMVRFQHAYNASARMVTTMDEMIDVII 485


>gi|326202857|ref|ZP_08192724.1| flagellar hook-associated protein FlgK [Clostridium papyrosolvens
           DSM 2782]
 gi|325986934|gb|EGD47763.1| flagellar hook-associated protein FlgK [Clostridium papyrosolvens
           DSM 2782]
          Length = 544

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 105/542 (19%), Positives = 205/542 (37%), Gaps = 103/542 (19%)

Query: 17  ASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMFDKVLHAHSSAIG 75
           A +   ++  N+ NA    Y R+ T+ + S P  V   T           ++   S A G
Sbjct: 18  AQRNLDTVGHNLSNATTPGYSRQQTIQSASNPLAVLDGT----------GMVGTGSQATG 67

Query: 76  QQRLLQSFEALK---------------EMMSADDHYNNSPTH-----YISKLRDSLESYS 115
            QR+  S+   K               E+M       N P+       +    DSL+  S
Sbjct: 68  VQRIRDSYLDFKYWSENVASGEWSKKAELMGEIQVTFNEPSKSGFVKIMEGFFDSLQELS 127

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
           K+ S       V+  A  + + FN +A   ++ + D + +++ ++  +    S++ ++N 
Sbjct: 128 KDPSSGAARALVVQKATTLTKYFNNTATHFEQFQNDLNDQVKTDVDQINIIASQIQLLNK 187

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST------IVRNNNDMVVY--TSDGTTL 227
            I     +   A+D  D R  L+ ++S++  I         + N  D V +  T  G TL
Sbjct: 188 QIYNYELTSGTANDLRDSRTKLVDQLSKLANIQAKEISYGKLPNGEDDVHFQITLGGKTL 247

Query: 228 ---FETVPRDI--NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS- 281
              F +   ++     K+N+  + +  +  + DG  V+      +  G+++ LL +RD  
Sbjct: 248 VDHFSSTKLNVVQRTTKLNAEDIGNLYDIKWEDGNSVN------ISGGELRGLLDVRDGK 301

Query: 282 ----------VVPIFQNQLDEMARVLIGSFSEK---------------------DPIAGN 310
                      VP +Q +L+E  +    +F+E                      DP   +
Sbjct: 302 DGIDGTPIYKGVPYYQKKLNEFVQTFAIAFNEGYTKTNSGYAHTDVGHIDGYGYDPDLTD 361

Query: 311 SENVPG---LFIADGI-------KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
           +   P     F   G+        DL   +  G S+   +N   +          SVS  
Sbjct: 362 ANTAPTGIRFFTMLGVGNTPISSADLIAGVTVGKSDPDYINQVAQQYKQITAKNFSVSSD 421

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLL------EYARNSIGWLEKN 414
            + N  N+A      +          +   + GI TN +L       ++ ++ +  +  +
Sbjct: 422 IIDNPNNIAA-----SETTGQNGNTGVLKKLMGIRTNQSLFKEGAPEDFMKSLVAGMGID 476

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +    +    +   +     +  GVNL EE++ +IK +QSYN + ++I+   ++  T
Sbjct: 477 AQQAETFAITQDTLVRQVDNRRMSVSGVNLNEEMTNMIKFQQSYNAAARMIVTMGQIYDT 536

Query: 475 LL 476
           L+
Sbjct: 537 LI 538


>gi|170694400|ref|ZP_02885554.1| flagellar hook-associated protein FlgK [Burkholderia graminis
           C4D1M]
 gi|170140823|gb|EDT08997.1| flagellar hook-associated protein FlgK [Burkholderia graminis
           C4D1M]
          Length = 657

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/331 (19%), Positives = 136/331 (41%), Gaps = 45/331 (13%)

Query: 16  NASQ-QFASIVRNIENADNKNYV----------RRDTMTTISPENVTVVT-QRSENKNMF 63
           NA+Q    +  +NI NA    Y            + T +   P+ V+ VT  R  ++ + 
Sbjct: 13  NAAQWGLTTTGQNISNASTPGYTIETPVFAETGGQYTGSGFLPQGVSTVTVTRQYSQYLT 72

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPT----HYISKLRDSLESYSKNLS 119
            ++ +A SS+        S      ++S  ++   SPT      I+     +++ S N S
Sbjct: 73  TQLNNAQSSS-------SSLATYNSLISQLNNLVGSPTAGLASAITGYFTGMQNVSNNAS 125

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                +T +  A+ +    N + ++   +R   + ++   +S +  +  ++  +N  I  
Sbjct: 126 SLATRQTAMSGAQTLANQINAAGQQYDALRESVNTQLSNTVSQINSYTQQIAQLNGQISA 185

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETV 231
            +      +  LDQRD+ +  +S++IG+  +V +N    V+ S+G  L          T 
Sbjct: 186 ASTQGQPPNQLLDQRDLAVSNLSQLIGVQ-VVNSNGSYGVFMSNGQPLVSGGNSFNLGTA 244

Query: 232 PRDINFEKMN-SYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
           P   +  +++  Y   + +NP     ++  S     +  G +  LL  R   +   + QL
Sbjct: 245 PSTGDSSELSVQYLGQAGANPAAAPQILPDSK----IDGGTLGGLLAFRSQTLDPAEAQL 300

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIAD 321
             +A     SF+ +     N++N  G+ +A 
Sbjct: 301 GAIAV----SFASQV----NAQNALGITLAG 323


>gi|293395589|ref|ZP_06639872.1| flagellar hook-associated protein FlgK [Serratia odorifera DSM
           4582]
 gi|291421908|gb|EFE95154.1| flagellar hook-associated protein FlgK [Serratia odorifera DSM
           4582]
          Length = 549

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/324 (19%), Positives = 147/324 (45%), Gaps = 40/324 (12%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRR----------DTMTTISPENVTVVT 54
           ++ N A +  N A    +++  NI N +   Y R+           TM+      VTV +
Sbjct: 4   SLINTAMSGLNAAQVALSTVSNNISNYNVAGYNRQTAILAQNGGMGTMSGFIGNGVTVTS 63

Query: 55  -QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  N+ + +++  A S A       +    +  +++      N+ +  +     +L++
Sbjct: 64  VNREYNQFITNQLRGAQSQAGAHDAYFEKVSQIDNLLA---DKTNTLSSSMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE---LEISNLRRFLSEL 170
              N  +D    TV+  A  +V  FN + + ++ + +  ++++    ++I+N  + +++L
Sbjct: 121 LVSNAGDDASRNTVLGKANGLVNQFNNTDKYLRDMESGVNQQLSDSAVQINNYSQQIAKL 180

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
               D  + + +   + +  LDQRD L+ ++++I+G+    ++ +   V  ++G TL   
Sbjct: 181 N--QDITRLRGSGGGEPNALLDQRDQLVSELNQIVGVQVTQQDGDAYSVSFANGLTL--- 235

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDG--VVVSSNQGSA---VPKGKI-----KALLQIRD 280
                  +  N+Y V  E+ P   D   + +  N+GS    +P+G+I       +L+ R 
Sbjct: 236 ------VQGNNAYQV--EAMPSSQDPSRLTLGYNRGSGASEIPQGQIVSGSVSGVLKFRS 287

Query: 281 SVVPIFQNQLDEMARVLIGSFSEK 304
             +   +NQL ++A  +  +F+++
Sbjct: 288 EALDSARNQLGQIALAMADNFNQQ 311


>gi|297570285|ref|YP_003691629.1| flagellar hook-associated protein FlgK [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296926200|gb|ADH87010.1| flagellar hook-associated protein FlgK [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 870

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 116/267 (43%), Gaps = 32/267 (11%)

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIG----QQRLLQSFEAL---KEMMSADDHYN 97
           +SP+ +T    RS ++ M +++    SS +G    QQ+ L+  E +      ++ +D  N
Sbjct: 61  VSPDTIT----RSYDQFMVERITR-QSSLMGNLQAQQQSLRVVEPIFNEARGLAMNDLLN 115

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE 157
                +  +L D+ ES +         + V+ N   +  +F T   E+ + R+D    I+
Sbjct: 116 QFWNSW-QELSDNPESLAAR-------QNVLQNGHLLSDHFKTMNDEIIRARSDIGTNID 167

Query: 158 LEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDM 217
             + ++    S++  +N  I     +K +A+D  DQRD L+++++ ++ IS     N   
Sbjct: 168 TAVGDINSLTSQIAALNSRITSAEVAKAEANDLRDQRDNLVKELAGLVEISHFASKNGTY 227

Query: 218 VVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVV--VSSNQGSAVPKGKIKAL 275
            V  ++G  L E        E        ++ N +  DG    VS     A   GK+   
Sbjct: 228 TVLMANGHPLVE------GDEAWQVSWSDNQLNWVSTDGSGKKVSRPLTGAQLGGKMGGW 281

Query: 276 LQIRDSVVPI----FQNQLDEMARVLI 298
           L+I   + P     +  +LD +A  LI
Sbjct: 282 LEIHSELAPGNPNNYAGRLDALANALI 308



 Score = 43.5 bits (101), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 35/54 (64%)

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           +V N ++E      GV+L EE++ LIK + +Y  + +LI  +D+ML TLL+ V+
Sbjct: 817 LVLNQMNEMRDTVSGVSLDEEMANLIKFQHAYTAAARLISTSDEMLVTLLDTVR 870


>gi|57169005|ref|ZP_00368134.1| flagellar hook-associated protein 1 (HAP1) (flgK) [Campylobacter
           coli RM2228]
 gi|305432258|ref|ZP_07401421.1| flagellar hook-associated protein FlgK [Campylobacter coli JV20]
 gi|57019671|gb|EAL56360.1| flagellar hook-associated protein 1 (HAP1) (flgK) [Campylobacter
           coli RM2228]
 gi|304444606|gb|EFM37256.1| flagellar hook-associated protein FlgK [Campylobacter coli JV20]
          Length = 608

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  +Q ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIGSDGENNNVVNASNQTLYNSVYSEYQSKSGVNTNEELAALIQWQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVTTVDQMLDTLL-GLK 607


>gi|238799422|ref|ZP_04642851.1| hypothetical protein ymoll0001_16400 [Yersinia mollaretii ATCC
           43969]
 gi|238716726|gb|EEQ08613.1| hypothetical protein ymoll0001_16400 [Yersinia mollaretii ATCC
           43969]
          Length = 549

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 102/212 (48%), Gaps = 11/212 (5%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++
Sbjct: 113 LQNLVSNAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKITESVTKINNYSEQI 172

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I + + +S  + +  LDQRD L+ ++++I+G++   ++ +   V  ++G  L +
Sbjct: 173 AKLNDQITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVAFANGLPLVQ 232

Query: 230 TVPRDINFEKMNSYTVTSESNPIFI-----DGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                    K+ +   +S++  + I      G V+  ++ S +  G +   L+ R   + 
Sbjct: 233 GSSS----HKIEAIASSSDATRLAIGYKYGSGDVMEVDE-SRLATGSLGGTLKFRSEALD 287

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPG 316
             +NQL ++A  +  SF+ +     +    PG
Sbjct: 288 SARNQLGQLALAMADSFNTQHKAGFDINGDPG 319


>gi|332798814|ref|YP_004460313.1| flagellar hook-associated protein FlgK [Tepidanaerobacter sp. Re1]
 gi|332696549|gb|AEE91006.1| flagellar hook-associated protein FlgK [Tepidanaerobacter sp. Re1]
          Length = 459

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/374 (20%), Positives = 149/374 (39%), Gaps = 48/374 (12%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
            LE+ SK+ +     +TV +    +    N +  ++  I +D +  I ++++ +    ++
Sbjct: 122 GLETLSKDAASQEARETVKEKGITLANTINHAVTQLNDIVSDINYRISIQVNEVNSIANQ 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N  I+        A D  D RD+LL ++S ++   +    N   +   + G  +  
Sbjct: 182 IAQLNLQIRQAETGGASAADLKDSRDLLLDQLSNLVQFESYEDENG--IFSINVGGAILV 239

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQ 287
             P   N E   S            +G +      S V   KG++K L+++RD  +  + 
Sbjct: 240 KGPDSANMEFDTSVA----------NGTIKWKEYSSDVRILKGELKGLIELRDDKLENYL 289

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
           +QLD+  +     F+       N +   G+           K  +  +  + VNP   SN
Sbjct: 290 DQLDKFTQTFADEFNAIHETGYNLDGETGI-----------KFFEYANGVLSVNPDIVSN 338

Query: 348 PSFL-----RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
           PS +      DG     +    + NL      I+       +N   D   G     T++ 
Sbjct: 339 PSKIAAAEEEDGIPSDNRIALELANLRYKTISID------GRNCTIDDYYG-----TII- 386

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
            A+  +   E  R+      M SQ     + E    T  V+L EE++ +I+    YN ++
Sbjct: 387 -AKIGVDSQEATRAADSQAFMVSQ-----LDERRQMTSSVSLDEEMTKMIQYLHGYNAAS 440

Query: 463 KLIMFTDKMLQTLL 476
           +++   D+ML T++
Sbjct: 441 RIVTTVDEMLDTII 454


>gi|307265481|ref|ZP_07547036.1| flagellar hook-associated protein FlgK [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919435|gb|EFN49654.1| flagellar hook-associated protein FlgK [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 480

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 106/499 (21%), Positives = 205/499 (41%), Gaps = 102/499 (20%)

Query: 27  NIENADNKNYVRRDT-MTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQ-------- 77
           NI NA+   Y R+   M +I+P              M+D+   A    +  Q        
Sbjct: 27  NIANANTTGYTRQVVDMASIAPPTTF---------GMYDQWGKAIGEGVKIQDIRQIRDQ 77

Query: 78  ----------RLLQSFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDI 122
                     + L  +E   ++++A ++  N P+       ++   +SL+  +KN     
Sbjct: 78  FLDNQYRRENKFLGEWETKAQVLAAVENIFNEPSDSGISTVLNDFFNSLQELAKNPESLT 137

Query: 123 LGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA 182
           +   V + A  +   FNT  + +     + +  I+  I+ +  +   ++ +N+ I     
Sbjct: 138 VRAEVRERAIALADTFNTVYQHLNDKLNELNSTIQSRIAEINSYADRISKLNNEIYRFEL 197

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-----DGTTLFETVPRDINF 237
           S   A+D  DQR++L+ ++S+++ I+T   +N +  +  +     DG+T F      +  
Sbjct: 198 SGQTANDLRDQRNLLVDQLSKLVNITTYEDSNGNFRIDIAGQALVDGSTAFT-----MGI 252

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAV--PKGKIKALLQIRDS-------VVPIFQN 288
           +K               DG VV    GS+V    G +K LL +RD         +P + N
Sbjct: 253 DK---------------DGKVVWDLTGSSVNPSSGILKGLLDMRDGDGSNGIKGIPYYIN 297

Query: 289 QLDEMARVLIGSFSEKDPIAG----NSENVPGLF--IADGIKDLDN-----KLCQGISET 337
           + +++A  +  + +E    AG    +S N+P LF   AD    +       K+   I ++
Sbjct: 298 EWNKLAYSIAQAINEVHK-AGYGLDSSTNIP-LFTDFADPYDPVVKYAQLIKVSSDILDS 355

Query: 338 ICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
             +     ++ S    G + +   L N+++  G P+L     D F               
Sbjct: 356 NGLQKIAAASSSATLPGDNTNALLLINLRD-QGIPELDGATFDDF--------------- 399

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
                 AR+ I  L  +   ++ +    QV+   I  +  +  GV+L EE++ +IK ++S
Sbjct: 400 ------ARSLISNLGVDAQQANMMQQNQQVMVKQIDLNRQSVSGVSLDEEMTNMIKYQKS 453

Query: 458 YNISNKLIMFTDKMLQTLL 476
           Y  S ++I   D++L TL+
Sbjct: 454 YAASARVITAMDELLDTLI 472


>gi|167464316|ref|ZP_02329405.1| flagellar hook-associated protein FlgK [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 519

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 82/419 (19%), Positives = 165/419 (39%), Gaps = 78/419 (18%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           DS   +SK+  ++   K +  NA  + +  N ++++++ I    DK + ++I ++   L 
Sbjct: 126 DSWAEFSKDSDKNTGRKLIRQNAIALTEAINQASKQIKDISQGLDKSLNMKIEDVNSILK 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            ++ +N+ I         A+D  D+RD +  ++S+++ I+             S+G   +
Sbjct: 186 TISTLNNEITRVEKMGDHANDLRDERDRMTDELSKMMNIT------------VSEGPEGY 233

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                +I+  K+N  + T E NP+  + +  S   G  +  G++  L+  RD+ V  ++ 
Sbjct: 234 -----NISMGKVNLLSGT-EVNPVTKESIEESFKSGD-LSSGELAGLITSRDTYVHDYKK 286

Query: 289 QLDEMARVLI-GSFSEKDP----------------------------------------- 306
           QLD++A  +  G  +   P                                         
Sbjct: 287 QLDDIANTIANGEITITIPKGSVLPEGTVLDGVTYTGANRTLTEDLTVTVKGLNGLHQLG 346

Query: 307 -IAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP-----SFLRDGGSVSKK 360
            I GN     G F     KD  + +    +E IC+NP   ++P     S   +G    +K
Sbjct: 347 YINGNPPEAGGPFFT--TKDGSDVIT---AENICLNPDIINDPNKIASSMATEGTGADEK 401

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
            +     LA    L+    D+    F F       TN T+ ++  + +G L     ++  
Sbjct: 402 LISGNNTLA---KLMAQLKDT---KFTFSGAGRGITNSTINDFYGSLVGQLGVQSKEATR 455

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            +     +        ++  GV   EE+  ++K   S+N + + +   D++L  L+ G 
Sbjct: 456 QYENEGKLVVQADTRRTSVSGVVELEEMMEMVKYNHSFNAAARFMTTYDEILNKLINGT 514


>gi|332533169|ref|ZP_08409038.1| flagellar hook-associated protein FlgK [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037451|gb|EGI73905.1| flagellar hook-associated protein FlgK [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 667

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 71/151 (47%), Gaps = 23/151 (15%)

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +  DA    ++RD  ++ +SE+I I T+   N + +V+   G  +       +     
Sbjct: 181 TNNAADASSTYNERDKAIRDLSELIDIETLDGPNGEKLVFMGTGEAVV------MQNGAF 234

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP--------KGKIKALLQIRDSVVPIFQNQLDE 292
           N +++T + +P F +   +  N G AVP        KGKI  LL  RD ++   QNQ+ +
Sbjct: 235 NLFSMTGDPDPNFKE-FTLDVNGGKAVPLEVDVSKLKGKIGGLLAFRDDILVPAQNQIGQ 293

Query: 293 MARVLIGSFSEKDP--------IAGNSENVP 315
           M   +  +F+E++         + GN  N+P
Sbjct: 294 MGLAIADAFNEQNKLGMDATGQLGGNIFNIP 324


>gi|254524155|ref|ZP_05136210.1| flagellar hook-associated protein FlgK [Stenotrophomonas sp. SKA14]
 gi|219721746|gb|EED40271.1| flagellar hook-associated protein FlgK [Stenotrophomonas sp. SKA14]
          Length = 626

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 120/303 (39%), Gaps = 32/303 (10%)

Query: 19  QQFASIVRNIENADNKNYVRRDT-MTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQ 77
           +  A+   N+ N +   Y R+     T  P+N    T  +  + + D    A   AI   
Sbjct: 17  RALATTSHNVANLNTPGYSRQKVNFATADPQNYGYGTIGNGTR-ITDIRRTADQLAI--S 73

Query: 78  RLLQS---FEALKEMMSADDHYNN-------SPTHYISKLRDSLESYSKNLSEDILGKTV 127
           RLL S      LK++    D  N+       +     S   DS+   S N S     + +
Sbjct: 74  RLLDSSGELARLKQLSGMADRVNSLFSEGATNIAGVWSNFFDSVSGLSSNASGTADRQNM 133

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           +D  + +   F      +  +  + +  +    + + R   E+  +N AI    A+   A
Sbjct: 134 LDGGKALANRFVQLNTHLNNLNGEVNNGLLAGATEVNRLAQEIAQINGAIGTNIANA--A 191

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY---- 243
            D LD+RD L+ ++    G + ++++   M VYT+ G  L             + Y    
Sbjct: 192 PDLLDRRDQLITQLIGYTGGTAVIQDGGIMNVYTAGGNALVVGTTATKVTTVADPYQPER 251

Query: 244 ---TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
               + ++ N I +D   V          G+I  LL+ RD+V+   Q +L ++A  L  +
Sbjct: 252 LQLALETQGNTIRLDAKAVG---------GQIGGLLEFRDTVLTPAQAELGKLAVGLAET 302

Query: 301 FSE 303
           F++
Sbjct: 303 FNQ 305



 Score = 44.3 bits (103), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 418 SHDLHMKSQVVFNHISESYSNTV-GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           S +  +++Q+V N  ++   + V GVNL EE + +++++Q+Y  +++LI   D M QT+L
Sbjct: 562 SAEYSLEAQLVINDKAQEARDEVSGVNLDEEAADMLRLQQAYQAASQLISTADSMFQTIL 621

Query: 477 EGVK 480
             V+
Sbjct: 622 GAVR 625


>gi|157371201|ref|YP_001479190.1| flagellar hook-associated protein FlgK [Serratia proteamaculans
           568]
 gi|157322965|gb|ABV42062.1| flagellar hook-associated protein FlgK [Serratia proteamaculans
           568]
          Length = 548

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/322 (20%), Positives = 144/322 (44%), Gaps = 37/322 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRR----------DTMTTISPENVTVVT 54
           ++ N A +  N A    +++  NI N +   Y R+           TM       VTV +
Sbjct: 4   SLINTAMSGLNAAQVALSTVSNNISNYNVAGYNRQTAILAQNGGMSTMNGFIGNGVTVTS 63

Query: 55  -QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  N+ + +++  A S A  Q    +    +  ++++     N+ +  +     +LE+
Sbjct: 64  VNREYNQFITNQLRGAQSQAGAQNAYFEKISQIDNLLASK---TNTLSTNMQDFFSNLEN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   +TV+  A  +V  FN + + ++ + +  ++++    + +  +  ++  +
Sbjct: 121 LVSNAGDDAARQTVLGKANGLVNQFNNTDKYLRDMDSGVNQQLSDSATQINSYSQQIAKL 180

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           ND I     S  + +  LDQRD L+ ++++++G+    ++ +   V  ++G TL      
Sbjct: 181 NDEITRLRGSGGEPNALLDQRDQLVTELNQVVGVQVTQQDGDAYTVSFANGLTL------ 234

Query: 234 DINFEKMNSYTVT---SESNPIFIDGVVVSSNQG---SAVPKGKI-----KALLQIRDSV 282
               +  N+Y V    S  +P  +    +  N+G   S VP+G+I       +L+ R   
Sbjct: 235 ---VQGNNAYQVEAIPSSGDPARL---TIGYNRGNGVSEVPEGQITSGSVSGVLKFRTES 288

Query: 283 VPIFQNQLDEMARVLIGSFSEK 304
           +   +NQL ++A  +  SF+++
Sbjct: 289 LDGARNQLGQLALAMADSFNQQ 310


>gi|238785491|ref|ZP_04629474.1| hypothetical protein yberc0001_18240 [Yersinia bercovieri ATCC
           43970]
 gi|238713593|gb|EEQ05622.1| hypothetical protein yberc0001_18240 [Yersinia bercovieri ATCC
           43970]
          Length = 549

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 98/200 (49%), Gaps = 11/200 (5%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++
Sbjct: 113 LQNLVSNAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKITESVTKINNYAEQI 172

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I + + +S  + +  LDQRD L+ ++++I+G++   ++ +   V  + G  L +
Sbjct: 173 AKLNDQITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVAFASGLPLVQ 232

Query: 230 TVPRDINFEKMNSYTVTSESNPIFID-----GVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                    K+ +    S++  + I      G V+  ++ S +  G +   L+ R   + 
Sbjct: 233 GSSS----YKVEAIASGSDATRLAIGYKYGSGDVMEVDE-SRLATGSLGGTLKFRSEALD 287

Query: 285 IFQNQLDEMARVLIGSFSEK 304
             +NQL ++A V+  SF+ +
Sbjct: 288 SARNQLGQLALVMADSFNTQ 307


>gi|322382414|ref|ZP_08056317.1| FlgK-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153631|gb|EFX46010.1| FlgK-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 472

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 82/419 (19%), Positives = 165/419 (39%), Gaps = 78/419 (18%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           DS   +SK+  ++   K +  NA  + +  N ++++++ I    DK + ++I ++   L 
Sbjct: 79  DSWAEFSKDSDKNTGRKLIRQNAIALTEAINQASKQIKDISQGLDKSLNMKIEDVNSILK 138

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            ++ +N+ I         A+D  D+RD +  ++S+++ I+             S+G   +
Sbjct: 139 TISTLNNEITRVEKMGDHANDLRDERDRMTDELSKMMNIT------------VSEGPEGY 186

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                +I+  K+N  + T E NP+  + +  S   G  +  G++  L+  RD+ V  ++ 
Sbjct: 187 -----NISMGKVNLLSGT-EVNPVTKESIEESFKSGD-LSSGELAGLITSRDTYVHDYKK 239

Query: 289 QLDEMARVLI-GSFSEKDP----------------------------------------- 306
           QLD++A  +  G  +   P                                         
Sbjct: 240 QLDDIANTIANGEITITIPKGSVLPEGTVLDGVTYTGANRTLTEDLTVTVKGLNGLHQLG 299

Query: 307 -IAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP-----SFLRDGGSVSKK 360
            I GN     G F     KD  + +    +E IC+NP   ++P     S   +G    +K
Sbjct: 300 YINGNPPEAGGPFFT--TKDGSDVIT---AENICLNPDIINDPNKIASSMATEGTGADEK 354

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
            +     LA    L+    D+    F F       TN T+ ++  + +G L     ++  
Sbjct: 355 LISGNNTLA---KLMAQLKDT---KFTFSGAGRGITNSTINDFYGSLVGQLGVQSKEATR 408

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            +     +        ++  GV   EE+  ++K   S+N + + +   D++L  L+ G 
Sbjct: 409 QYENEGKLVVQADTRRTSVSGVVELEEMMEMVKYNHSFNAAARFMTTYDEILNKLINGT 467


>gi|39998134|ref|NP_954085.1| flagellar hook-associated protein FlgK [Geobacter sulfurreducens
           PCA]
 gi|39985080|gb|AAR36435.1| flagellar hook-associated protein FlgK [Geobacter sulfurreducens
           PCA]
          Length = 477

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 90/405 (22%), Positives = 173/405 (42%), Gaps = 36/405 (8%)

Query: 86  LKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGK----TVIDNAEEVVQNFNTS 141
           L  M  A+  +N   T  + K      S  ++L+ +  G+     ++   +++   F   
Sbjct: 91  LASMTRAEQLFNEFTTDGLGKSLQDFFSAWQDLTANPQGQPERQAILARGQQLADQFKRV 150

Query: 142 AREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKI 201
              +  IR +A++ +E   +++   L ++  +N+ IK        A++  DQRD+ ++++
Sbjct: 151 NSYLNDIRTEANQSLEGVTADVNDKLRKIASLNEQIKQIEVQGARANELRDQRDLAVRQL 210

Query: 202 SEIIGISTIVRNNNDMVVYTSDGTTLF---ETVPRDINFEKMNS--YTVTSESNPIFIDG 256
           +E +GI+ + + +  + V  S G  L    +     +  +  NS  Y + S + P     
Sbjct: 211 AEKVGITYMEQTDGTLNVSLSLGQPLVLGKDAAVLSLQPDAANSGFYRIYSTA-PGGKTA 269

Query: 257 VVVSS-NQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
           V +SS   G    +G++   LQ+RDS+V  F   LDE+A  L    +             
Sbjct: 270 VDISSIVGGPGNGQGEMGGTLQVRDSLVNGFLADLDELAYTLATEVNAVHSSGFGLTGST 329

Query: 316 GL-FIADGIKDLDNKLCQGISETICVN---PQYRSNPSFLRDGGSVSKKFLWNVKNLAGY 371
           GL F +            GIS  I  +       ++PS    GG+ +     N K++A  
Sbjct: 330 GLDFFSTPATMAGYSGLGGISVAISNSNDIAAANADPSV---GGTGNNT---NAKDIASL 383

Query: 372 PDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNH 431
            D I              P++G   N+TL  +  + +G +  +  ++      S+ V   
Sbjct: 384 FDKIL-------------PLSG--GNMTLGGFYNSLVGKVGVSVQNAERSATLSEGVLKQ 428

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +     +  GV+L EEL+ LIK ++++  + KLI    +M+  +L
Sbjct: 429 LDNLRESQSGVSLDEELANLIKYQKAFEGAAKLINTGTEMMDVIL 473


>gi|224534287|ref|ZP_03674865.1| flagellar hook-associated protein FlgK [Borrelia spielmanii A14S]
 gi|224514389|gb|EEF84705.1| flagellar hook-associated protein FlgK [Borrelia spielmanii A14S]
          Length = 627

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/294 (20%), Positives = 128/294 (43%), Gaps = 26/294 (8%)

Query: 23  SIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQ---- 77
           ++  N+ NA    Y R R TMTT +P     + +  +   +   ++      +  +    
Sbjct: 24  TVGHNLSNATKPGYSRQRVTMTTTTPLYAPQLNRAKKQGQLGQGIMVQSIDRVKDELLNT 83

Query: 78  RLLQSFEALKEMMSAD-------DHYNNSPTHYISK-LRDSLESYSKNLSEDILG----K 125
           R+++    L    S D       D YN      I K L D  ES+ ++L+    G    K
Sbjct: 84  RIIEESHRLGYWTSQDKFISMLEDVYNEPEDQSIRKRLNDFWESW-QDLANQPQGLAERK 142

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            +++  +   +   +    +++I   A+ EI++       ++  +  +N  I    A K 
Sbjct: 143 IILERGKSFCEGIRSRFHSLERIYTMANDEIKITTDEANNYIRNIANLNKQISKSQAMKD 202

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYT 244
           + +D +D RD++++K+  +I +S   + + +  +  S+G  L + ++  +   E  N  T
Sbjct: 203 NPNDLMDARDLMVEKLGNLINVSIENKQDPNEFLIHSEGRHLVQGSIANEFRLEATNGPT 262

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            T          ++ ++N  + +  GK+ +L+ IRD  +    N+L+ +A  +I
Sbjct: 263 RTRWD-------ILWTNNDKAHLKTGKLGSLINIRDEEIKNEINELNNLAANII 309


>gi|296157449|ref|ZP_06840284.1| flagellar hook-associated protein FlgK [Burkholderia sp. Ch1-1]
 gi|295892221|gb|EFG72004.1| flagellar hook-associated protein FlgK [Burkholderia sp. Ch1-1]
          Length = 657

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 100/232 (43%), Gaps = 24/232 (10%)

Query: 16  NASQ-QFASIVRNIENADNKNYVRRD----------TMTTISPENVTVVT-QRSENKNMF 63
           NA+Q    +  +NI NA    Y   +          T +   P+ V+  T  R  ++ + 
Sbjct: 13  NAAQWGLTTTGQNISNASTPGYTIENPVYAESGGQYTGSGYLPQGVSTTTVTRQYSQYLT 72

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS----LESYSKNLS 119
            ++ +A SS         S      ++S  ++   SPT  I+    S    L++ S N S
Sbjct: 73  TELNNAQSSG-------SSLSTYNTLISQLNNLIGSPTAGIASAITSYFTGLQNVSNNAS 125

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                +T +  A+ +V   N + ++   +R   + ++   +S +  +  ++  +N  I  
Sbjct: 126 SLATRQTAMSGAQTLVNQINAAGQQYDALRQSVNTQLTNTVSQINSYSQQIAQLNGQIAQ 185

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +      +  LDQRD+ +  +S++IG++ +V +N    V+ S+G  L  + 
Sbjct: 186 ASTQGQPPNQLLDQRDLAVSNLSQLIGVN-VVNSNGSYSVFMSNGQPLVSSA 236


>gi|118588734|ref|ZP_01546142.1| hypothetical protein SIAM614_18549 [Stappia aggregata IAM 12614]
 gi|118438720|gb|EAV45353.1| hypothetical protein SIAM614_18549 [Stappia aggregata IAM 12614]
          Length = 617

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 84/186 (45%), Gaps = 14/186 (7%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           K V+  AE   +  N S  ++  +R +AD  +  +  ++   L+ +  +++AI+  T S 
Sbjct: 131 KDVVSAAEAFAREINASYEQIADLRQEADNALASQTDSVNGLLASIEDIDEAIQSATQSG 190

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF-ETVPRDINFEKMNSY 243
               D  D+RD L++++S  + I     +NN + + T+ G  L+ +     + F   +  
Sbjct: 191 VSTADMEDERDRLIEQLSGYLDIDVSKNDNNSIAIRTAGGNQLYADGKASTLTFNATHLL 250

Query: 244 TVTSESNPIFID-------GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
                 N + +         ++ SS  GS      + A  ++RD ++   Q QLD +A  
Sbjct: 251 QPGQAGNSVMVRTPGGTQYDLIASSKSGS------MLATAELRDDILVEAQTQLDTIAAE 304

Query: 297 LIGSFS 302
           L  +FS
Sbjct: 305 LSLAFS 310


>gi|217076647|ref|YP_002334363.1| flagellar hook-associated protein 1 [Thermosipho africanus TCF52B]
 gi|217036500|gb|ACJ75022.1| flagellar hook-associated protein 1 [Thermosipho africanus TCF52B]
          Length = 847

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 74/177 (41%), Gaps = 9/177 (5%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + ++  AEE+V+N       ++++R D D EI   +  +   +  L  +N  ++   A K
Sbjct: 144 RELVSRAEELVKNVKDLYSRLEQLREDLDYEISQRVEQINGMVKRLADINSKVRLSMALK 203

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
              +D LD+RD +L  +S+   I      +  + +   D   L      D+N  +     
Sbjct: 204 STPNDLLDERDRILDDLSKFADIFYTEDASGQISLRIGDQIVL---TGSDVNELRALERP 260

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
                  IF+       N    +  G +KA + +RD ++  + N+LDE    L   F
Sbjct: 261 YGKGFKEIFV------GNSKVDIHDGSLKAAMDLRDDIIVKYMNRLDEFVLYLTDKF 311


>gi|238755319|ref|ZP_04616662.1| hypothetical protein yruck0001_10770 [Yersinia ruckeri ATCC 29473]
 gi|238706455|gb|EEP98829.1| hypothetical protein yruck0001_10770 [Yersinia ruckeri ATCC 29473]
          Length = 547

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 94/202 (46%), Gaps = 14/202 (6%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N S+D   KTV+  AE +V  F  + + +Q +    ++ I    + +  +  ++
Sbjct: 118 LQNLASNSSDDAARKTVLGKAEGLVNQFKNADKYLQDMNNGINQSINDSATKINNYAEQI 177

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I + + +S  + +  LDQRD L+ +++ II +S   ++ +   V  + G  L +
Sbjct: 178 ANLNDQITRLRGSSGSEPNALLDQRDQLVSELNTIIPVSVTQQDGDAYNVSFAGGLALVQ 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFI-------DGVVVSSNQGSAVPKGKIKALLQIRDSV 282
                   E  N   V S ++   +       +G  V+    S +  G +   L+ R   
Sbjct: 238 ------GSESYNVRAVPSSADGTRLTLGYDRGNGSEVAEVDESRISTGSLGGTLKFRSEA 291

Query: 283 VPIFQNQLDEMARVLIGSFSEK 304
           +   +NQL ++A  +  SF+++
Sbjct: 292 LDNARNQLGQLALAMADSFNQQ 313


>gi|51894116|ref|YP_076807.1| flagellar hook-associated protein [Symbiobacterium thermophilum IAM
           14863]
 gi|51857805|dbj|BAD41963.1| flagellar hook-associated protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 558

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 119/277 (42%), Gaps = 24/277 (8%)

Query: 25  VRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFE 84
           + NI NA++ NY RR     + P        R  +  +  +   A SSA G   +     
Sbjct: 27  LENIANANDPNYTRRTLENRVDPFGRLPEVVRMRDLFIDFQYRRAQSSA-GYASIRADLM 85

Query: 85  ALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSARE 144
           A  E +  D          I +  D+ ++ S++ ++++L    I+     VQ+ + +  +
Sbjct: 86  ARVEDIFGDP-IEGGLAQAIDRFFDAFKAVSEDPADEVLRIEAIEAGRRFVQHIHEAMSQ 144

Query: 145 VQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEI 204
           +  I++  +++I+  ++ +   L  L  +N  I     S   A D +DQRD +L +++ +
Sbjct: 145 LTLIKSQINEKIQGAVTEINAHLENLRNLNSRIATMVGSSEMAADLMDQRDRVLDELARL 204

Query: 205 IGISTIVRNNNDMVVYTSDGT--TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN 262
            G           V Y  DGT   +  +VP  ++   +N   V    N     G  V   
Sbjct: 205 TGAR---------VTYLEDGTVRVMIGSVPA-VDGTAINLLEVVEGEN-----GPTVKW- 248

Query: 263 QGSAVPK----GKIKALLQIRDSVVPIFQNQLDEMAR 295
           QG  +P     G + ALL++RD  +     ++D++A+
Sbjct: 249 QGFNLPAYSGHGVLSALLEMRDGDLQHVIAEVDKLAK 285


>gi|294339836|emb|CAZ88199.1| putative flagellar hook-associated protein FlgK [Thiomonas sp. 3As]
          Length = 667

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/214 (19%), Positives = 96/214 (44%), Gaps = 17/214 (7%)

Query: 27  NIENADNKNYVRRDTM-TTISPE-----------NVTVVTQRSENKNMFDKVLHAHSSAI 74
           NI N +   Y R   + +T++P             +  VT RS N  +  +V    ++A 
Sbjct: 28  NIANVNTPGYSRETAVQSTLTPSLYGGQYLGNGTQIDAVT-RSYNSYLQSQVWSTAATAS 86

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKL-RDSLESYSKNLSEDILGKTVIDNAEE 133
           G   L    + +  +++  D      +  I+K     +   + N ++    +++I  ++ 
Sbjct: 87  GANTLNTQIQPIANLIAGTDS---GLSTSINKFFASGVAQVAANPADLPSRQSLISQSQS 143

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQ 193
           + Q   TSA+++Q   +  ++++   ++ +     ++  +N  I   + +    +  LDQ
Sbjct: 144 LAQTIQTSAQQLQSAASGVNQQLGQSVTAINSLTQQIAQLNVQINTLSGAGSTPNSLLDQ 203

Query: 194 RDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
           RD L+ ++S  +G++ + +  N + V+T +G  L
Sbjct: 204 RDQLITQLSGQVGVTVLPQGGNQVNVFTGNGQVL 237


>gi|254504553|ref|ZP_05116704.1| flagellar hook-associated protein FlgK [Labrenzia alexandrii
           DFL-11]
 gi|222440624|gb|EEE47303.1| flagellar hook-associated protein FlgK [Labrenzia alexandrii
           DFL-11]
          Length = 631

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 86/187 (45%), Gaps = 22/187 (11%)

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
           + + +  NTS +++  +R +AD+ +  +   +   LS +  ++ AI+  T +   + +  
Sbjct: 138 DAMARELNTSYQQIADLRQEADEALARQTETVNSLLSNIESIDAAIRDATQAGVSSSEME 197

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF-ETVPRDINFEKMNSYTVTSESN 250
           D+RD L++++S  + ++      N + + T +G  LF +     + F+  N      + N
Sbjct: 198 DERDRLVEQLSGYLDLNVSKTTTNTLFIQTKNGQPLFSDGEAATLAFQSTNRLGADQQGN 257

Query: 251 PIFIDGVVVSSNQGSA----VPKGK-----------IKALLQIRDSVVPIFQNQLDEMAR 295
            I      V++  G A    VP G            + A +++RD V+   Q QLD +A 
Sbjct: 258 AI------VATTAGGAQFDIVPAGASGRDRTTGTGLMVATMELRDDVLIEAQKQLDTIAA 311

Query: 296 VLIGSFS 302
            L  +FS
Sbjct: 312 ELSLAFS 318



 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 73/153 (47%), Gaps = 10/153 (6%)

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA 392
           G +  I VNP   ++ S L D  +       N    A Y  L+N      N+   FDP A
Sbjct: 484 GYANGISVNPALLADSSLLVDYQTTPAANSENDPARAQY--LLNALT---NETAYFDPEA 538

Query: 393 GINTNV-----TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEE 447
           G+ ++      T+L+Y   ++ +     +D+       + +  +++  Y  +  VNL  E
Sbjct: 539 GMGSSSSPFQGTVLDYINQTVAYQGNQAADAKTYSDSKEALTLNLAVRYEESYSVNLDAE 598

Query: 448 LSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           ++FL+++E +Y+ + +++   + ++Q LL  V+
Sbjct: 599 MAFLVQLENAYSANARVMQTINDLMQELLNVVR 631


>gi|187926948|ref|YP_001893293.1| flagellar hook-associated protein FlgK [Ralstonia pickettii 12J]
 gi|241665277|ref|YP_002983636.1| flagellar hook-associated protein FlgK [Ralstonia pickettii 12D]
 gi|187728702|gb|ACD29866.1| flagellar hook-associated protein FlgK [Ralstonia pickettii 12J]
 gi|240867304|gb|ACS64964.1| flagellar hook-associated protein FlgK [Ralstonia pickettii 12D]
          Length = 645

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 94/220 (42%), Gaps = 25/220 (11%)

Query: 27  NIENADNKNYVRRDTMTT------------ISPENVTVVTQRSENKNMFDKVLHAHSSAI 74
           NI NA+   Y R++ + T                NVT V      K ++D+ L A     
Sbjct: 26  NIANANTPGYSRQEAVQTENIPLYAGVGYLGQGANVTTV------KRIYDQFLTAQVQ-- 77

Query: 75  GQQRLLQSFEALKEMMSADDHY----NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDN 130
             Q    + + L  ++S    Y    N+  +  ++   +  +  + N S     +  ++ 
Sbjct: 78  NGQAATSAADQLNSLLSGLSKYVSDSNSGLSSALTSFFNGADGLASNPSSTTARQVFLNG 137

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHD 189
           A  +   FN+ A ++  +    + +++ +IS++     ++  +ND I K + ++   A+D
Sbjct: 138 ASGLQSRFNSIAGQLNALSGQVNTQVQTQISSVNGTAQQIAALNDQIAKAEASTGQPAND 197

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             DQRD L+Q +++ I  S +   +    +Y  +G  L +
Sbjct: 198 LRDQRDQLVQTLNQSIKASVVQTGDGQYNIYVGNGQALVQ 237


>gi|187925754|ref|YP_001897396.1| flagellar hook-associated protein FlgK [Burkholderia phytofirmans
           PsJN]
 gi|187716948|gb|ACD18172.1| flagellar hook-associated protein FlgK [Burkholderia phytofirmans
           PsJN]
          Length = 657

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 99/228 (43%), Gaps = 24/228 (10%)

Query: 16  NASQ-QFASIVRNIENADNKNYV----------RRDTMTTISPENVTVVT-QRSENKNMF 63
           NA+Q    +  +NI NA    Y            + T +   P+ V+  T  R  ++ + 
Sbjct: 13  NAAQWGLTTTGQNISNASTPGYTIETPVYAESGGQYTGSGYLPQGVSTTTVTRQYSQYLT 72

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS----LESYSKNLS 119
            ++ +A SS         S      ++S  ++   SPT  I+    S    L++ S N S
Sbjct: 73  TELNNAQSSG-------SSLSTYNTLISQLNNLIGSPTAGIASAITSYFTGLQNVSNNAS 125

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                +T +  A+ +V   N + ++   +R   + ++   +S +  +  ++  +N  I  
Sbjct: 126 SLATRQTAMSGAQTLVNQINAAGQQYDALRQSVNTQLTNTVSQINSYTQQIAQLNGQITQ 185

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            +      +  +DQRD+ +  +S++IG++ +V +N    V+ S+G  L
Sbjct: 186 ASTQGQPPNQLMDQRDLAVSNLSQLIGVN-VVNSNGSYSVFMSNGQPL 232


>gi|238751767|ref|ZP_04613255.1| hypothetical protein yrohd0001_35400 [Yersinia rohdei ATCC 43380]
 gi|238710038|gb|EEQ02268.1| hypothetical protein yrohd0001_35400 [Yersinia rohdei ATCC 43380]
          Length = 549

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 98/197 (49%), Gaps = 11/197 (5%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++
Sbjct: 113 LQNLVSNADDDAARKTVLGKAEGLVNQFQNADQYLRDMDTGVNQKITESVAKINNYAEQI 172

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I + + +S  + +  LDQRD L+ ++++I+G++   ++ +   V  ++G  L +
Sbjct: 173 AGLNDQITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTMSQQDGDAYNVSFANGLPLVQ 232

Query: 230 TVPRDINFEKMNSYTVTSESNPIFID-----GVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                    K+ +   +S++  + +      G V+  ++ S +  G +   L+ R   + 
Sbjct: 233 GASS----YKVEAIPSSSDATRLAVGYKYGSGTVLEVDE-SRLTTGSLGGTLKFRSEALD 287

Query: 285 IFQNQLDEMARVLIGSF 301
             +NQL ++A V+  SF
Sbjct: 288 NARNQLGQLALVMADSF 304


>gi|95928660|ref|ZP_01311407.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95135450|gb|EAT17102.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 465

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 124/282 (43%), Gaps = 19/282 (6%)

Query: 27  NIENADNKNYVRRDTMTTISPE---------NVTVVTQRSENKNMF-DKVLHAHSSAIGQ 76
           N+ NA  + Y R+    + SP          +  VVT  +  +++F  K L   S   G+
Sbjct: 28  NLTNASTEGYSRQVLKVSSSPALEHNGIIVGHGAVVTAIARQESVFVTKQLINKSGDYGE 87

Query: 77  QRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQ 136
           Q  +   E L E+       +++    I+   ++ ++ S   S  +  + VI   + + +
Sbjct: 88  QAAMA--EPLGELERIAGISDDNLVADINAYFEAWQALSNEPSGTVERQEVIQMGKNIAK 145

Query: 137 NFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDV 196
            F +   ++ ++  + +  I  E+  + +   ++  +N  I    A    A+   D RD 
Sbjct: 146 TFASMDADLNELTENINVSIAAEVDTINQMADQIASLNLRIVSTEAGGTSANGLRDDRDQ 205

Query: 197 LLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFID 255
           LLQ++SE++GI+T    +  + V  S G  L E  +   ++  +++  T  S      +D
Sbjct: 206 LLQELSELVGINTYEGGSGMVSVQLSSGLPLVEGGIASSMSSSRVDGLTTLS------LD 259

Query: 256 GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
               +   G     G+IK L+ +RD+ +P  ++ LD +A  L
Sbjct: 260 MGATTVELGLDDFGGEIKGLMSVRDNEIPQVRDSLDRLAYTL 301


>gi|21242721|ref|NP_642303.1| flagellar hook-associated protein FlgK [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21108196|gb|AAM36839.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 624

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 98/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   ++++  A D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQAAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G       P  +        TV     P
Sbjct: 195 DQRDALVSKLVGFTGGTAVIQDGGFMNVFTAGGQ------PLVVGTTSSKLTTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSASSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|294665573|ref|ZP_06730854.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292604671|gb|EFF48041.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 624

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 98/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   ++++  A D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQAAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G       P  +        TV     P
Sbjct: 195 DQRDALVSKLVGFTGGTAVIQDGGFMNVFTAGGQ------PLVVGTTSSKLITVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSASSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|222823431|ref|YP_002575005.1| flagellar hook-associated protein FlgK [Campylobacter lari RM2100]
 gi|222538653|gb|ACM63754.1| flagellar hook-associated protein FlgK [Campylobacter lari RM2100]
          Length = 609

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 11/146 (7%)

Query: 335 SETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGI 394
           + +I VN   R++P+ L+           +   + G  D+ N      N+   F    G 
Sbjct: 474 ASSINVNSSIRNDPNTLK----------ASSNGVDGNNDIANAMLQLQNQKVNFYNKDGT 523

Query: 395 NTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKV 454
             ++TL  Y R   G +  N   +   H  +  VFN     Y +  GVN  EEL+ LI+ 
Sbjct: 524 VDSLTLDGYYRKFTGKIASNAESNSFAHATNMTVFNTAYAEYQSKSGVNTNEELAALIQY 583

Query: 455 EQSYNISNKLIMFTDKMLQTLLEGVK 480
           + SY  + K++   D+M++TLL G+K
Sbjct: 584 QASYGAAAKIVTTVDQMIETLL-GLK 608


>gi|294624307|ref|ZP_06703010.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292601389|gb|EFF45423.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 624

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 98/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   ++++  A D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQAAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G       P  +        TV     P
Sbjct: 195 DQRDALVSKLVGFTGGTAVIQDGGFMNVFTAGGQ------PLVVGTTSSKLITVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSASSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|254973892|ref|ZP_05270364.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-66c26]
 gi|255091277|ref|ZP_05320755.1| putative flagellar hook-associated protein [Clostridium difficile
           CIP 107932]
 gi|255312936|ref|ZP_05354519.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-76w55]
 gi|255515695|ref|ZP_05383371.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-97b34]
 gi|255648789|ref|ZP_05395691.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-37x79]
 gi|260682009|ref|YP_003213294.1| putative flagellar hook-associated protein [Clostridium difficile
           CD196]
 gi|260685607|ref|YP_003216740.1| putative flagellar hook-associated protein [Clostridium difficile
           R20291]
 gi|260208172|emb|CBA60493.1| putative flagellar hook-associated protein [Clostridium difficile
           CD196]
 gi|260211623|emb|CBE01861.1| putative flagellar hook-associated protein [Clostridium difficile
           R20291]
          Length = 436

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 92/219 (42%), Gaps = 20/219 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-MTTISP------ENVTVVT 54
            L ++ N A +  N   +   +I  NI N D   Y R+ T   T SP       N     
Sbjct: 3   GLFSILNTANSGMNAHQKAIQTISHNISNLDTDGYSRQRTEFATNSPMYMPSLSNSIARG 62

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYN------NSPTHY----- 103
           Q     ++ D V  A +S    Q   ++ +     +S  D+YN      N P+ Y     
Sbjct: 63  QLGTGVHVTD-VTRARNSFYDYQFRAEAHK-YGNTVSKYDYYNTIETIINEPSDYGISAG 120

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I       ES +K+++ D     V++NA  +    + S +++ K++ D D  I  EI  +
Sbjct: 121 IDDFFKGWESLAKDINSDSKKSLVVENASNLATLISESYKKLNKLKGDIDDNINSEIKQI 180

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKIS 202
              L  L  +N +I   + S    +D LD+RD +L  +S
Sbjct: 181 NDMLKSLEDLNKSIDVISGSGSTPNDLLDERDRILDDLS 219


>gi|119899021|ref|YP_934234.1| flagellar hook-filament junction protein 1 [Azoarcus sp. BH72]
 gi|119671434|emb|CAL95347.1| flagellar hook-filament junction protein 1 [Azoarcus sp. BH72]
          Length = 663

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 105/246 (42%), Gaps = 32/246 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-TTISPE-----------NV 50
           +  + N      N A  Q  +   NI NA  + Y R+  + T+ +P+            V
Sbjct: 1   MAGLLNIGLTGLNAAQAQLLTTGHNITNAGVEGYHRQTVIQTSNTPQFTGVGFFGQGTQV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           + VT RS ++ + ++VL + +        L  F A    +S     NN      S L   
Sbjct: 61  SAVT-RSYSQYLENQVLTSSAR-------LSEFTAYNSQIS---QINNLLADSTSGLSPV 109

Query: 111 LESY-------SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +E +       + N +     +++I +A+ +V  F T    + +IR   + EI   ++ +
Sbjct: 110 MEGFFAGVQEMASNPTSVAARQSLISSAQALVSRFQTMDARLAEIRQGTEGEIASTVTQI 169

Query: 164 RRFLSELTVVNDAIKFKTASKHD--AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
             F   +  +N  I     +     A+D LDQRD L+ ++++++ ++T+  N+  M V+ 
Sbjct: 170 NMFAGAIAEMNQRIAQAQVAGPSVAANDLLDQRDQLVAELNKLVKVNTVTENDGSMSVFM 229

Query: 222 SDGTTL 227
             G  L
Sbjct: 230 GSGQGL 235


>gi|24217008|ref|NP_714489.1| flagellar hook-associated protein FlgK [Leptospira interrogans
           serovar Lai str. 56601]
 gi|24198413|gb|AAN51507.1| flagellar hook-associated protein FlgK [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 636

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 128/309 (41%), Gaps = 57/309 (18%)

Query: 19  QQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHS--SAIG 75
           Q   +   NI NADNK+Y R R TMT + P              ++D  L+  +    IG
Sbjct: 20  QALQTTGHNISNADNKHYARQRVTMTAMDP--------------LYDPSLNRANLPGQIG 65

Query: 76  QQRLLQSFEALKE--------MMSADDHYNNSPTHYI------------SKLRDSLESYS 115
           Q   + S E +++          S +  Y  +   Y+            + LR  ++ + 
Sbjct: 66  QGVEIASIERIRDNFIDDRIIETSGNKDYWAARNEYLYQLETVFNEPNGTTLRTLMDKFW 125

Query: 116 K------NLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
                  N  ED   ++V+ + A  +        R++ ++R  A++EIE +  +L     
Sbjct: 126 SSWEDLANYPEDNAHRSVVLEKANGLGSRTEDVYRKLAQLRDQANREIETKTYHLNTIAE 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            +  +N+ I    A     +D  D+RD LLQ++S ++          D+ +  SD   L 
Sbjct: 186 NIRTLNERIGKSEALGDRPNDLYDKRDALLQELSSLV----------DVTIGRSDEDELM 235

Query: 229 ETVPRDINFEKMNSYTVTSESNPI---FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
             + + I  +   +  +    NP     +D    ++     + KG+++ L+++RD V+  
Sbjct: 236 VFIGQQILVQGNKANKIDIIGNPSKDGLLDLFWSATGDPVLLRKGRLQGLIEVRDKVIRE 295

Query: 286 FQNQLDEMA 294
             +Q+D ++
Sbjct: 296 KIDQVDALS 304


>gi|315639201|ref|ZP_07894363.1| flagellar hook-associated protein 1 (HAP1) (flgK) [Campylobacter
           upsaliensis JV21]
 gi|315480527|gb|EFU71169.1| flagellar hook-associated protein 1 (HAP1) (flgK) [Campylobacter
           upsaliensis JV21]
          Length = 608

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
           +T+ EY R   G +  +  +++ +H  +  ++N +   Y +  GVN  EEL+ LI+ + S
Sbjct: 526 LTMEEYYRKFTGKIASDGENNNVIHKSNMTLYNSVYAEYQSKSGVNTNEELAALIQWQSS 585

Query: 458 YNISNKLIMFTDKMLQTLLEGVK 480
           Y  + K++   D+ML TLL G+K
Sbjct: 586 YGAAAKIVSTVDQMLDTLL-GLK 607


>gi|203287640|ref|YP_002222655.1| flagellar hook-associated protein [Borrelia recurrentis A1]
 gi|201084860|gb|ACH94434.1| flagellar hook-associated protein [Borrelia recurrentis A1]
          Length = 627

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 109/238 (45%), Gaps = 17/238 (7%)

Query: 62  MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSED 121
           + D  +   S  +G   L   F +L E +     YN      + K  +   +  ++LS+ 
Sbjct: 80  LLDIKIAEESHHLGYWNLKDRFISLLENV-----YNEPEEQSMRKRLNDFWASWQDLSKQ 134

Query: 122 ILG----KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
             G      +++  +  V+   +    +++I   A+ EI++    +  +L  ++ +N  I
Sbjct: 135 PQGLAERNIILERGQAFVEVITSRFHSLERIYTMANDEIKITTEEINNYLRNISDLNKQI 194

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTI-VRNNNDMVVYTSDGTTLFETVPRDIN 236
               A K   +D +D+RD+++ K+S +I IS    R+ N+ +++      +  T+  ++ 
Sbjct: 195 AKAIAMKGHPNDLMDERDLIIDKLSNLISISIENKRDPNEFLIHIEGKHLIQGTIANELI 254

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            E  N  T T  +       ++ ++ + + +  GK+ AL+ IRD+ +    N+LD +A
Sbjct: 255 LEAANGPTKTKWN-------ILWNNRETANINTGKLGALINIRDNEIKNEINELDNIA 305


>gi|216263829|ref|ZP_03435823.1| flagellar hook-associated protein FlgK [Borrelia afzelii ACA-1]
 gi|215979873|gb|EEC20695.1| flagellar hook-associated protein FlgK [Borrelia afzelii ACA-1]
          Length = 627

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +   +    +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRSRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  +I +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNLISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + N +  +  S+G  L + ++  +   E  N  T T  +       ++ ++N    
Sbjct: 225 SIENKQNPNEFLIHSEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKVQ 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ ALL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGALLNIRDEEIKNEINELNNLAANII 309


>gi|57505236|ref|ZP_00371165.1| flagellar hook-associated protein 1 (HAP1) (flgK) [Campylobacter
           upsaliensis RM3195]
 gi|57016372|gb|EAL53157.1| flagellar hook-associated protein 1 (HAP1) (flgK) [Campylobacter
           upsaliensis RM3195]
          Length = 608

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
           +T+ EY R   G +  +  +++ +H  +  ++N +   Y +  GVN  EEL+ LI+ + S
Sbjct: 526 LTMEEYYRKFTGKIASDGENNNVIHKSNMTLYNSVYAEYQSKSGVNTNEELAALIQWQSS 585

Query: 458 YNISNKLIMFTDKMLQTLLEGVK 480
           Y  + K++   D+ML TLL G+K
Sbjct: 586 YGAAAKIVSTVDQMLDTLL-GLK 607


>gi|45659268|ref|YP_003354.1| flagellar hook-associated protein FlgK [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45602514|gb|AAS71991.1| flagellar hook-associated protein 1 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 636

 Score = 50.4 bits (119), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 128/309 (41%), Gaps = 57/309 (18%)

Query: 19  QQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHS--SAIG 75
           Q   +   NI NADNK+Y R R TMT + P              ++D  L+  +    IG
Sbjct: 20  QALQTTGHNISNADNKHYARQRVTMTAMDP--------------LYDPSLNRANLPGQIG 65

Query: 76  QQRLLQSFEALKE--------MMSADDHYNNSPTHYI------------SKLRDSLESYS 115
           Q   + S E +++          S +  Y  +   Y+            + LR  ++ + 
Sbjct: 66  QGVEIASIERIRDNFIDDRIIETSGNKDYWAARNEYLYQLETVFNEPNGTTLRTLMDKFW 125

Query: 116 K------NLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
                  N  ED   ++V+ + A  +        R++ ++R  A++EIE +  +L     
Sbjct: 126 SSWEDLANYPEDNAHRSVVLEKANGLGSRTEDVYRKLAQLRDQANREIETKTYHLNTIAE 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            +  +N+ I    A     +D  D+RD LLQ++S ++          D+ +  SD   L 
Sbjct: 186 NIRTLNERIGKSEALGDRPNDLYDKRDALLQELSSLV----------DVTIGRSDEDELM 235

Query: 229 ETVPRDINFEKMNSYTVTSESNPI---FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
             + + I  +   +  +    NP     +D    ++     + KG+++ L+++RD V+  
Sbjct: 236 VFIGQQILVQGNKANKIDIIGNPSKDGLLDLFWSATGDPVLLRKGRLQGLIEVRDKVIRE 295

Query: 286 FQNQLDEMA 294
             +Q+D ++
Sbjct: 296 KIDQVDALS 304


>gi|325916941|ref|ZP_08179185.1| flagellar hook-associated protein FlgK [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536844|gb|EGD08596.1| flagellar hook-associated protein FlgK [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 624

 Score = 50.4 bits (119), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 96/236 (40%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I    A  + A D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNSGLTSAVDEVNRLTQQIAKINGTIGNSAA--NAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G  L       +        TV     P
Sbjct: 195 DQRDALVSKLVGYTGGTAVIQDGGFMNVFTAGGQALV------VGTTSSKLTTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSANSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|89075502|ref|ZP_01161913.1| hypothetical flagellar hook-associated protein FlgM [Photobacterium
           sp. SKA34]
 gi|89048774|gb|EAR54345.1| hypothetical flagellar hook-associated protein FlgM [Photobacterium
           sp. SKA34]
          Length = 778

 Score = 50.4 bits (119), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 107/229 (46%), Gaps = 25/229 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           + MM  DD  + S  + ++ + D   S+ S S + ++    +TV+D+A +  ++FN+S  
Sbjct: 91  QHMMMLDDFTSKSAVNTVNSMNDFYNSVRSLSDHPNDLGSRQTVLDHANQAAKSFNSSHE 150

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISE 203
            +  IR D ++++ + +  +     E+  +N +++ +       HD LD++  L+ ++++
Sbjct: 151 MLTNIRRDVNEQLGVTLDRVNALGQEIAAINTSLQ-EMPDGDQNHDLLDKQRGLINELAK 209

Query: 204 IIGISTIVRNNN--DMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS 261
              ++ +    +  D V+  S G TL   V         +S       +P   D  +   
Sbjct: 210 YTKVTVLADKGSLADKVIIGS-GDTLVSGVE--------SSQLKMVNGDPDLEDKQIALI 260

Query: 262 NQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           N   A P       G + A+L IRD V+      LDEM R+ IG FS++
Sbjct: 261 NGNQAKPIKSDDIGGGLGAMLFIRDDVI---DKSLDEMGRMAIG-FSKQ 305



 Score = 44.3 bits (103), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
           G ++ + L E     IG ++ N   + +++   Q+ F+  SE  SN  GVNL EE + L+
Sbjct: 695 GKSSVIDLFEGLATDIGMMKSNADKTAEVN---QLDFDAASERVSNLSGVNLDEEAANLM 751

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
           K +QSY  S++++    +   TL+  V
Sbjct: 752 KFQQSYMASSRIMSVAKETFDTLMRAV 778


>gi|203284102|ref|YP_002221842.1| flagellar hook-associated protein [Borrelia duttonii Ly]
 gi|201083545|gb|ACH93136.1| flagellar hook-associated protein [Borrelia duttonii Ly]
          Length = 627

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 109/238 (45%), Gaps = 17/238 (7%)

Query: 62  MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSED 121
           + D  +   S  +G   L   F +L E +     YN      + K  +   +  ++LS+ 
Sbjct: 80  LLDIKIAEESHHLGYWNLKDRFISLLENV-----YNEPEEQSMRKRLNDFWASWQDLSKQ 134

Query: 122 ILG----KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
             G      +++  +  V+   +    +++I   A+ EI++    +  +L  ++ +N  I
Sbjct: 135 PQGLAERNIILERGQAFVEVVTSRFHSLERIYTMANDEIKITTEEINNYLRNISDLNKQI 194

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTI-VRNNNDMVVYTSDGTTLFETVPRDIN 236
               A K   +D +D+RD+++ K+S +I IS    R+ N+ +++      +  T+  ++ 
Sbjct: 195 AKAIAMKDHPNDLMDERDLIIDKLSNLISISIENKRDPNEFLIHMEGKHLIQGTIANELI 254

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            E  N  T T  +       ++ ++ + + +  GK+ AL+ IRD+ +    N+LD +A
Sbjct: 255 LEAANGPTKTKWN-------ILWNNRETANINTGKLGALINIRDNEIKNEINELDNIA 305


>gi|88704300|ref|ZP_01102014.1| flagellar hook-associated protein 1 FlgK [Congregibacter litoralis
           KT71]
 gi|88701351|gb|EAQ98456.1| flagellar hook-associated protein 1 FlgK [Congregibacter litoralis
           KT71]
          Length = 627

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 31/204 (15%)

Query: 150 ADADKEIELEISNLRR----FLSELTVVNDAIKFKT--ASKHDAHDFLDQRDVLLQKISE 203
           A  D+E  + I N  R    F + +  +ND I  +T  +     +D LD RD LL ++SE
Sbjct: 140 AGLDQEANIRIDNSVREINAFAAGIADLNDRIVSETVRSGGQPPNDLLDARDQLLNRLSE 199

Query: 204 IIGISTI----------VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIF 253
           +IG++T+          V N   +VV +S   T  ET     +  ++N          + 
Sbjct: 200 VIGVTTVDQGDGAVNVLVGNGQALVVGSS--VTELETFTDPFDVTRVN----------VG 247

Query: 254 IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSEN 313
           I G+ V ++ G  +  G++ A+L  R +V+   ++ L  +A  L  +F+++  +     +
Sbjct: 248 ISGLAVQTDIGRFLSGGELGAVLDFRGNVLDGARSDLGLIATGLTATFNDQQALG---LD 304

Query: 314 VPGLFIADGIKDLDNKLCQGISET 337
           + G F  D  + L+  + + IS T
Sbjct: 305 LNGNFGGDFFRPLEPTISESISNT 328


>gi|111115003|ref|YP_709621.1| flagellar hook-associated protein FlgK [Borrelia afzelii PKo]
 gi|110890277|gb|ABH01445.1| flagellar hook-associated protein [Borrelia afzelii PKo]
          Length = 627

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +   +    +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRSRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  +I +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNLISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + N +  +  S+G  L + ++  +   E  N  T T  +       ++ ++N    
Sbjct: 225 SIENKQNPNEFLIHSEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKVH 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ ALL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGALLNIRDEEIKNEINELNNLAANII 309


>gi|315127347|ref|YP_004069350.1| flagellar hook-associated [Pseudoalteromonas sp. SM9913]
 gi|315015861|gb|ADT69199.1| flagellar hook-associated [Pseudoalteromonas sp. SM9913]
          Length = 668

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 141/323 (43%), Gaps = 52/323 (16%)

Query: 12  NICNNA----SQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQR----------- 56
           NI N+     S+   +  +NI N + + YVR  T  T   +N     Q            
Sbjct: 7   NIANSGIRANSELLQTTSKNIANVNTEGYVRERTEFTTMIDNQVGRGQTYRLLNEFAQKQ 66

Query: 57  ----SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
               + NK+ FD+ +   S      R+ Q F             +NS +  I+ + ++++
Sbjct: 67  LNRDTSNKSFFDQFVSEAS------RVDQIFS----------EKSNSLSTSINSMFNNVQ 110

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
                 S  +    V+ +A+ ++   +  A  V + +A  ++++E+        +  ++ 
Sbjct: 111 EALNQPSSTVARSLVMSDAQNLIDQMDRLAGIVSEQKAVVNEQLEIFSEEANTLIESISS 170

Query: 173 VNDAIK--FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +N  I     T ++ DA    ++RD  ++ +S++I I T+   N +  V+   G  +   
Sbjct: 171 LNQEIAGVHGTKNEADASSAYNERDKAIRDLSKLIDIETLDGPNGEKQVFMGTGEAV--- 227

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP--------KGKIKALLQIRDSV 282
           V ++ +F   N ++++ + +  F + + +  N G AVP        KGKI  LL  RD +
Sbjct: 228 VMQNGSF---NLFSISGDPDANFKE-LRLDVNGGQAVPLEIDPTKLKGKIGGLLAFRDDI 283

Query: 283 VPIFQNQLDEMARVLIGSFSEKD 305
           +   QNQ+ +M   L  SF++++
Sbjct: 284 LVPAQNQIGQMGIALADSFNQQN 306


>gi|91785627|ref|YP_560833.1| flagellar hook-associated protein FlgK [Burkholderia xenovorans
           LB400]
 gi|91689581|gb|ABE32781.1| Flagellar hook-associated protein [Burkholderia xenovorans LB400]
          Length = 657

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 65/137 (47%), Gaps = 5/137 (3%)

Query: 99  SPTHYISKLRDS----LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADK 154
           SPT  I+    S    L++ S N S     +T +  A+ +V   N + ++   +R   + 
Sbjct: 101 SPTAGIASAITSYFTGLQNVSNNASSLATRQTAMSGAQTLVNQINAAGQQYDALRQSVNT 160

Query: 155 EIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN 214
           ++   +S +  +  ++  +N  I   +      +  LDQRD+ +  +S++IG++ +V +N
Sbjct: 161 QLTNTVSQINSYSQQIAQLNGQIAQASTQGQPPNQLLDQRDLAVSNLSQLIGVN-VVNSN 219

Query: 215 NDMVVYTSDGTTLFETV 231
               V+ S+G  L  + 
Sbjct: 220 GSYSVFMSNGQPLVSST 236


>gi|257457497|ref|ZP_05622665.1| flagellar hook-associated protein FlgK [Treponema vincentii ATCC
           35580]
 gi|257445120|gb|EEV20195.1| flagellar hook-associated protein FlgK [Treponema vincentii ATCC
           35580]
          Length = 625

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 74/152 (48%), Gaps = 6/152 (3%)

Query: 143 REVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKIS 202
           R +Q IR   + +IE  +  +  F  ++  +N+ I    A   + +D +D+RDVL +K++
Sbjct: 159 RGLQGIRDMINGDIEARVKQVNSFTRQIAALNEEIVKVKAMGDNPNDLMDKRDVLTEKLA 218

Query: 203 EIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN 262
           ++I IS    + ++  +  SDG  L +   R      + S T     N  + + V   S 
Sbjct: 219 DLISISVEKVDADESYIIYSDGMELVQG--RTFRTFGLKSGT----GNEGYANVVWEDSG 272

Query: 263 QGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
             +    G++ AL+++RD  V    N+LD MA
Sbjct: 273 NLAHFGGGRLAALIELRDGDVRDEINKLDTMA 304


>gi|78047580|ref|YP_363755.1| flagellar hook-associated protein FlgK [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927969|ref|ZP_08189190.1| flagellar hook-associated protein FlgK [Xanthomonas perforans
           91-118]
 gi|78036010|emb|CAJ23701.1| flagellar hook-associated protein 1 (HAP1) [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325541654|gb|EGD13175.1| flagellar hook-associated protein FlgK [Xanthomonas perforans
           91-118]
          Length = 624

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 98/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTPERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   ++++  A D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQAAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G       P  +        TV     P
Sbjct: 195 DQRDALVSKLVGFTGGTAVIQDGGFMNVFTAGGQ------PLVVGTTSSKLVTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSASSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|258404735|ref|YP_003197477.1| flagellar hook-associated protein FlgK [Desulfohalobium retbaense
           DSM 5692]
 gi|257796962|gb|ACV67899.1| flagellar hook-associated protein FlgK [Desulfohalobium retbaense
           DSM 5692]
          Length = 560

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 69/130 (53%), Gaps = 7/130 (5%)

Query: 107 LRDSLESY---SKNLSEDILGKT----VIDNAEEVVQNFNTSAREVQKIRADADKEIELE 159
           L DS++ +    ++LS +  G+T    V+ +AE +   FN     + K+R   D E+  +
Sbjct: 109 LSDSIDDFFGAWQDLSLNPGGETEREIVLRSAEVLQTEFNQKMTSLDKLRQSIDSELNTQ 168

Query: 160 ISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVV 219
           I+ +   L ++  +N  ++   A   + +  LDQRDVLLQ++++ +G + +  +N  + V
Sbjct: 169 IAGINAKLGQVAKLNATVQQGLAVGKNPNTALDQRDVLLQELAQRLGATAVEGDNGAVSV 228

Query: 220 YTSDGTTLFE 229
             + G TL +
Sbjct: 229 QLAGGQTLVQ 238


>gi|209521596|ref|ZP_03270294.1| flagellar hook-associated protein FlgK [Burkholderia sp. H160]
 gi|209497979|gb|EDZ98136.1| flagellar hook-associated protein FlgK [Burkholderia sp. H160]
          Length = 664

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 78/183 (42%), Gaps = 22/183 (12%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           +T I +A+ +    N +  +  ++R+  + ++   ++ +  + +++  +N  I   +   
Sbjct: 132 QTAISDAQTLANQINAAGEQYDQLRSSVNTQLSNTVTQINTYTAQIATLNTQITQASNQG 191

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
              +  LDQRD  +  +S+++G+S +V++N    ++ S+G       P  +     N  T
Sbjct: 192 QSPNQLLDQRDEAVANLSKLVGVS-VVQDNGSYSLFMSNGK------PLVLAGNSFNLGT 244

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPK-------------GKIKALLQIRDSVVPIFQNQLD 291
            TS  +P  +   V    Q  A P              G +  LLQ R   +   + QL 
Sbjct: 245 ATSSGDPTELS--VQYLGQAGATPAPTPQTLSDTSVSGGTLGGLLQFRSQTLDPAEAQLG 302

Query: 292 EMA 294
            +A
Sbjct: 303 AIA 305


>gi|268589172|gb|ACZ06862.1| flagella hook-associated protein [Xanthomonas axonopodis pv.
           glycines]
          Length = 624

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 98/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   ++++  A D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQAAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G       P  +        TV     P
Sbjct: 195 DQRDALVSKLVGFTGGTAVIQDGGFMNVFTAGGQ------PLVVGTTSSKLTTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSASSLGGQIGVLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|283955071|ref|ZP_06372574.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 414]
 gi|283793438|gb|EFC32204.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 414]
          Length = 608

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ +++ ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNLSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   ++ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVNQMLDTLL-GLK 607


>gi|90579916|ref|ZP_01235724.1| flagellar hook-associated protein [Vibrio angustum S14]
 gi|90438801|gb|EAS63984.1| flagellar hook-associated protein [Vibrio angustum S14]
          Length = 778

 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 107/229 (46%), Gaps = 25/229 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           + MM  DD  + S  + ++ + D   S+ S S + ++    +TV+++A +  ++FN+S  
Sbjct: 91  QHMMMLDDFTSKSAVNTVNSMNDFYNSVRSLSDHPNDLGSRQTVLEHANQAAKSFNSSHE 150

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISE 203
            +  IR D ++++ + +  +     E+  +N +++       + HD LD++  L+ ++++
Sbjct: 151 MLTNIRRDVNEQLGVTLDRVNALGQEIAAINTSLQEMPDGDQN-HDLLDKQRGLINELAK 209

Query: 204 IIGISTIVRNNN--DMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS 261
              ++ +    +  D V+  S G TL   V         +S       +P   D  +   
Sbjct: 210 YTKVTVLADKGSLADKVIIGS-GDTLVSGVE--------SSQLKMVNGDPDLEDKQIALI 260

Query: 262 NQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           N   A P       G + A+L IRD V+      LDEM R+ IG FS++
Sbjct: 261 NGNQAKPIKSDDIGGGLGAMLSIRDDVI---DKSLDEMGRMAIG-FSKQ 305



 Score = 42.0 bits (97), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
           G ++ + L E     IG ++ N   + +++   Q+ F+  SE  SN  GVNL EE + L+
Sbjct: 695 GKSSVIDLFEGLATDIGMMKSNADKTAEVN---QLDFDAASERVSNLSGVNLDEEAANLM 751

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +QSY  S++++    +   TL+  V
Sbjct: 752 NFQQSYMASSRIMSVAKETFDTLMRAV 778


>gi|269103183|ref|ZP_06155880.1| flagellar hook-associated protein FlgK [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163081|gb|EEZ41577.1| flagellar hook-associated protein FlgK [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 661

 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 105/223 (47%), Gaps = 13/223 (5%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           + MM  DD  + S  + ++ + D   S+ S S + ++    +TV++ A++  Q+F TS +
Sbjct: 91  QNMMMLDDFTSKSAVNTVNSMNDFYNSVRSLSDHPNDLGARQTVLEQAKQTAQSFQTSHQ 150

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISE 203
            +  +  D   +I + +  +     EL  VN +++ + AS   ++D  D++  L+ ++++
Sbjct: 151 TLTNMHQDVTDQIGVSLERINTLGQELAAVNTSLQEQAASGK-SNDLFDKQRSLINELAK 209

Query: 204 IIGISTIVRNNNDMV--VYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS 261
              + T++ +   +   V    G TL   V      + +N    T       + G     
Sbjct: 210 YTKV-TVLADKGSLANTVIIGSGDTLVSGVTS-AKLKLVNGKPDTQTQQIALVTGNSAKE 267

Query: 262 NQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
            +   +  G + +LL IRD+V+      LDEM R+ IG FS++
Sbjct: 268 IKSDGIG-GSLGSLLDIRDNVID---KSLDEMGRMAIG-FSKQ 305



 Score = 43.9 bits (102), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
           G ++ + L +     IG  +KN   + ++   +Q+ F+  SE  SN  GVNL EE + L+
Sbjct: 578 GKSSVIDLFQKLSTDIGMAKKNADQTAEV---TQLDFDAASERVSNLSGVNLDEEAANLM 634

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
           K +QSY  S++++    +   TL+  V
Sbjct: 635 KFQQSYMASSRIMSVAKETFDTLMRAV 661


>gi|307731356|ref|YP_003908580.1| flagellar hook-associated protein FlgK [Burkholderia sp. CCGE1003]
 gi|307585891|gb|ADN59289.1| flagellar hook-associated protein FlgK [Burkholderia sp. CCGE1003]
          Length = 657

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 98/228 (42%), Gaps = 24/228 (10%)

Query: 16  NASQ-QFASIVRNIENADNKNYV----------RRDTMTTISPENVTVVT-QRSENKNMF 63
           NA+Q    +  +NI NA    Y            + T +   P+ V+ VT  R  ++ + 
Sbjct: 13  NAAQWGLTTTGQNISNASTPGYTIETPVYAESGGQYTGSGYLPQGVSTVTVTRQYSQYLT 72

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS----LESYSKNLS 119
            ++  A SS+        S      ++S  ++   SPT  I+    S    +++ S N S
Sbjct: 73  TQLNDAQSSS-------SSLATYNSLISQLNNLIGSPTAGIASAITSYFTGMQNVSNNAS 125

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                +T +  A+ +    N + ++   +R   + ++   +S +  +  ++  +N  I  
Sbjct: 126 SLATRQTAMSGAQTLANQINAAGQQYDALRQSVNTQLNNTVSQINSYTQQIAQLNGQINA 185

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            +      +  LDQRD+ +  +S++IG+  +V +N    V+ S+G  L
Sbjct: 186 ASTQDQPPNQLLDQRDLAVSNLSQLIGVQ-VVNSNGAYSVFMSNGQPL 232


>gi|332525060|ref|ZP_08401240.1| flagellar hook-associated protein FlgK [Rubrivivax benzoatilyticus
           JA2]
 gi|332108349|gb|EGJ09573.1| flagellar hook-associated protein FlgK [Rubrivivax benzoatilyticus
           JA2]
          Length = 659

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 90/196 (45%), Gaps = 15/196 (7%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V+  A+++   FN +A ++  ++A    +++  +S +      L  +ND I       
Sbjct: 127 QVVLARAQDLATRFNAAAGQIDTLQAGVTADLKTTVSAVNGLTKSLAKINDQIAAARGLG 186

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF---ETVPRDINFEKMN 241
              +D LD+RD ++ ++S  I +ST++ ++  + V+ + G  L     +V   +  + ++
Sbjct: 187 QPPNDLLDERDRIVSELSSKIQVSTVMADDGTVGVFVAGGQNLVLGATSVDMRVTTDPLD 246

Query: 242 SYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
               TS S    +DG  +     +++  G + ALL+        FQN+    AR L+G  
Sbjct: 247 ----TSRSALALVDGDKLRMLDENSLGGGSMTALLR--------FQNEDLVDARNLVGQL 294

Query: 302 SEKDPIAGNSENVPGL 317
           +     A N +   GL
Sbjct: 295 AAGVASAVNGQQSLGL 310


>gi|59712475|ref|YP_205251.1| flagellar hook-associated protein FlgK [Vibrio fischeri ES114]
 gi|59480576|gb|AAW86363.1| flagellar hook-associated protein 1, FlgK [Vibrio fischeri ES114]
          Length = 626

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 98/201 (48%), Gaps = 19/201 (9%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D++++ + + +E    K V++ +  V Q+ N     V++  AD +K+++L +  +     
Sbjct: 117 DAVKTLADSPNEIGARKVVLEKSRLVSQSLNDFYENVRQQNADVNKKMDLTVERMNAIAL 176

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN-NDMVVYTSDGTTL 227
           EL  +N  +  KT   H+  D +D+ + L++++S+   ++   R+N N   V    G  L
Sbjct: 177 ELKDINKMM-VKTPGPHN--DLMDRHEKLIKELSQYTKVTITKRDNENSFNVLIGGGHML 233

Query: 228 FETVPRDINFEKMNSYTVTSESNPI-----FIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
                   N  ++    +    +P+      ++G  + + Q  ++  GK+ AL ++RDS 
Sbjct: 234 VSGT----NASELK--MIAGSPDPLQRRLAMVEGKGMKAIQHDSI-GGKLSALFELRDST 286

Query: 283 VPIFQNQLDEMARVLIGSFSE 303
           +P     +DE+ RV +G  SE
Sbjct: 287 IPTI---MDELGRVAVGFSSE 304


>gi|119503650|ref|ZP_01625733.1| flagellar hook-associated protein [marine gamma proteobacterium
           HTCC2080]
 gi|119460712|gb|EAW41804.1| flagellar hook-associated protein [marine gamma proteobacterium
           HTCC2080]
          Length = 556

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 84/176 (47%), Gaps = 12/176 (6%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           + ++ NAE +VQ F+     +  +  + + +I   +S + +    +  +N+ I K    S
Sbjct: 131 QVMLSNAETLVQRFDYIVSRIDDVTKEMNSQINSAVSEINQLAGGIATLNNEIAKVSGGS 190

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF-----ETVPRDINFE 238
               +D LDQRD LL ++S ++   T+ +++  + V+   G  L      ET+    + E
Sbjct: 191 TGLPNDLLDQRDALLVQLSSLVDTKTLAQDDGSLNVFIGRGQPLVTGSVAETLATQTDPE 250

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
             ++  VT  +   F+ G   SS+    +  GK+ A L + D VV   + +L+ +A
Sbjct: 251 LGSTSLVTLSA---FVAG---SSDVSDFLTGGKLGAALTVTDEVVNPTRRELNLLA 300


>gi|116326933|ref|YP_796653.1| flagellar hook-associated protein FlgK [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116332402|ref|YP_802120.1| flagellar hook-associated protein FlgK [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116119677|gb|ABJ77720.1| Endoflagellar hook junction protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116126091|gb|ABJ77362.1| Endoflagellar hook junction protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 636

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 130/310 (41%), Gaps = 59/310 (19%)

Query: 19  QQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHS--SAIG 75
           Q   +   NI NADNK+Y R R TMT + P              ++D  L+  +    IG
Sbjct: 20  QALQTTGHNISNADNKHYARQRVTMTAMDP--------------LYDPSLNRANLPGQIG 65

Query: 76  QQRLLQSFEALKE--------MMSADDHYNNSPTHYISKLR---------------DSLE 112
           Q   + S E +++          S +  Y  +   Y+ +L                D   
Sbjct: 66  QGVEIASIERIRDNFIDDRIIETSGNKDYWAARNEYLYQLEAVFNEPNGTTLRTLMDKFW 125

Query: 113 SYSKNLS---EDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           S  ++L+   ED   ++V+ + A  +        R++ ++R  A++EIE +  ++     
Sbjct: 126 SSWEDLANYPEDNAHRSVVLEKANGLGSRTEDVYRKLAQLRDQANREIETKAYHMNTIAE 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            +  +N+ I    A     +D  D+RD LLQ++S ++          D+ +  SD   L 
Sbjct: 186 NIRTLNERIGKSEALGDKPNDLYDKRDALLQELSSLV----------DVTIGRSDEDELM 235

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP----KGKIKALLQIRDSVVP 284
             + + I  +   +  +    NP   DG++      +  P    KG+++ L+++RD ++ 
Sbjct: 236 VFIGQQILVQGNKANKIDIIGNP-SKDGLLDLYWSATGDPVLLRKGRLQGLIEVRDKIIR 294

Query: 285 IFQNQLDEMA 294
              +Q+D ++
Sbjct: 295 EKIDQVDSLS 304


>gi|242238975|ref|YP_002987156.1| flagellar hook-associated protein FlgK [Dickeya dadantii Ech703]
 gi|242131032|gb|ACS85334.1| flagellar hook-associated protein FlgK [Dickeya dadantii Ech703]
          Length = 551

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 99/208 (47%), Gaps = 21/208 (10%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +S    +LES S+N S+    +TVI +AE +V  F ++ + ++ + +  +  I      +
Sbjct: 111 MSSFFTALESLSENASDTSARQTVISSAESMVNQFVSTDQYLRDMDSAINSSISSSADQI 170

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMV-VYTS 222
             +  ++  +N  I     S   A+  LDQRD L+ ++++I+G+   V   + MV V   
Sbjct: 171 NSYTQQIATLNKQISQLGTSGSAANQLLDQRDQLISELNDIVGVD--VTTQDSMVSVSLK 228

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP---------KGKIK 273
           +G TL   V  D ++  M + T +S+S+       V++ + G   P          G + 
Sbjct: 229 NGLTL---VQGDTSY-SMKAVTSSSDSSR-----TVLAYDTGVGDPIELDEDDLQSGSVY 279

Query: 274 ALLQIRDSVVPIFQNQLDEMARVLIGSF 301
            LL  R S +   ++QL+ +A  L  SF
Sbjct: 280 GLLNFRSSALDSARDQLNLIALTLADSF 307


>gi|238758104|ref|ZP_04619284.1| hypothetical protein yaldo0001_12400 [Yersinia aldovae ATCC 35236]
 gi|238703642|gb|EEP96179.1| hypothetical protein yaldo0001_12400 [Yersinia aldovae ATCC 35236]
          Length = 555

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 97/210 (46%), Gaps = 23/210 (10%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   KTV+   E +V  F  + + ++ +    +++I    + +  +  ++
Sbjct: 118 LQNLVSNAGDDAARKTVLGKGEGLVNQFQNADKYLRDMDVGVNQKITESATQINNYAEQI 177

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I + + +S  + +  LDQRD L+ ++++I+G++   ++ +   V  + G +L +
Sbjct: 178 AKLNDQITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVSFAGGLSLVQ 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDG--VVVSSNQGSA---------VPKGKIKALLQI 278
             P        N+Y V  E+ P   D   + +    GS          +  G +   L+ 
Sbjct: 238 G-P--------NAYKV--EAIPSSGDATRLTLGYKYGSGDTLEVDERRLTNGSLGGTLKF 286

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSEKDPIA 308
           R   +   +NQL ++A V+  SF+ +  + 
Sbjct: 287 RSEALDSARNQLGQLALVMADSFNTQHKVG 316


>gi|312793870|ref|YP_004026793.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181010|gb|ADQ41180.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 527

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/423 (19%), Positives = 167/423 (39%), Gaps = 70/423 (16%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I +   SL+  SKN     +   V   A  +    +   ++++ ++++ + ++  +I  +
Sbjct: 117 IDQFFSSLQELSKNPESLTVRALVRQRASALTDAIHKMYKQLEDLQSELNDQVYDKILEI 176

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
                ++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + 
Sbjct: 177 NSIALQIADLNKQIFILELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAG 236

Query: 224 GTTL--------FET----VPRDINFE------KMNSYTVTSESNPIFIDGVVV----SS 261
           G TL         ET    + R+  FE      + N     S+ N   + G+ V     +
Sbjct: 237 GETLVNHFTVYELETDKSRIERNSGFESNGLPTQFNPDDPRSQQNLYDVPGLFVVMWKDT 296

Query: 262 NQGSAVPKGKIKALLQIRDSV--------------------------VPIFQNQLDEMAR 295
            Q   +  G++K LL +RD V                          +P + N+L+E AR
Sbjct: 297 GQVLNIKSGELKGLLDMRDGVGGLDEDIKDEKGKIVVDVPNKNSFTGIPYYLNRLNEFAR 356

Query: 296 VLIGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
            LI  F+E  K   + N +N        GI    N     + +        + + + + D
Sbjct: 357 KLIEKFNELHKKGWSLNGQN-------KGI----NFFEPPVGQKFFYARDIKVSDAIMND 405

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
             +++    ++V NL G  DL+       N   IF             ++ ++ I  L  
Sbjct: 406 LNNIATT--YDVNNLPGGNDLVVDMLKLRNDTSIF-------KEGKFEDFLKSLISNLGV 456

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           +   + +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML 
Sbjct: 457 DSQGAKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLD 516

Query: 474 TLL 476
           T++
Sbjct: 517 TIV 519


>gi|309779453|ref|ZP_07674214.1| flagellar hook-associated protein FlgK [Ralstonia sp. 5_7_47FAA]
 gi|308921694|gb|EFP67330.1| flagellar hook-associated protein FlgK [Ralstonia sp. 5_7_47FAA]
          Length = 645

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 95/220 (43%), Gaps = 25/220 (11%)

Query: 27  NIENADNKNYVRRDTMTT------------ISPENVTVVTQRSENKNMFDKVLHAHSSAI 74
           NI NA    Y R++ + T                NVT V      K ++D+ L A   + 
Sbjct: 26  NIANASTPGYSRQEAVQTENIPLYAGVGYLGQGANVTTV------KRIYDQFLTAQVQS- 78

Query: 75  GQQRLLQSFEALKEMMSADDHY----NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDN 130
             Q    + + L  ++S    Y    N+  T  ++   ++ +  +   S+    +  ++ 
Sbjct: 79  -GQASTSAADQLNSLVSGLSKYMSDSNSGLTSSLTSFFNAADGLASKPSDTTARQVFLNA 137

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHD 189
           A  +   FN+ A ++  + +  + +++ +IS +     ++  +ND I K + ++   A+D
Sbjct: 138 AAGLQSRFNSIAGQLSSLNSQVNTQVQTQISAVNGTAQQIAALNDQISKAEASTGQPAND 197

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             DQRD L+Q +++ I  S +   +    +Y  +G  L +
Sbjct: 198 LRDQRDQLVQTLNQSIKASVVQTGDGQFNIYVGNGQALVQ 237


>gi|187918055|ref|YP_001883618.1| flagellar hook-associated protein FlgK [Borrelia hermsii DAH]
 gi|119860903|gb|AAX16698.1| flagellar hook-associated protein 1 [Borrelia hermsii DAH]
          Length = 627

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 115/253 (45%), Gaps = 37/253 (14%)

Query: 71  SSAIGQQRLLQSFEALKE-----MMSADDH---YNNSPTHYIS----------------K 106
           +  +GQ  ++QS E +++      ++ + H   Y NS   +IS                +
Sbjct: 61  AGQLGQGMMVQSIERIRDDLLDIRIAEESHRLGYWNSKDKFISLLENIYNEPEDQSIRKR 120

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSARE----VQKIRADADKEIELEISN 162
           L D  +S+ ++LS    G    +   E  Q F    R     + +I   A+ E+++ I  
Sbjct: 121 LNDFWDSW-QDLSRQPQGLAERNITLERGQAFAEIVRSRFHSLNRIYTMANDEVKITIEE 179

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI-VRNNNDMVVYT 221
           +  +L  ++ +N  I    A K   +D +D+RD+++ K+S +I IS    R+ N+ +++T
Sbjct: 180 INNYLRNISDLNRQIAKAIAMKDQPNDLMDERDLIVDKLSNLISISIENKRDPNEFLIHT 239

Query: 222 SDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS 281
                +   +  +   E  N  T T  +       ++ ++ + + +  GK+ AL+ +RD+
Sbjct: 240 EGKHLIQGAIANEFILEAANGPTRTKWN-------ILWNNREPANINTGKLGALINVRDN 292

Query: 282 VVPIFQNQLDEMA 294
            +    N++D MA
Sbjct: 293 EIKNEINEIDNMA 305


>gi|197336362|ref|YP_002156694.1| flagellar hook-associated protein FlgK [Vibrio fischeri MJ11]
 gi|197317852|gb|ACH67299.1| flagellar hook-associated protein FlgK [Vibrio fischeri MJ11]
          Length = 626

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 98/201 (48%), Gaps = 19/201 (9%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D++++ + + +E    K V++ +  V Q+ N     V++  AD +K+++L +  +     
Sbjct: 117 DAVKTLADSPNEIGARKVVLEKSRLVSQSLNDFYENVRQQNADVNKKMDLTVERMNAIAL 176

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN-NDMVVYTSDGTTL 227
           EL  +N  +  KT   H+  D +D+ + L++++S+   ++   R+N N   V    G  L
Sbjct: 177 ELKDINKMM-VKTPGPHN--DLMDRHEKLIKELSQYTKVTITKRDNENSFNVLIGGGHML 233

Query: 228 FETVPRDINFEKMNSYTVTSESNPI-----FIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
                   N  ++    +    +P+      ++G  + + Q  ++  GK+ AL ++RDS 
Sbjct: 234 VSGT----NASELK--MIAGTPDPLQRRLAMVEGKGMKAIQHDSI-GGKLSALFELRDST 286

Query: 283 VPIFQNQLDEMARVLIGSFSE 303
           +P     +DE+ RV +G  SE
Sbjct: 287 IPTI---MDELGRVAVGFSSE 304


>gi|254516995|ref|ZP_05129053.1| flagellar hook-associated protein FlgK [gamma proteobacterium
           NOR5-3]
 gi|219674500|gb|EED30868.1| flagellar hook-associated protein FlgK [gamma proteobacterium
           NOR5-3]
          Length = 639

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 78/169 (46%), Gaps = 24/169 (14%)

Query: 150 ADADKEIELEISNLRR----FLSELTVVNDAIKFKT--ASKHDAHDFLDQRDVLLQKISE 203
           A  D+E  + I N  R    F S +  +ND I  +T  +     +D LD RD LL ++SE
Sbjct: 152 AGLDQEANIRIDNSVREINAFASGIADLNDRIVSETVRSGGQQPNDLLDARDQLLNRLSE 211

Query: 204 IIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDINFEKMNSYTVTSESNPIFID 255
           I+G++T+ + +  + V   +G  L         ET     +  ++N          + I 
Sbjct: 212 IVGVTTVDQGDGAVNVLVGNGQALVVGNSVTELETFTDPFDVTRLN----------VGIA 261

Query: 256 GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           G+   ++ G  +  G++ A+L  R  V+   ++ L  +A  L  +F+++
Sbjct: 262 GIAAQTDIGRFLSGGELGAVLDFRGDVLDGARSDLGLIATGLAATFNDQ 310


>gi|296330251|ref|ZP_06872732.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676144|ref|YP_003867816.1| flagellar hook-filament junction [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152519|gb|EFG93387.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414388|gb|ADM39507.1| flagellar hook-filament junction [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 507

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 81/404 (20%), Positives = 152/404 (37%), Gaps = 60/404 (14%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  S N +ED     V    + V + FN  +  +  ++++   E+   + ++   LS
Sbjct: 126 NSLQELSNNTNEDSARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVNSLLS 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++GT   
Sbjct: 186 QLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALSSAEGTVSI 245

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           E + ++    K +  TV    N    +      N+   V        + I D+ V +   
Sbjct: 246 EILDKN----KQSLGTVLDGKNYAVSELAANYDNETGLVSS------ISIGDTAVQVE-- 293

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADG---------IKDLDNKLCQGISETIC 339
                      SFS K  + G  E+  G   ADG         + DLDN     +     
Sbjct: 294 -----------SFSSKGSLLGFVESY-GYITADGEEKGIYPEMLSDLDN---MALEFAKA 338

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWN----VKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
            N  +R+  +   D G     F        K  AG   + +   DS   N  F      N
Sbjct: 339 FNEVHRNGLTKSGDQGGDFFDFTGGDTEPAKGAAGKIKVADSIIDSKGANIAFSLTGAAN 398

Query: 396 TNV--------------------TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
            N                     ++L+Y    IG L     +++ L   ++   N    +
Sbjct: 399 DNANATKLANVLTGKITINGKETSVLDYYAGLIGELGIKAQEANRLASNTETQLNDADIN 458

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                 V+L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 459 RQQMSAVSLDEEMTNMIQFQHAYNAAARMVTLQDEILDKVINGM 502


>gi|149908753|ref|ZP_01897414.1| putative flagellar hook-associated protein [Moritella sp. PE36]
 gi|149808295|gb|EDM68234.1| putative flagellar hook-associated protein [Moritella sp. PE36]
          Length = 443

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 74/364 (20%), Positives = 134/364 (36%), Gaps = 65/364 (17%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + +I +A+ +   FN+    +     D  ++I   +S+     S++  +N  I   +A+ 
Sbjct: 130 QQIIASADALANRFNSLYSNLDIQSTDISQQINGMMSSANTMFSQVAALNSKIVESSATG 189

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
            +     DQR   + K++E++ +    + +  + +  S G  +           K + Y 
Sbjct: 190 GNVTALQDQRAETISKLAELMALDVSRQGDGSITLSLSGGQPVVLGASAATLSNKGSGYA 249

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           V+        +G V           GKI  +L  +  V+   + +LD++A+         
Sbjct: 250 VSIAGQNFTFNGDV----------GGKIGGVLSYKSHVLDPTKAELDKLAK--------- 290

Query: 305 DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWN 364
                           D    ++N+L  G  + I V P     P F  D  + +  F   
Sbjct: 291 ----------------DTADAMNNQLALG--QDINV-PVGVGKPLFSYDPSNPAGSF--- 328

Query: 365 VKNLAGYPDLINHYCDSFNKNFIFDPVAGI----NTNVTLLEYARNS--------IGWLE 412
                          D F    +    AG     NTN+T L   ++         +G L 
Sbjct: 329 ------------QVSDGFKPKDLALGAAGTGPGDNTNLTALLEMKDGFLGIYNGLVGSLA 376

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
               ++      SQ V  +      +  GVNL EE   L+K +QSYN + K+I   D++ 
Sbjct: 377 IKSGEARSSAQASQTVAENALAQRDSVSGVNLDEEGISLMKYQQSYNANAKVISMADQLF 436

Query: 473 QTLL 476
            TLL
Sbjct: 437 STLL 440


>gi|331007440|ref|ZP_08330617.1| Flagellar hook-associated protein flgK [gamma proteobacterium
           IMCC1989]
 gi|330418747|gb|EGG93236.1| Flagellar hook-associated protein flgK [gamma proteobacterium
           IMCC1989]
          Length = 1062

 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 114/261 (43%), Gaps = 41/261 (15%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKH 185
           ++  A  +   FNT A  V  +     + I   +SN+    +E+  +N+ I +F  +   
Sbjct: 134 LVSEASNLADRFNTLAARVDAVNEGVVQGIRAGVSNVNNLTAEIASLNNKIAEFSGSQSA 193

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV 245
             +D LDQRD  L ++S +I +S  V++ N + V   +G      +P  +  ++ +    
Sbjct: 194 SPNDLLDQRDNALLELSALISVSVSVQDGNQINVTVGNG------IPLVLGSQQTSIAVG 247

Query: 246 TSESNP----IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
            +E +P    I +    +S +  SA   G+I  LL  +++V+    +  +++ R+ I   
Sbjct: 248 QNEFDPQKPEILLVNNSISESITSAFSGGEIGGLLDFQNTVI---DSTYNDIGRIAI--- 301

Query: 302 SEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP-SFLRDGGSVSKK 360
                                I D  N+L    S+ + ++  Y S+  + + D     ++
Sbjct: 302 --------------------SIADTFNQLQ---SQGLTLDNAYGSDIFTDINDTAIAQER 338

Query: 361 FLWNVKNLAGYPDLINHYCDS 381
            L NV N +G PD++ +  DS
Sbjct: 339 ILSNVNNGSGNPDILVNINDS 359


>gi|291613044|ref|YP_003523201.1| flagellar hook-associated protein FlgK [Sideroxydans lithotrophicus
           ES-1]
 gi|291583156|gb|ADE10814.1| flagellar hook-associated protein FlgK [Sideroxydans lithotrophicus
           ES-1]
          Length = 640

 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 60/105 (57%), Gaps = 2/105 (1%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTAS 183
           +T+I +A+ +   F    + + +IR   + +I   ++ +  +  ++  +ND I + +  +
Sbjct: 130 QTMISSAQSLADGFQAMNQNMNQIRDGLNGQISASVTQINSYAKQIAALNDKIVQLQANT 189

Query: 184 KHDA-HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            + A +D LDQRD L+ ++S+ I +STI +++  M V+  +G +L
Sbjct: 190 PNQAPNDLLDQRDQLVNQLSQEIRVSTIKQSDGSMNVFIGNGQSL 234


>gi|224370754|ref|YP_002604918.1| putative flagellar hook-associated protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223693471|gb|ACN16754.1| putative flagellar hook-associated protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 1268

 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/318 (20%), Positives = 135/318 (42%), Gaps = 48/318 (15%)

Query: 5   AVFNKAQNICNNASQQFASIVR--NIENADNKNYVRRDTMTTISPENVTVVTQRSENKNM 62
           +  N AQ     A+QQ+   V   NI N +N +Y            ++ V  Q+S     
Sbjct: 6   STLNIAQGAI--AAQQYGLNVTGNNIANVNNPDY------------SLQVADQKSNTPAS 51

Query: 63  FDKVLHAHSSAIGQ--QRLLQ--------------SFEALKEMMSA-DDHYNNSPTHYIS 105
           +   L     ++ Q  QR+ Q              +FE  +  +S  +  ++ S    I+
Sbjct: 52  YSGFLFGTGVSVDQIQQRVNQLLENRLTDAKSSQAAFEEAESYLSVVESFFDESSETSIN 111

Query: 106 KLRDSLESYSKNLSEDILGKT----VIDNAEEVVQNFNTSAREVQKIRADADKEIELEIS 161
            +     +  ++LS + LG +    V D A+ + + FN+   ++  +R D + EI   + 
Sbjct: 112 SIMGQFWTSWQDLSNNPLGSSERVAVYDTAKNLTERFNSVNGDLAGLRTDLNSEISTTLG 171

Query: 162 NLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
            +     ++  +N  I     +K  A+   D+R+ L+ ++  +I I+T  ++N  +++  
Sbjct: 172 QINDITDQIADINLEITGLELNKT-ANGQRDERNALVDELGTLININTFEQSNGAIIINA 230

Query: 222 SDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS-NQGSAVPKGKIKALLQIRD 280
            +G +L             ++Y ++ + + +   G   S  +    +  GK+   L +RD
Sbjct: 231 GNGFSLVN---------GGDNYALSFDEDQVMWQGSYGSKVDISDKISGGKLGGWLDLRD 281

Query: 281 SVVPIFQNQLDEMARVLI 298
            ++P +Q  +D +A  +I
Sbjct: 282 EIIPKYQADIDVLAENMI 299


>gi|167626161|ref|YP_001676455.1| flagellar hook-associated protein FlgK [Shewanella halifaxensis
           HAW-EB4]
 gi|167356183|gb|ABZ78796.1| flagellar hook-associated protein FlgK [Shewanella halifaxensis
           HAW-EB4]
          Length = 457

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 159/377 (42%), Gaps = 68/377 (18%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V++ A+ + Q FN+ +  +       + +I      +   L  +  +N  I+   AS 
Sbjct: 127 QGVLNEAKALTQRFNSISEGLNSQVTQVEGQINASAKEINTQLETIASLNAEIQSSNASG 186

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
           +     LD RD  +  +S II ++ +  ++  + +  + G  L             +   
Sbjct: 187 NVPLALLDARDSAIDDLSSIIDVNVVEDSSGMLNISLAQGQPLLSGT-------TASKLE 239

Query: 245 VTSE-SNPIFIDGVVVSSNQGS----AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           VT + SNP F   + +   Q S        G + AL+  RD+ +      +DE+A  +  
Sbjct: 240 VTPDPSNPKFSQ-ISIQFGQSSFPLDETAGGSLGALIDYRDNSLVDSMAFIDELAMTMAD 298

Query: 300 SFSEKDPIAGNSE---NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
            F+    +AG ++   N P        +DL              +P   +NP+     GS
Sbjct: 299 EFNAV--LAGGTDLNGNTP-------TQDL-----------FTYDP---TNPA-----GS 330

Query: 357 VSKKFLWNVKNLA----GYPDL---INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
           +     +N + LA    G P     +    D  NK+F F  + G++T  T+ +   + IG
Sbjct: 331 LKMTAGFNAEMLAFGKDGTPGDNSNLKELVDIANKSFTFSSM-GVDT--TMGDAFGSKIG 387

Query: 410 WL-------EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
            L       + +++ + +L M++Q       + +++T GVN+ EE   LI  +QSY  + 
Sbjct: 388 ELGSASRQAQMSKTTAENLQMEAQ-------KQWASTSGVNMDEEGVNLIIYQQSYQANA 440

Query: 463 KLIMFTDKMLQTLLEGV 479
           K+I   D++ QT+L  +
Sbjct: 441 KVISTADQLFQTILNSI 457


>gi|242278417|ref|YP_002990546.1| flagellar hook-associated protein FlgK [Desulfovibrio salexigens
           DSM 2638]
 gi|242121311|gb|ACS79007.1| flagellar hook-associated protein FlgK [Desulfovibrio salexigens
           DSM 2638]
          Length = 583

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 128/328 (39%), Gaps = 46/328 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD----TMTTISP------ENV 50
           MSL    +  Q    NA     +   NI N++ + Y R D    ++  I+          
Sbjct: 1   MSLTNTLSIGQRALANAQVSINTTSNNIANSETEGYQRADAVYDSLGNINSYGNSLGTGA 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD- 109
            +V  R+      +K        I    L  S   L  +   D  +N S    ++  +D 
Sbjct: 61  DIVAIRANWDRFIEKQF-----LIALGSLSCSEAQLGYLSQMDSVFNQSEEQGLAAAQDE 115

Query: 110 ------SLESYSKNLSE--DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEIS 161
                  L +Y  +L+E  D+LG+     AE ++   N+S  E++ + A  + EI  +++
Sbjct: 116 FLSAWNGLSTYPDSLAEREDLLGE-----AESLLYGLNSSYSELRDMSASVESEIVDQVN 170

Query: 162 NLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
                +  + ++N+ I    ++  D ++ +  RD  ++++ E+IG+  +   +    +YT
Sbjct: 171 TANELIDSIGLLNEQI----SANPDNYELVASRDQAIRELDELIGVEVLSYEDGSTKIYT 226

Query: 222 SDGTTLFE-------TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP----KG 270
             G  L E        V  D +  K   +          +D   +S   G AV      G
Sbjct: 227 ETGHPLVEGEETHHLAVAYDDDTSKTGLFWENGSGG--LVDITPMSDESGDAVSGRITGG 284

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLI 298
            I  L   RD  +    ++LDE A  LI
Sbjct: 285 SIAGLFITRDEHIQPTLDRLDEYAAALI 312


>gi|303325592|ref|ZP_07356035.1| flagellar hook-associated protein FlgK [Desulfovibrio sp. 3_1_syn3]
 gi|302863508|gb|EFL86439.1| flagellar hook-associated protein FlgK [Desulfovibrio sp. 3_1_syn3]
          Length = 710

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N ++ EY  N +  +  +R  S         + N ++E  ++  GVN+ EE+S LIK + 
Sbjct: 627 NQSISEYYANLVTTVGSDRRLSKTNSEYHSALTNDLAERTASVSGVNMDEEMSNLIKFQH 686

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + KLI   D+MLQTLL G+K
Sbjct: 687 SYTAAAKLITTADQMLQTLL-GLK 709


>gi|77359728|ref|YP_339303.1| flagellar hook-associated [Pseudoalteromonas haloplanktis TAC125]
 gi|76874639|emb|CAI85860.1| putative flagellar hook-associated [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 670

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 28/177 (15%)

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
           A    ++RD  ++ +SE+I I T+   N + +V+   G  +   V ++ +F   N +++ 
Sbjct: 187 ASGTYNERDKAIRDLSELIDIETLDGPNGEKLVFMGSGEAV---VMQNGSF---NLFSMR 240

Query: 247 SESNPIFIDGVVVSSNQGSAVP--------KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            + +P F + + +  N G AVP        KGKI  LL  RD ++   QNQ+ +M   L 
Sbjct: 241 GDPDPNFKE-LRLDVNGGKAVPLEVDASKLKGKIGGLLAFRDDILVPAQNQIGQMGLALA 299

Query: 299 GSFSEKD--------PIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
            +F++++         + G+  N+P    A G     N    G+S T  V P   SN
Sbjct: 300 DAFNQQNHLGMDANGKLGGDIFNIP---TAKGFAYQANTGGAGVSAT--VEPGKGSN 351


>gi|292489127|ref|YP_003532014.1| flagellar hook-filament junction protein 1 [Erwinia amylovora
           CFBP1430]
 gi|292900246|ref|YP_003539615.1| flagellar hook-associated protein 1 [Erwinia amylovora ATCC 49946]
 gi|291200094|emb|CBJ47220.1| flagellar hook-associated protein 1 [Erwinia amylovora ATCC 49946]
 gi|291554561|emb|CBA22169.1| Flagellar hook-filament junction protein 1 [Erwinia amylovora
           CFBP1430]
 gi|312173285|emb|CBX81540.1| Flagellar hook-filament junction protein 1 [Erwinia amylovora ATCC
           BAA-2158]
          Length = 545

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/321 (20%), Positives = 137/321 (42%), Gaps = 36/321 (11%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-----------VT 54
           +FN A++  +++    + I  NI NA N +Y RRD +   S   ++              
Sbjct: 3   LFNIARSGLSSSQAGLSVIGSNINNAMNGHYSRRDILLGESGGMISGKGFYGFGVQVNGV 62

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           QR  +  + +++    ++  G +   +    +  M+  D+    +P+  ++K  D+L+  
Sbjct: 63  QRGYDAFINNEMRSGITACAGHKARYEQLAEIDNMLGNDE---TNPSVSLNKFFDALKEM 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
            K+ S     ++       +   FN+S+  +  +    + +I+  + ++     +L  +N
Sbjct: 120 EKDPSAPAARQSAFSTLGSLTYQFNSSSERLTGLEKSTNTQIKQSVDDINSCTQQLAKLN 179

Query: 175 DAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIV-RNNNDMVVYTSDGTTLFETV 231
           + I+ K  S+H     D LD RD LL+ +S   GI     +    M V  +DG  L    
Sbjct: 180 ENIE-KIVSQHGTPPADMLDARDGLLEDLSMQTGIKVSEDKLTGRMDVMLADGRPL---- 234

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA---------VPKGKIKALLQIRDSV 282
              ++  ++  Y + +E++    +  VVS    S          +  G +  L   R+  
Sbjct: 235 ---VSGSRV--YQLKAEASAENPNKTVVSYIDASGNATRLDEERMTGGALGGLFTFRNED 289

Query: 283 VPIFQNQLDEMARVLIGSFSE 303
           +   +N+L++MA  + G F+E
Sbjct: 290 LSKARNELNQMALKMAGRFNE 310


>gi|260779341|ref|ZP_05888233.1| flagellar hook-associated protein FlgK [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605505|gb|EEX31800.1| flagellar hook-associated protein FlgK [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 457

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 9/178 (5%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           +I+ +E + + FNT    +     D + +    IS+    +S +  VN  I     +  +
Sbjct: 132 IINESEALARRFNTLTESLSHQHKDVNDQRNAAISHANSLMSNIADVNKQIVEMEGTGGN 191

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
               +D RD L+ ++S+++ + T  + +  + V  S G  L   +  D    K     V 
Sbjct: 192 PAQLMDTRDALIGELSKVVEVKTTSQADGSLQVTLSSGQPLV--MGGDAAVLK----AVP 245

Query: 247 SESNPIFIDGVVVSSNQGSAV---PKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             S+P   D  V    Q  A+   P G++ AL   +  V+  +++ +D+MA+ L   F
Sbjct: 246 DPSDPYLADLHVEFGTQSFAITDTPGGQVGALTDYQTEVLKPYRSAIDDMAKALADEF 303


>gi|302878282|ref|YP_003846846.1| flagellar hook-associated protein FlgK [Gallionella
           capsiferriformans ES-2]
 gi|302581071|gb|ADL55082.1| flagellar hook-associated protein FlgK [Gallionella
           capsiferriformans ES-2]
          Length = 646

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 15/178 (8%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK--FKTA 182
           +TV+  AE  V  F    + +  I      +I   +  +  + +++  +N++IK    TA
Sbjct: 132 QTVLSTAEATVNRFQAMDQRLTDISNSLTTQIASSVQTVNTYATQIATLNNSIKSAIATA 191

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
                +D LDQRD L+  +++ I +ST  + +  M V+  +G  L       +  + M  
Sbjct: 192 QGQQPNDLLDQRDQLVNLLNKEIKVSTQQQTDGSMSVFVGNGQALV------VGDQAMAL 245

Query: 243 YTVTSESNPIFID------GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
             V + ++P  +D      G  V+  Q S++  G + A L  RD  +   +N L  +A
Sbjct: 246 QVVQNPADPSKVDVAYLNNGKSVTMQQ-SSLQGGNLGAYLTFRDQSLEPARNALGRVA 302


>gi|288958563|ref|YP_003448904.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
 gi|288910871|dbj|BAI72360.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
          Length = 465

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/342 (20%), Positives = 134/342 (39%), Gaps = 80/342 (23%)

Query: 166 FLSELTVVNDAIKFKTASKHDAH-DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            L E+  +N+  +  +    DA    +D+RD L+++++  IG+ ++ R +  + ++T  G
Sbjct: 167 LLKEIAALNE--RIGSGKDGDAALSAMDRRDQLIKELNGYIGVRSMTRGDGRVALFTGSG 224

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFI-DGVVVSSNQGSAVPKGKIKALLQ-IRDS- 281
             L +  P           T+T++ N + +  G  V  +    V  GKI AL+  +RD  
Sbjct: 225 MMLLDATP----------VTLTTDGNSVRLSSGEAVDGH----VKDGKIGALMSMLRDGS 270

Query: 282 ---------------VVPIFQNQLDEMARVLIG------------SFSEKDPIAGNSENV 314
                          V+   ++QLD +A+  +G            ++ E  P A + E  
Sbjct: 271 TADPPKPADGEPTAEVIRKLRSQLDGLAQGFVGETRPGEPKSFRDAYDEAKP-AKSGEAP 329

Query: 315 PGLFIADGIKDLDNKLCQGISE-TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPD 373
            G F             QG    T+ V       PS L +  SV    L  V        
Sbjct: 330 AGFF-------------QGKDRFTLAV------KPSLLDERESVKTSALSPVV------- 363

Query: 374 LINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHIS 433
                 ++  +    D +   +++ T +  A     W    ++ ++D   + +     + 
Sbjct: 364 ---RALNATGRQLDADGLKTSDSSYTGMVSAFTG-SWATAAKA-ANDQQGQEKAALQLVD 418

Query: 434 ESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
           E Y    GVNL EE++ L +++ +Y  S +++     M  TL
Sbjct: 419 ERYHAKTGVNLDEEIATLQQLQTAYAASARILQTVKAMHDTL 460


>gi|296135666|ref|YP_003642908.1| flagellar hook-associated protein FlgK [Thiomonas intermedia K12]
 gi|295795788|gb|ADG30578.1| flagellar hook-associated protein FlgK [Thiomonas intermedia K12]
          Length = 667

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/221 (19%), Positives = 99/221 (44%), Gaps = 31/221 (14%)

Query: 27  NIENADNKNYVRRDTM-TTISPE-----------NVTVVTQRSENKNMFDKVLHAHSSAI 74
           NI N +   Y R   + +T++P             +  VT RS N  +  +V    ++A 
Sbjct: 28  NIANVNTPGYSRETAVQSTLTPSLYGGQYLGNGTQIDAVT-RSYNSYLQSQVWSTAATAS 86

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL-ESYSKNLSE------DILGK-T 126
           G   L    + +  +++  D          S L  S+ + ++  +++      DI  + +
Sbjct: 87  GANTLNTQIQPIANLIAGTD----------SGLSTSINQFFASGVAQVAVNPADIPSRQS 136

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           +I  ++ + Q   TSA+++Q      ++++   ++ +     ++  +N  I   + +   
Sbjct: 137 LISQSQSLAQTIQTSAQQLQSAANGVNQQLGQSVTAINSLTQQIAQLNVQINTLSGTGST 196

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            +  LDQRD L+ ++S  +G++ + ++ N + V+T +G  L
Sbjct: 197 PNSLLDQRDQLITQLSGQVGVTVLPQDGNQVNVFTGNGQVL 237


>gi|194015655|ref|ZP_03054271.1| flagellar hook-associated protein FlgK [Bacillus pumilus ATCC 7061]
 gi|194013059|gb|EDW22625.1| flagellar hook-associated protein FlgK [Bacillus pumilus ATCC 7061]
          Length = 506

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 78/380 (20%), Positives = 161/380 (42%), Gaps = 46/380 (12%)

Query: 125 KTVID-NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTAS 183
           +TV+  +A+ +V  F      +  I+ +   E++    N+   LS++  VN  I     +
Sbjct: 143 RTVVKTSAQALVDQFRLLNSSLTTIQKNLKTELDSTAKNVNTILSQIDEVNKQIAAVEPN 202

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
            +  +D  D RD L+ ++S ++ I      +    +  ++GT   + +  +         
Sbjct: 203 GYLPNDLYDTRDALVDQLSSLVDIKVSYNPSGGNALKIAEGTVNIDIIGANGQSAGTILN 262

Query: 244 TVTSESNPIFID-----GVVVSSNQGSAV-------PKGKIKALLQI--------RDSVV 283
            +T+E + + I      G+V S   G+           GK+KAL++            + 
Sbjct: 263 GITNEKSELQISYDNTTGLVNSLQFGTTTIAADQLQVNGKVKALVEAYGYMSNGAEKGMY 322

Query: 284 PIFQNQLDEMARVLIGSFSE--KDPIAGNSENVPGLFIADGIKDLDNK--LCQGISETIC 339
           P    +LDE+A+V + +F++  K     N  +    F      D++N   L +G++  I 
Sbjct: 323 PDMLAELDEVAQVFMDTFNDVHKQGYTLNGTSGQDFF------DIENNNDLNKGLAARIK 376

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVT 399
           V+    ++   +    + +K    N   LAG  DL               P+ G  T  T
Sbjct: 377 VSDVILASTDNIAASLNQTKGDGSNATKLAGIQDL-------------KVPIGGNTT--T 421

Query: 400 LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYN 459
           + +Y +N I  +      +  L   S  + N  +E   +T  V++ EE++ +I+ + +YN
Sbjct: 422 IQDYYQNVIAEMGIQGKKNITLESSSAALVNSANERRMSTSAVSIDEEMTNMIQFQHAYN 481

Query: 460 ISNKLIMFTDKMLQTLLEGV 479
            + +++   D++L  ++ G+
Sbjct: 482 AAARVVTLQDEILDKVINGM 501


>gi|119952979|ref|YP_945188.1| flagellar hook-associated protein FlgK [Borrelia turicatae 91E135]
 gi|119861750|gb|AAX17518.1| flagellar hook-associated protein 1 [Borrelia turicatae 91E135]
          Length = 627

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 76/151 (50%), Gaps = 8/151 (5%)

Query: 145 VQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEI 204
           +++I   A+ E+++    +  +L  ++ +N  I    A K   +D +D+RD+++ K+S +
Sbjct: 162 LKRIYTMANDEVKITTEEINNYLRNISDLNRQIAKAIAMKDQPNDLMDERDLIVDKLSNL 221

Query: 205 IGISTI-VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           I IS    R+ N+ ++Y      +   +  +   E  N  T T  +       V+ ++ +
Sbjct: 222 ISISIENKRDPNEFLIYVEGKHLIQGAIANEFILEAANGPTGTKWN-------VLWNNGE 274

Query: 264 GSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            + +  GK+ AL+ +RD+ +    N++D MA
Sbjct: 275 PANINTGKLGALINVRDNEIKNEINEIDNMA 305


>gi|310764854|gb|ADP09804.1| Flagellar hook-associated protein 1, FlgK [Erwinia sp. Ejp617]
          Length = 545

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/320 (20%), Positives = 136/320 (42%), Gaps = 34/320 (10%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-----------VT 54
           +FN A++  +++    + I  NI NA N +Y RRD +   S   ++              
Sbjct: 3   LFNIARSGLSSSQAGLSVIGSNINNAMNGHYSRRDILLGESGGMISGKGFYGFGVQVNGV 62

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           QR  +  + +++    ++  G +   +    +  M+  D+    +P+  ++K  ++L+  
Sbjct: 63  QRGYDAFINNELRGGITACAGHKTRYEQLAEIDNMLGNDE---TNPSVSLNKFFEALKEM 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
            K+ S     ++       +   FN+S+  +  +    + +I+  + ++     +L  +N
Sbjct: 120 EKDPSAPAARQSAYSTLGSLTYQFNSSSERLTGLEKSTNTQIKQSVDDINSCTQQLAKLN 179

Query: 175 DAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           + I+ K  S+H     D LD RD LL+ +S    + T ++ N D +    D  TL +  P
Sbjct: 180 ENIE-KIVSQHGTPPADLLDARDGLLEDLS----MQTGIKVNEDKLTGRMD-VTLADGRP 233

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA---------VPKGKIKALLQIRDSVV 283
                     Y + +E++    +  VVS    S          +  G +  L   R+  +
Sbjct: 234 L---VSGTRVYQLKAEASAENPNKTVVSYIDASGNATRLDEERMTGGALGGLFTFRNEDL 290

Query: 284 PIFQNQLDEMARVLIGSFSE 303
              +N+L++MA  + G F+E
Sbjct: 291 SKARNELNQMALKMAGRFNE 310


>gi|259907640|ref|YP_002647996.1| Flagellar hook-associated protein 1, FlgK [Erwinia pyrifoliae
           Ep1/96]
 gi|224963262|emb|CAX54746.1| Flagellar hook-associated protein 1, FlgK [Erwinia pyrifoliae
           Ep1/96]
          Length = 545

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/320 (20%), Positives = 136/320 (42%), Gaps = 34/320 (10%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-----------VT 54
           +FN A++  +++    + I  NI NA N +Y RRD +   S   ++              
Sbjct: 3   LFNIARSGLSSSQAGLSVIGSNINNAMNGHYSRRDILLGESGGMISGKGFYGFGVQVNGV 62

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           QR  +  + +++    ++  G +   +    +  M+  D+    +P+  ++K  ++L+  
Sbjct: 63  QRGYDAFINNELRGGITACAGHKTRYEQLAEIDNMLGNDE---TNPSVSLNKFFEALKEM 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
            K+ S     ++       +   FN+S+  +  +    + +I+  + ++     +L  +N
Sbjct: 120 EKDPSAPAARQSAYSTLGSLTYQFNSSSERLTGLEKSTNTQIKQSVDDINSCTQQLAKLN 179

Query: 175 DAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           + I+ K  S+H     D LD RD LL+ +S    + T ++ N D +    D  TL +  P
Sbjct: 180 ENIE-KIVSQHGTPPADLLDARDGLLEDLS----MQTGIKVNEDKLTGRMD-VTLADGRP 233

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA---------VPKGKIKALLQIRDSVV 283
                     Y + +E++    +  VVS    S          +  G +  L   R+  +
Sbjct: 234 L---VSGTRVYQLKAEASAENPNKTVVSYIDASGNATRLDEERMTGGALGGLFTFRNEDL 290

Query: 284 PIFQNQLDEMARVLIGSFSE 303
              +N+L++MA  + G F+E
Sbjct: 291 SKARNELNQMALKMAGRFNE 310


>gi|86149406|ref|ZP_01067637.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni CF93-6]
 gi|88596766|ref|ZP_01100003.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 84-25]
 gi|218563069|ref|YP_002344848.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85840188|gb|EAQ57446.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni CF93-6]
 gi|88191607|gb|EAQ95579.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 84-25]
 gi|112360775|emb|CAL35574.1| putative flagellar hook-associated protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|284926674|gb|ADC29026.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315927413|gb|EFV06751.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315929004|gb|EFV08247.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 608

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|307718454|ref|YP_003873986.1| flagellar hook-associated protein [Spirochaeta thermophila DSM
           6192]
 gi|306532179|gb|ADN01713.1| flagellar hook-associated protein [Spirochaeta thermophila DSM
           6192]
          Length = 624

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 90/193 (46%), Gaps = 23/193 (11%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D+ +  S +  E      VI+NA+ +V   +   R +  IR   +++++  +  +  +++
Sbjct: 126 DAWQELSIHPDEMAARHAVIENAKALVDGIHERYRALSSIRKMIEEDVQATVKEVNDYIA 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL- 227
            +  +N+ I    A   + +D +D+RD+L++K++++I ++   R+ ++  ++   G  L 
Sbjct: 186 RIAHLNEQIVKVKAMGDNPNDLMDRRDLLVEKLAKLINVTVDTRDPDEFTIHVG-GRHLV 244

Query: 228 -------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                  F   PR  N E  ++      +  + ++G             GK+ ALL++RD
Sbjct: 245 QGKVYHPFALDPRPQN-EGFSAVLWEGSTEEVRLEG-------------GKLAALLELRD 290

Query: 281 SVVPIFQNQLDEM 293
             V     +LD M
Sbjct: 291 GDVRGEIQKLDTM 303


>gi|283956843|ref|ZP_06374316.1| putative flagellar hook-associated protein FlgK [Campylobacter
           jejuni subsp. jejuni 1336]
 gi|283791569|gb|EFC30365.1| putative flagellar hook-associated protein FlgK [Campylobacter
           jejuni subsp. jejuni 1336]
          Length = 608

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|86153170|ref|ZP_01071375.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85844055|gb|EAQ61265.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 608

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|224534099|ref|ZP_03674682.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi
           CA-11.2a]
 gi|224512798|gb|EEF83166.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi
           CA-11.2a]
          Length = 388

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESWH-DLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|256371026|ref|YP_003108850.1| flagellar hook-associated protein FlgK [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256007610|gb|ACU53177.1| flagellar hook-associated protein FlgK [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 462

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/344 (20%), Positives = 137/344 (39%), Gaps = 56/344 (16%)

Query: 138 FNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK-HDAHDFLDQRDV 196
            N +A  +  +  D  ++  L ++ +   L+++  +N  I  ++  +   A+  +D R+ 
Sbjct: 144 LNQAASNLTGLFNDTSQQASLLVAQVNTQLAQVASLNGQIAAQSGGEVGAANSLIDARNQ 203

Query: 197 LLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM---NSYTVTSESNPIF 253
           +L +++  IG +T+V  ++  V     G TL +    +     +    S    S +  I 
Sbjct: 204 VLSQLANEIG-ATVVPASSQQVNVLVGGVTLVQGTQSNALAAAIAAPGSPPTASGTAQIL 262

Query: 254 IDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF---------- 301
           + G   +S Q   VP   G +  +L   ++ +P +  QL+  A+ L              
Sbjct: 263 LAG---TSTQ---VPVTSGSLGGMLASLNNNLPRYGTQLNATAQALATQVNGLLASGQTQ 316

Query: 302 SEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKF 361
               PIAG     P LF+A G   LD       + +I VNPQ  ++PS L    S +   
Sbjct: 317 GTTGPIAG-----PPLFVAAGGGTLD-------AGSIAVNPQIEASPSLLAA--STTPYA 362

Query: 362 LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDL 421
             N +N A   +L     D  N  +                    ++G +  +   +  L
Sbjct: 363 GGNGQNAAAIANL-GSAADGPNALW------------------SQAVGQVGLDVQSATSL 403

Query: 422 HMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
              +         +  ++VGV++  +L  L+  +Q+Y  + K+I
Sbjct: 404 ATSAAQQAQSAQTAEQSSVGVDVNGQLVNLVTYQQAYQAAAKVI 447


>gi|322832570|ref|YP_004212597.1| flagellar hook-associated protein FlgK [Rahnella sp. Y9602]
 gi|321167771|gb|ADW73470.1| flagellar hook-associated protein FlgK [Rahnella sp. Y9602]
          Length = 550

 Score = 48.5 bits (114), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 134/321 (41%), Gaps = 39/321 (12%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV- 53
           ++ N A +  N A    ++   NI N     Y R+  + T S             VTV  
Sbjct: 4   SLINTAMSGLNAAQAALSTTGNNIANVSVAGYNRQTAIITQSNGISTPAGYIGNGVTVTG 63

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH---YISKLRDS 110
             R  N  +  ++L A  SA G     Q    L +  S DD   +S T     +S     
Sbjct: 64  VNREYNSFVVKQLLGA--SATGSALSTQ----LDQASSIDDLLGDSSTGIDATMSTFFKG 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N S+    + V+  A+ +   FN+SA+ +  +    ++++   +  +  + S++
Sbjct: 118 LQTLTSNASDSAARQAVLGEAQGLTAQFNSSAKYLNDMNTAVNQQVTQNVDQINTYASQI 177

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I   + ++  + +  LDQRD L+ +++ + G+    ++ +   +  ++GT L  
Sbjct: 178 AKLNSQITATRGSTGQEPNALLDQRDQLVSQLNNVTGVVVTQQDGDTYNISFANGTPLVS 237

Query: 230 --------TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIR-D 280
                    +P   +  K+        + P   DG  VS  Q S +  G +   L  R D
Sbjct: 238 GGNAKTVVAMPSSADPSKL----TVGMTQP---DG-SVSEIQESRLTTGSLGGTLAFRKD 289

Query: 281 SVVPIFQNQLDEMARVLIGSF 301
           ++ P   NQL ++A  L  SF
Sbjct: 290 NLEPAI-NQLGQLALALSDSF 309


>gi|91776315|ref|YP_546071.1| flagellar hook-associated protein FlgK [Methylobacillus flagellatus
           KT]
 gi|91710302|gb|ABE50230.1| Flagellar hook-associated protein [Methylobacillus flagellatus KT]
          Length = 645

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/335 (21%), Positives = 136/335 (40%), Gaps = 34/335 (10%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE---------NVTVV--T 54
           +FN  +   N A    ++   NI NA+ + Y R+  + +             N T V   
Sbjct: 4   IFNIGKTALNAAQVGISTTGHNIANANTEGYSRQVIVQSAGQAQAWGFGYLGNGTQVDTV 63

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           +R  N+ +  ++ ++ S A G    L +   +  M+ AD     SP   I     S+   
Sbjct: 64  KRVYNELLSRQISNSQSIASGINTQLSNINHINNML-ADAEAGLSPA--IQDFFASINDL 120

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S   ++    + ++  AE +   FN     + +++   + ++   ++ +  +  E+  +N
Sbjct: 121 SSAPNDPASRQAMLSTAEALSSRFNGLGSRLLEMQGSVNAQLNASVNTVNHYAKEIARLN 180

Query: 175 DAIKFKTAS-KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           + I   T S     +D LDQRD L+  +++ I  + IV++ N   V   +G      +P 
Sbjct: 181 EVIDVATTSTGQPPNDLLDQRDQLVLALNKEIKGTVIVQDGNRYNVSIGNG------IPL 234

Query: 234 DINFEKMNSYTVTSESNP-----IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
               +  +  TV S +NP      +  G   S     ++  G I  L++ R   +   QN
Sbjct: 235 VNGLKSYSLTTVDSPTNPGRLEVAYQAGATTSILAEQSLQGGVIGGLIEYRRESLDKAQN 294

Query: 289 QLDEMARVLIGSF--------SEKDPIAGNSENVP 315
            L ++A  L  SF        +  D   GN  N+P
Sbjct: 295 TLGQIAVALAQSFNIQHQQGLTNGDVQGGNFFNIP 329


>gi|153954739|ref|YP_001395504.1| hypothetical protein CKL_2121 [Clostridium kluyveri DSM 555]
 gi|219855203|ref|YP_002472325.1| hypothetical protein CKR_1860 [Clostridium kluyveri NBRC 12016]
 gi|146347597|gb|EDK34133.1| FlgK [Clostridium kluyveri DSM 555]
 gi|219568927|dbj|BAH06911.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 632

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 101/239 (42%), Gaps = 23/239 (9%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKN 61
           L ++FN A++              NI NA+ + Y R R T+ T +P      T  S N  
Sbjct: 4   LFSIFNTAKSGLFAQQTSINVTSHNIANAETEGYSRQRATLVTTTP-----YTMPSMNAA 58

Query: 62  MFDKVLHAHSSAIGQQRLLQSF--------EALKEMMSADDHYN-------NSPTHY-IS 105
                L    +     R+  SF          +    +A D Y        N PT   IS
Sbjct: 59  TIAGQLGTGVTVASIDRIRDSFLDYQIRVENGVNGHYTAKDKYLSQVENVLNEPTDSGIS 118

Query: 106 KLRDSLESYSKNLSEDILG-KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            L     +  ++LS       TV   A ++  + N+   ++  I+ +A  EI+  + ++ 
Sbjct: 119 SLMSEFFNSWQDLSSSPQNTSTVAQQAYQLTNDLNSVYSQLTSIKDNAKSEIKSAVVDIN 178

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
             L++++ +N  IK    S ++ +D +D RD+LL ++SE  GIS   R    + V TS+
Sbjct: 179 GMLTQISQLNQQIKDVKMSGNNPNDLMDSRDLLLDQLSEKFGISIDPRKYEGIDVTTSN 237



 Score = 39.3 bits (90), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 391 VAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFN-----HISESYSNTVGVNLQ 445
           V  +N   TL  Y  N +     N+   H+   K QV +        ++S  +T GV+L 
Sbjct: 542 VGSVNGGSTLDNYFNNLV-----NKVGMHEEEAKKQVDYEATQLESFTQSRESTSGVSLD 596

Query: 446 EELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           EE++ LI+ +  Y  + K+I   D++L  ++ G+K
Sbjct: 597 EEMTNLIQFQHCYQANAKMISTVDELLDVVINGLK 631


>gi|57238490|ref|YP_179621.1| flagellar hook-associated protein FlgK [Campylobacter jejuni
           RM1221]
 gi|57167294|gb|AAW36073.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni RM1221]
 gi|315058921|gb|ADT73250.1| Flagellar hook-associated protein flgK [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 608

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|148925638|ref|ZP_01809326.1| putative flagellar hook-associated protein [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|145845648|gb|EDK22739.1| putative flagellar hook-associated protein [Campylobacter jejuni
           subsp. jejuni CG8486]
          Length = 608

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|205356101|ref|ZP_03222868.1| putative flagellar hooK associated protein [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|205345944|gb|EDZ32580.1| putative flagellar hooK associated protein [Campylobacter jejuni
           subsp. jejuni CG8421]
          Length = 608

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|157415691|ref|YP_001482947.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386655|gb|ABV52970.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|307748332|gb|ADN91602.1| Putative flagellar hook-associated protein FlgK [Campylobacter
           jejuni subsp. jejuni M1]
 gi|315930976|gb|EFV09951.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 608

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|86151883|ref|ZP_01070096.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 260.94]
 gi|315124902|ref|YP_004066906.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni ICDCCJ07001]
 gi|85840991|gb|EAQ58240.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 260.94]
 gi|315018624|gb|ADT66717.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni ICDCCJ07001]
          Length = 608

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|163783192|ref|ZP_02178186.1| flagellar hook associated protein FlgK [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159881526|gb|EDP75036.1| flagellar hook associated protein FlgK [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 528

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 132/313 (42%), Gaps = 49/313 (15%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-TISPENVTVVTQRSENKNM 62
           L ++ K+ +I N          RN+ NA+N +YV+ D +  + +P  +     R  ++N+
Sbjct: 13  LEIYRKSLDIHN----------RNVINANNPDYVQEDPVVESFAPVGINFQDVR-RDQNI 61

Query: 63  FDKVLHAHSSAIGQQRLLQS-----------FEALKEMMSADDHYNNSPTHYISKLRDSL 111
           +   L+  +S +   R L+            F+ L E    +D+ N     Y+  ++D  
Sbjct: 62  Y--YLNLRNSKLSLVRYLEERSGVLSNVEGIFQELFEGTGINDYTNRFYEAYLDVMKDPT 119

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
              +KN         + ++A+ +       + ++  +    D  +   +S +     +L 
Sbjct: 120 NEGAKN--------ELYNSAKSLADFLRNKSSDIDALDNSIDYNLRDVVSRINELSRKLF 171

Query: 172 VVNDAIKFKTASKH----DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            VN  I    A  +    D  +FLD RD  L+++SE+I I         + V TS G  L
Sbjct: 172 NVNREITVMYAQNYARGKDYKNFLDIRDKYLRELSELINIDVQQDEIGRVKVTTSKGFAL 231

Query: 228 --FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
             F+     + +     Y  + + N + I GV+ S         GK+KALL  R  +   
Sbjct: 232 VDFQDNYWQLEYTGGKLYWKSKDGNDVDITGVIES---------GKVKALLDARADLAR- 281

Query: 286 FQNQLDEMARVLI 298
           F+N+L+ +A  LI
Sbjct: 282 FKNELNSIASQLI 294


>gi|121612872|ref|YP_001001115.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249591|gb|EAQ72550.1| flagellar hook-associated protein FlgK, putative [Campylobacter
           jejuni subsp. jejuni 81-176]
          Length = 608

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL+ LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|330830297|ref|YP_004393249.1| flagellar hook-associated protein FlgK [Aeromonas veronii B565]
 gi|328805433|gb|AEB50632.1| Flagellar hook-associated protein FlgK [Aeromonas veronii B565]
          Length = 667

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 90/204 (44%), Gaps = 6/204 (2%)

Query: 27  NIENADNKNYVRRDTMT---TISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSF 83
           NI N +++ YVR  T+    TI      + TQR  N  M  +V    S+       L  +
Sbjct: 26  NIVNVNSQGYVRERTLVYTNTIGLGTGDIKTQRVINDYMQGEVRRDTSA---YHASLTHY 82

Query: 84  EALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           E L  + S     +NS    I+    S  S +++ +E    K V+     +V  F+T + 
Sbjct: 83  EQLAGVDSLLGDTSNSVGAAITSYFKSFHSANESPAEIGGRKVVMTELSGMVNRFHTLSA 142

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISE 203
           ++ K     +  IE E   +   L+ +  +N AI     S  +     DQRD  ++++SE
Sbjct: 143 QLDKQSDTLNTRIEDETKQVNSLLTSINDLNQAIIRTQGSPEENLMLFDQRDEAIRQLSE 202

Query: 204 IIGISTIVRNNNDMVVYTSDGTTL 227
            + I T+ + N  M+V  S G +L
Sbjct: 203 KMDIRTVAQPNGSMLVNMSTGHSL 226


>gi|239907786|ref|YP_002954527.1| flagellar hook-associated protein 1 [Desulfovibrio magneticus RS-1]
 gi|239797652|dbj|BAH76641.1| flagellar hook-associated protein 1 [Desulfovibrio magneticus RS-1]
          Length = 710

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 102/228 (44%), Gaps = 19/228 (8%)

Query: 27  NIENADNKNYVRRDTM--------TTISPENVTVVTQ---RSENKNMFDKVLHAHSSAIG 75
           NI N D + Y R+  +        T        VV Q   R+ +K +  + L   S+   
Sbjct: 28  NISNVDTEGYSRQSVVLKDGQYVNTFTGQVGTGVVAQEVVRAHDKFVEAQYLTKVSARDR 87

Query: 76  QQRLLQSFEALKEMM--SADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
            Q L    ++++ ++  S  D  N S    +S   D     + N     + +T++D+ E 
Sbjct: 88  YQTLYNGLQSVQNLVNESNTDGLNTS----LSTFFDDWGDLTTNPESAAVRQTLVDDTET 143

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHDFLD 192
           ++    + A  ++++   AD+ I   +  L     ++  +N+ I + +   K + ++  D
Sbjct: 144 LLSTLRSEADSMRQLEDQADQSIAAGVDKLNELAKDIADLNNQINQTQIDGKSNPNNLYD 203

Query: 193 QRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEK 239
            RDV L++++ ++ I+ I     D+ VYT+ G T+ +  V  D  FE+
Sbjct: 204 LRDVKLREMAGLVDINVIDNGKGDITVYTTAGQTVVDGVVAFDFKFEQ 251



 Score = 38.1 bits (87), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 431 HISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
            ++E   +T GVNL EEL+ +IK + SY  + KL+   + M +T+L G+K
Sbjct: 661 ELNEQQLSTSGVNLDEELTNMIKFQHSYQAAAKLVSTANSMFETVL-GLK 709


>gi|317152827|ref|YP_004120875.1| flagellar hook-associated protein FlgK [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943078|gb|ADU62129.1| flagellar hook-associated protein FlgK [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 670

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 62/110 (56%), Gaps = 9/110 (8%)

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           ED+LG      AE +V   N++A  ++ + A  + EIE  +S+  + ++++ V N +I  
Sbjct: 132 EDLLGI-----AETLVYALNSTADGLETMEAAINTEIEDAVSSANQLIADIAVANASI-- 184

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             A+  D +  +  RD ++++++ IIG+ TI + N  + + T +G +L +
Sbjct: 185 --AASPDNNQLISDRDQMIRELNAIIGVQTIEQENGMVTILTDEGYSLVD 232


>gi|209695756|ref|YP_002263686.1| flagellar hook-associated protein FlgK [Aliivibrio salmonicida
           LFI1238]
 gi|208009709|emb|CAQ80013.1| flagellar hook-associated protein type 3 FlgM [Aliivibrio
           salmonicida LFI1238]
          Length = 626

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 95/201 (47%), Gaps = 19/201 (9%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D++++ S + +E    K V++ +  + Q+ N     V++  AD +K+++L +  +     
Sbjct: 117 DAVKTLSDSPNEIGARKVVLEKSRLISQSLNDFYENVRQQNADVNKKMDLTVERMNGIAL 176

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN-NDMVVYTSDGTTL 227
           EL  +N  +  KT   H+  D +D+ + L++++S+   ++   R+N N   V    G  L
Sbjct: 177 ELKDINKMM-VKTPGPHN--DLMDRHEKLIKELSQYTKVTITKRDNENSFNVLIGGGHML 233

Query: 228 FETVPRDINFEKMNSYTVTSESNPI-----FIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
                     E      +    +P+      ++G  V + Q  ++  GK+ +L ++RD  
Sbjct: 234 VSGT------ESSQLKMIQGTPDPLQRRLAMVEGNGVKAIQHDSI-GGKLSSLFELRDKT 286

Query: 283 VPIFQNQLDEMARVLIGSFSE 303
           +P     +DE+ RV +G  SE
Sbjct: 287 IPTI---MDELGRVAVGFSSE 304


>gi|32490795|ref|NP_871049.1| hypothetical protein WGLp046 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166001|dbj|BAC24192.1| flgK [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 545

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 101/206 (49%), Gaps = 15/206 (7%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I+ + D LE  S+    +I  ++   N + +  +FN   +E++ +  +   EI+L IS++
Sbjct: 110 INNVFDDLEFISQEPFNEIYKESAFLNFKSLNNHFNFIGKEIKDLENNIYNEIKLNISDI 169

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               S+L+ +N  I  K+ ++  + D LD+RD LL +IS+ IGIS      + + V   +
Sbjct: 170 NSLTSQLSSINKEI-LKSKNEKISLDLLDKRDQLLSEISKKIGISVNFNEKSTVNVALEN 228

Query: 224 GTTLFET-VPRDINFEKM--NSYTVTSESNP---IFIDGVVVSSNQGSAVPKGKIKALLQ 277
           G  L +     D+  +K   N +++  E++    I ID          ++  G+I  L+ 
Sbjct: 229 GFFLVDKDQSNDLKIKKYFENDFSLFYENSKKEFIQID--------SDSIQNGEIGGLIS 280

Query: 278 IRDSVVPIFQNQLDEMARVLIGSFSE 303
             +  +PI + +++ +   L   F+E
Sbjct: 281 FYNKEIPIIKEKINFIIFSLAKRFNE 306


>gi|54307275|ref|YP_128295.1| flagellar hook-associated protein [Photobacterium profundum SS9]
 gi|46911695|emb|CAG18493.1| Hypothetical flagellar hook-associated protein [Photobacterium
           profundum SS9]
          Length = 468

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           +T++  +E +VQ FN  + ++         +++  +S     ++ +  +N++I+   AS 
Sbjct: 126 QTIVSQSESMVQRFNNLSSQLDGQTKQVSGQLDATVSEANTLMAGIASMNESIRDAGASG 185

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
               D LD RD  ++++S ++ ++T          Y  DGT    T+ +       +S +
Sbjct: 186 KSMTDLLDARDESVRQLSALVDVNT---------TYNDDGTISL-TLDKGQPLVSGSSAS 235

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPK------GKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           V  + N    DG ++S  +G+          G I  L+  RD  +   Q +LD MA    
Sbjct: 236 VLKKDN----DG-LLSLQRGNGTLALDGNIGGTIGGLVDYRDGELNELQRELDVMAYSFA 290

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDN 328
             F+E      +    PG  +  G+  +D 
Sbjct: 291 AQFNEAHQAGFDLNGDPGKALFGGVDSIDG 320


>gi|27380964|ref|NP_772493.1| hypothetical protein bll5853 [Bradyrhizobium japonicum USDA 110]
 gi|27354130|dbj|BAC51118.1| bll5853 [Bradyrhizobium japonicum USDA 110]
          Length = 627

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 82/193 (42%), Gaps = 13/193 (6%)

Query: 139 NTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLL 198
           N + + +Q +R++ ++++          + ++  +N  ++  +A+   A   +DQRD  +
Sbjct: 144 NVTTKGIQSLRSNVEQDLGTSAQQANASMQQIADINTKLQGLSANDPSAATLMDQRDQAI 203

Query: 199 QKISEIIGISTIVRNNNDMVVYTSDGTTLFET-VPRDINFEKMNSYTVTS--ESNPI--- 252
             +S+ + +      +N   +YT+ G  L    +     F    + + TS  + +P    
Sbjct: 204 NTLSKYVDVRVTTDGSNQANIYTTTGIQLVGAGLASQFTFASAGALSATSLYDMDPAKSG 263

Query: 253 -------FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKD 305
                    +G  V     + V  G+I A L++RD  +   QNQ+D++A  +  + S+K 
Sbjct: 264 VGALNIRLPNGSQVDVVANNVVSSGQIAADLKLRDQTLVQAQNQIDQLAATMSSALSDKT 323

Query: 306 PIAGNSENVPGLF 318
                    P  F
Sbjct: 324 TAGSTVSGPPAGF 336


>gi|146296674|ref|YP_001180445.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410250|gb|ABP67254.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 525

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 84/421 (19%), Positives = 167/421 (39%), Gaps = 68/421 (16%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +
Sbjct: 117 IDQFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEI 176

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               S++  +N  I         A+D  DQR++L+ K+S+II  +     +   +V  + 
Sbjct: 177 NSIASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIIDTTAYEDKDGRFIVQIAG 236

Query: 224 GTTL--------FET----VPRDINFEK------MNSYTVTSESNPIFIDGVVV----SS 261
           G TL         ET    + R   F+        N     S+ N   + G+ V     +
Sbjct: 237 GETLVNHFTVYELETDKSKIMRKSGFDSNGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDT 296

Query: 262 NQGSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVL 297
            Q   V  G++K LL +RD +                        +P + N+L+E A+ L
Sbjct: 297 GQVLNVKSGELKGLLDMRDGIGGLNEDIVVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKL 356

Query: 298 IGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG 355
           I  F+E      + N +N        GI    N     +S+T       + + + + D  
Sbjct: 357 IEKFNELHTQGWSLNGQNT-------GI----NFFEPPVSQTFFYARYIKVSDAIMNDLN 405

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +++    ++V NL G  DL+       N   IF             ++ ++ I  L  + 
Sbjct: 406 NIATT--YDVNNLPGGNDLVVDMLRLRNDTSIF-------KEGRFEDFLKSLISNLGVDS 456

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             + +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  +
Sbjct: 457 QGAKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVI 516

Query: 476 L 476
           +
Sbjct: 517 V 517


>gi|309390123|gb|ADO78003.1| flagellar hook-associated protein FlgK [Halanaerobium praevalens
           DSM 2228]
          Length = 572

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 107/260 (41%), Gaps = 51/260 (19%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I++  +SL+  S N S+      V +NA  V+ +F +   ++   +   +  +    +N+
Sbjct: 121 INQFWNSLQDLSNNPSDTAARNMVRENAYNVIDSFQSVENQLNDYKESINDNLSNAAANI 180

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST--------IVRNNN 215
                ++  +N  I     S  + +D LD+RD L +++S +I + +        +V  N 
Sbjct: 181 NNITGKMADLNKQIVSVKGSGQNPNDLLDERDALYKELSSLINVQSREDEQGNLVVSTNG 240

Query: 216 DMVVYTSD-------GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP 268
             +V  SD       G T  +T+P+  N +K+      +E  P                 
Sbjct: 241 LQLVNGSDSYDLETKGFTEDKTIPK--NQDKLIHSQTGNEIRPT---------------- 282

Query: 269 KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPG------------ 316
            GKI A + +RD  +  ++ +LD++A  ++  F+ +     ++  V G            
Sbjct: 283 NGKIDAWMDMRDDKLDFYRGRLDKLAAEMVKEFNSQHKAGYDANGVDGGDFFKPIDEDSD 342

Query: 317 ------LFIADGIKDLDNKL 330
                 L +   IKDL+N L
Sbjct: 343 QSAISQLDLTAAIKDLENGL 362



 Score = 39.7 bits (91), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%)

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           Y R  +  +    S S  +     VV   ++    +  GV+L EE++ LIK +QSY  + 
Sbjct: 496 YFRTIVTSVGAESSRSQQMKNNQDVVLKQLNTLDKSVSGVSLDEEMANLIKYQQSYAAAA 555

Query: 463 KLIMFTDKMLQTLL 476
           K I  TD++L+TL+
Sbjct: 556 KYINKTDQLLETLM 569


>gi|170024641|ref|YP_001721146.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           YPIII]
 gi|169751175|gb|ACA68693.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           YPIII]
          Length = 554

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 141/320 (44%), Gaps = 37/320 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQ 55
           ++ N A +  N A    +++  NI N     Y R++T+      TI+      N   VT 
Sbjct: 4   SLMNTAMSGLNAAQYALSTVSNNITNFQVAGYNRQNTVFAQNGGTITSAGFIGNGVTVTG 63

Query: 56  RSENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            +   N F  +++  + + + G     Q    +  ++S   + +N+ +  +     +L++
Sbjct: 64  VNREYNAFITNQLRASQTQSSGLATYYQQISQIDNLLS---NASNNLSTTMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   KTV+  AE +V  F  + + ++ +    +++I    + +  +  ++  +
Sbjct: 121 LVSNADDDAARKTVLGKAEGLVNQFQNADKYLRDMDDGVNQKITDSATQINNYAEQIAKL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           ND I + + +S  + +  LDQRD L+ ++++I+ ++   ++ +   V  + G +L +   
Sbjct: 181 NDQITRLRGSSGSEPNALLDQRDQLVTELNQIMAVTVTQQDGDAYNVSFAGGLSLVQ--- 237

Query: 233 RDINFEKMNSYTVTSESNPIFIDG--VVVSSNQG---------SAVPKGKIKALLQIRDS 281
                   N+Y V  E+ P   D   + +   +G         S +  G +   L+ R  
Sbjct: 238 ------GPNAYKV--EAIPSSADATRLTLGYKRGNGEATEVDESRITTGSLGGTLKFRSE 289

Query: 282 VVPIFQNQLDEMARVLIGSF 301
            +   +NQL ++A V+  SF
Sbjct: 290 ALDSARNQLGQLALVMADSF 309


>gi|22126384|ref|NP_669807.1| flagellar hook-associated protein FlgK [Yersinia pestis KIM 10]
 gi|45441403|ref|NP_992942.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51596017|ref|YP_070208.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           IP 32953]
 gi|108807179|ref|YP_651095.1| flagellar hook-associated protein FlgK [Yersinia pestis Antiqua]
 gi|108812477|ref|YP_648244.1| flagellar hook-associated protein FlgK [Yersinia pestis Nepal516]
 gi|145598604|ref|YP_001162680.1| flagellar hook-associated protein FlgK [Yersinia pestis Pestoides
           F]
 gi|149366245|ref|ZP_01888280.1| flagellar hook-associated protein 1 [Yersinia pestis CA88-4125]
 gi|153948415|ref|YP_001401283.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           IP 31758]
 gi|162421752|ref|YP_001606478.1| flagellar hook-associated protein FlgK [Yersinia pestis Angola]
 gi|165925892|ref|ZP_02221724.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938764|ref|ZP_02227319.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010871|ref|ZP_02231769.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166210949|ref|ZP_02236984.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167401050|ref|ZP_02306553.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167420208|ref|ZP_02311961.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425863|ref|ZP_02317616.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467496|ref|ZP_02332200.1| flagellar hook-associated protein FlgK [Yersinia pestis FV-1]
 gi|186895120|ref|YP_001872232.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928928|ref|YP_002346803.1| flagellar hook-associated protein FlgK [Yersinia pestis CO92]
 gi|229896251|ref|ZP_04511421.1| flagellar hook-associated protein 1 [Yersinia pestis Pestoides A]
 gi|229897188|ref|ZP_04512344.1| flagellar hook-associated protein 1 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897915|ref|ZP_04513066.1| flagellar hook-associated protein 1 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902854|ref|ZP_04517971.1| flagellar hook-associated protein 1 [Yersinia pestis Nepal516]
 gi|270486639|ref|ZP_06203713.1| flagellar hook-associated protein FlgK [Yersinia pestis KIM D27]
 gi|294504024|ref|YP_003568086.1| flagellar hook-associated protein [Yersinia pestis Z176003]
 gi|21959370|gb|AAM86058.1|AE013853_6 flagellar biosynthesis protein, hook-filament junction protein 1
           [Yersinia pestis KIM 10]
 gi|45436263|gb|AAS61819.1| flagellar hook-associated protein 1 [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51589299|emb|CAH20920.1| flagellar hook-associated protein 1 [Yersinia pseudotuberculosis IP
           32953]
 gi|108776125|gb|ABG18644.1| flagellar hook-associated protein 1 [Yersinia pestis Nepal516]
 gi|108779092|gb|ABG13150.1| flagellar hook-associated protein 1 [Yersinia pestis Antiqua]
 gi|115347539|emb|CAL20448.1| flagellar hook-associated protein 1 [Yersinia pestis CO92]
 gi|145210300|gb|ABP39707.1| flagellar hook-associated protein 1 [Yersinia pestis Pestoides F]
 gi|149292658|gb|EDM42732.1| flagellar hook-associated protein 1 [Yersinia pestis CA88-4125]
 gi|152959910|gb|ABS47371.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           IP 31758]
 gi|162354567|gb|ABX88515.1| flagellar hook-associated protein FlgK [Yersinia pestis Angola]
 gi|165913378|gb|EDR32000.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922096|gb|EDR39273.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990215|gb|EDR42516.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166208129|gb|EDR52609.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166961903|gb|EDR57924.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049439|gb|EDR60847.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055262|gb|EDR65059.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186698146|gb|ACC88775.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680301|gb|EEO76400.1| flagellar hook-associated protein 1 [Yersinia pestis Nepal516]
 gi|229688956|gb|EEO81021.1| flagellar hook-associated protein 1 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693525|gb|EEO83574.1| flagellar hook-associated protein 1 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701174|gb|EEO89203.1| flagellar hook-associated protein 1 [Yersinia pestis Pestoides A]
 gi|262361790|gb|ACY58511.1| flagellar hook-associated protein [Yersinia pestis D106004]
 gi|262366074|gb|ACY62631.1| flagellar hook-associated protein [Yersinia pestis D182038]
 gi|270335143|gb|EFA45920.1| flagellar hook-associated protein FlgK [Yersinia pestis KIM D27]
 gi|294354483|gb|ADE64824.1| flagellar hook-associated protein [Yersinia pestis Z176003]
          Length = 554

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 141/320 (44%), Gaps = 37/320 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQ 55
           ++ N A +  N A    +++  NI N     Y R++T+      TI+      N   VT 
Sbjct: 4   SLMNTAMSGLNAAQYALSTVSNNITNFQVAGYNRQNTVFAQNGGTITSAGFIGNGVTVTG 63

Query: 56  RSENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            +   N F  +++  + + + G     Q    +  ++S   + +N+ +  +     +L++
Sbjct: 64  VNREYNAFITNQLRASQTQSSGLATYYQQISQIDNLLS---NASNNLSTTMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   KTV+  AE +V  F  + + ++ +    +++I    + +  +  ++  +
Sbjct: 121 LVSNADDDAARKTVLGKAEGLVNQFQNADKYLRDMDDGVNQKITDSATQINNYAEQIAKL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           ND I + + +S  + +  LDQRD L+ ++++I+ ++   ++ +   V  + G +L +   
Sbjct: 181 NDQITRLRGSSGSEPNALLDQRDQLVTELNQIMAVTVTQQDGDAYNVSFAGGLSLVQ--- 237

Query: 233 RDINFEKMNSYTVTSESNPIFIDG--VVVSSNQG---------SAVPKGKIKALLQIRDS 281
                   N+Y V  E+ P   D   + +   +G         S +  G +   L+ R  
Sbjct: 238 ------GPNAYKV--EAIPSSADATRLTLGYKRGNGEATEVDESRITTGSLGGTLKFRSE 289

Query: 282 VVPIFQNQLDEMARVLIGSF 301
            +   +NQL ++A V+  SF
Sbjct: 290 ALDSARNQLGQLALVMADSF 309


>gi|320015457|gb|ADV99028.1| flagellar hook-associated protein 1 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 554

 Score = 48.1 bits (113), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 141/320 (44%), Gaps = 37/320 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISPE----NVTVVTQ 55
           ++ N A +  N A    +++  NI N     Y R++T+      TI+      N   VT 
Sbjct: 4   SLMNTAMSGLNAAQYALSTVSNNITNFQVAGYNRQNTVFAQNGGTITSAGFIGNGVTVTG 63

Query: 56  RSENKNMF--DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            +   N F  +++  + + + G     Q    +  ++S   + +N+ +  +     +L++
Sbjct: 64  VNREYNAFITNQLRASQTQSSGLATYYQQISQIDNLLS---NASNNLSTTMQDFFSNLQN 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +D   KTV+  AE +V  F  + + ++ +    +++I    + +  +  ++  +
Sbjct: 121 LVSNADDDAARKTVLGKAEGLVNQFQNADKYLRDMDDGVNQKITDSATQINNYAEQIAKL 180

Query: 174 NDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           ND I + + +S  + +  LDQRD L+ ++++I+ ++   ++ +   V  + G +L +   
Sbjct: 181 NDQITRLRGSSGSEPNALLDQRDQLVTELNQIMAVTVTQQDGDAYNVSFAGGLSLVQ--- 237

Query: 233 RDINFEKMNSYTVTSESNPIFIDG--VVVSSNQG---------SAVPKGKIKALLQIRDS 281
                   N+Y V  E+ P   D   + +   +G         S +  G +   L+ R  
Sbjct: 238 ------GPNAYKV--EAIPSSADATRLTLGYKRGNGEATEVDESRITTGSLGGTLKFRSE 289

Query: 282 VVPIFQNQLDEMARVLIGSF 301
            +   +NQL ++A V+  SF
Sbjct: 290 ALDSARNQLGQLALVMADSF 309


>gi|226320912|ref|ZP_03796463.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 29805]
 gi|226233684|gb|EEH32414.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 29805]
          Length = 358

 Score = 48.1 bits (113), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESWH-DLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDVRDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|20086976|gb|AAM10736.1| flagella-associated protein K [Leptospira interrogans serovar lai]
          Length = 543

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 127/309 (41%), Gaps = 57/309 (18%)

Query: 19  QQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHS--SAIG 75
           Q   +   NI NADNK+Y R R TMT + P              ++D  L+  +    IG
Sbjct: 20  QALQTTGHNISNADNKHYARQRVTMTAMDP--------------LYDPSLNRANLPGQIG 65

Query: 76  QQRLLQSFEALKE--------MMSADDHYNNSPTHYI------------SKLRDSLESYS 115
           Q   + S E +++          S +  Y  +   Y+            + LR  ++ + 
Sbjct: 66  QGVEIASIERIRDNFIDDRIIETSGNKDYWAARIEYLYQLETVFNEPNGTTLRTLMDKFW 125

Query: 116 K------NLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
                  N  ED   ++V+ + A  +        R++ ++R  A++EIE +  +L     
Sbjct: 126 SSWEDLANYPEDNAHRSVVLEKANGLGSRTEDVYRKLAQLRDQANREIETKTYHLNTIAE 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            +  +N+ I    A     +D  D+RD LLQ++S ++          D+ +  SD   L 
Sbjct: 186 NIRTLNERIGKSEALGDRPNDLYDKRDALLQELSSLV----------DVTIGRSDEDELM 235

Query: 229 ETVPRDINFEKMNSYTVTSESNPI---FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
             + + I  +   +  +    NP     +D    ++     + KG+++ L+++R  V+  
Sbjct: 236 VFIGQQILVQGNKANKIDIIGNPSKDGLLDLFWSATGDPVLLRKGRLQGLIEVRGKVIRE 295

Query: 286 FQNQLDEMA 294
             +Q+D ++
Sbjct: 296 KIDQVDALS 304


>gi|225548519|ref|ZP_03769567.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 94a]
 gi|225370782|gb|EEH00217.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 94a]
          Length = 627

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 99/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +   +    +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRSRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|229916660|ref|YP_002885306.1| flagellar hook-associated protein FlgK [Exiguobacterium sp. AT1b]
 gi|229468089|gb|ACQ69861.1| flagellar hook-associated protein FlgK [Exiguobacterium sp. AT1b]
          Length = 504

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 90/420 (21%), Positives = 169/420 (40%), Gaps = 71/420 (16%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEI 156
           N   H + K   SL+  + N  +D   ++V+   A  + Q FN  +  + K++ D   E 
Sbjct: 113 NGLAHALDKFWSSLQDLAVN-PDDTGARSVVRQRALTLTQTFNYMSSSLSKVQEDLKAEA 171

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI------ 210
            +    +   L+++  VN  I          ++  D+RD  + ++S+ I    +      
Sbjct: 172 GVVTKKINDLLTKIGDVNRQIGDAEPLGVLPNELYDERDRYMDELSQYIEFERVPVDYTN 231

Query: 211 --VRNNNDMVVY-------------TSDGTTLFETVPRDINFEKMNSYTVT----SESNP 251
              R N+  V               T    TL + +   +   K+N   +T      +  
Sbjct: 232 GETRGNSQRVAEGRIDIQISVPGTPTPTKITLVDGLTGGVG--KINDMEITDAAAGTTTL 289

Query: 252 IFIDGVVVSSNQGSAVPKGKIKALL---------QIRDSVVPIFQNQLDEMARVLIGSFS 302
           +F D           +P GK+KAL+         +  D         LD MA+    +F+
Sbjct: 290 VFDD-----------LPNGKLKALVDMYGSATGTETHDGAFTKMLKDLDVMAKEFTTAFN 338

Query: 303 E--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
           +  K    GN ++ P      GI    +    G ++T+ VNP   SN + +    ++SK 
Sbjct: 339 DLHKTFYDGNVQDNP---RQTGI----DFFIVGDAKTVTVNPTILSNLNLI----AISKD 387

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLL-EYARNSIGWLEKNRSDSH 419
              N+ + +G  DL N       KN       G +T  T + +Y +N IG +    S + 
Sbjct: 388 --QNIGDGSGALDLANL------KNAQITFTGGSSTATTSIGKYYQNVIGNMAVEASQNG 439

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +L   +  + +   +   +   V+L EE++ +I+ + +YN + + I   D+ML  ++ G+
Sbjct: 440 NLAKSTFALLSSSDQRRQSVSAVSLDEEMTMMIQYQHAYNAAARNITAVDEMLDKIINGM 499


>gi|52082076|ref|YP_080867.1| flagellar hook-associated protein FlgK [Bacillus licheniformis ATCC
           14580]
 gi|52787465|ref|YP_093294.1| flagellar hook-associated protein FlgK [Bacillus licheniformis ATCC
           14580]
 gi|319647943|ref|ZP_08002161.1| FlgK protein [Bacillus sp. BT1B_CT2]
 gi|52005287|gb|AAU25229.1| flagellar hook-associated protein 1 [Bacillus licheniformis ATCC
           14580]
 gi|52349967|gb|AAU42601.1| FlgK [Bacillus licheniformis ATCC 14580]
 gi|317390284|gb|EFV71093.1| FlgK protein [Bacillus sp. BT1B_CT2]
          Length = 507

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 75/393 (19%), Positives = 155/393 (39%), Gaps = 39/393 (9%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +S++  + N  E      V    + V   FNT    +  ++++   +I+  +  +   LS
Sbjct: 127 NSIQELTNNAHEPSAASVVAQKGQAVADTFNTLYESLTTVQSNLGDQIDQNVMTINSLLS 186

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N+ I     + +  +D  D+RD LL ++S ++ I           + T++G    
Sbjct: 187 QLNSLNEQIAKVEPNGYLPNDLYDKRDQLLDELSSMVNIKVSYAKTGGNPLATAEGIVSI 246

Query: 229 ETVPRDINFEKM----NSYTVTSESNPIFID---GVVVSSNQG-------SAVPKGKIKA 274
           E +  D+N + +    +    T+E+  +  D   G+V   + G       S   KG +  
Sbjct: 247 EVL--DVNGQSLGKVLDGPNFTTETVKVNYDNDTGLVTGVSLGGTDIGIDSFTSKGSLLG 304

Query: 275 LLQI--------RDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDL 326
           L++            + P     LD MA      F+        S   PG    +     
Sbjct: 305 LIESYGYMSNGEEKGLYPEMLADLDTMALAFAKEFNAVHQSGFTSSGEPGGIFFE-FTGG 363

Query: 327 DNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNF 386
           + +  +G +  I V  +  ++      G  V+        + A   +L N +        
Sbjct: 364 EAEPAKGAAGKIKVADEIMNSK-----GDKVAASLNGEASDNANATNLANVFTKKIQ--- 415

Query: 387 IFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQE 446
           I D         T+L+Y    IG +     +++ L   ++ + N    +  +   V+L E
Sbjct: 416 IGDKT------TTVLDYYAGIIGEMGVKAQETNRLAKNTETLVNTAELNRQSVSAVSLDE 469

Query: 447 ELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           E+S +I+ + +YN + ++I   D++L  ++ G+
Sbjct: 470 EMSNMIQFQHAYNAAARMITLQDEVLDKIINGM 502


>gi|146307863|ref|YP_001188328.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina ymp]
 gi|145576064|gb|ABP85596.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina ymp]
          Length = 681

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 92/201 (45%), Gaps = 16/201 (7%)

Query: 101 THYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI 160
           T  + +L  +L++ +++ +     +  +  AE + + FNT    + +  A  +K++    
Sbjct: 107 TPGLQRLFAALQTAAEDPANIPARQLALSEAEGLSKRFNTIYDRLYEQNAFLNKQLSAVT 166

Query: 161 SNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY 220
             + +  + +   NDAI    ++    +D LD R+  ++K+SE IG++ + +++N   ++
Sbjct: 167 DQINQLATSIAGFNDAIAVAASNGQAPNDLLDAREEAVRKLSEFIGVTVVPQDDNSYNLF 226

Query: 221 TSDGTTLFETVPRDINFEKMNSYTVTSESNPI-----FIDGVVVSSNQG--SAVPKGKIK 273
              G  L       +  +         +S+P+     F+ G   SS QG  S +  G++ 
Sbjct: 227 IGSGQPLV------VGSKAARLEVTPGQSDPLRSEIQFVSG---SSRQGITSLITGGEMG 277

Query: 274 ALLQIRDSVVPIFQNQLDEMA 294
            LL+ R  V+    N +  +A
Sbjct: 278 GLLRYRQDVLDQSMNAVGRLA 298


>gi|312877567|ref|ZP_07737526.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795642|gb|EFR12012.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 522

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 81/418 (19%), Positives = 166/418 (39%), Gaps = 65/418 (15%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           + +   SL+  SKN     +   V   A  +    +   ++++ ++++ + ++  +I  +
Sbjct: 117 VDQFFSSLQELSKNPESLTVRALVRQRASALTDAIHKMYKQLEDLQSELNDQVYDKILEI 176

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + 
Sbjct: 177 NSIASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAG 236

Query: 224 GTTL--------FET----VPRDINFEKMNSYTVTSESNPIF------IDGVVV----SS 261
           G TL         ET    + R   F+     T     +P+       + G+ V     +
Sbjct: 237 GETLVNHFTVYELETDKSKIMRKSGFDSNGLPTGFKPDDPLSQQNLYDVPGLFVVMWKDT 296

Query: 262 NQGSAVPKGKIKALLQIRDSV---------------------VPIFQNQLDEMARVLIGS 300
            Q   +  G++K LL +RD V                     +P + N+L+E A+ LI  
Sbjct: 297 GQVLNIKSGELKGLLDMRDGVGGLDEDSQAGVDVPNKNSFTGIPYYLNRLNEFAQKLIEK 356

Query: 301 FSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
           F+E      + N +N        GI    N     + +T       + + + + D  +++
Sbjct: 357 FNELHTQGWSLNGQNT-------GI----NFFEPPVGQTFFYARYIKVSDAIMNDLNNIA 405

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
               ++V NL G  DL+       N   IF             ++ ++ I  L  +   +
Sbjct: 406 TT--YDVNNLPGGNDLVVDMLKLRNDTSIF-------KEGKFEDFLKSLISNLGVDSQGA 456

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML T++
Sbjct: 457 KNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDTIV 514


>gi|183222558|ref|YP_001840554.1| flagellar hook-associated protein FlgK [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189912593|ref|YP_001964148.1| flagellar hook-associated protein FlgK [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167777269|gb|ABZ95570.1| Endoflagellar hook junction protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167780980|gb|ABZ99278.1| Flagellar hook-associated protein 1 (HAP1) [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 637

 Score = 47.8 bits (112), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 131/310 (42%), Gaps = 59/310 (19%)

Query: 19  QQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHS--SAIG 75
           Q   +   NI NADNK+Y R R  M ++ P              ++D   +       IG
Sbjct: 20  QAIQTTGHNISNADNKHYARQRVVMNSMDP--------------IYDPAFNRAEVPGQIG 65

Query: 76  Q-------QRLLQSF--------EALKEMMSADDHY-------NNSPTHY-ISKLRDSLE 112
           Q       +R+  +F         +LKE     + Y        N PT   +  + D   
Sbjct: 66  QGVKISEIERVRDNFIDDRIIDSSSLKEYWGKKNDYLYQVETVFNEPTGTTLRSMMDQFW 125

Query: 113 SYSKNLS---EDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           S  ++LS   E+   + V+ + AE +        R++  +R  +++EIE ++++L     
Sbjct: 126 SSWEDLSNYPEETAHRAVVQEKAEALGSRMEDVYRKLSLLRDQSNREIEAKVNHLNTVSE 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            +  +N+ I    A   + +D LD+RD LLQ   E+ G++       D+ +  SD   L 
Sbjct: 186 NIKSLNEKITKSQALGDNPNDLLDRRDELLQ---ELAGMA-------DITIGRSDDDELM 235

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA----VPKGKIKALLQIRDSVVP 284
             + + I  +    + +    NP   DG++     G+     + +G I+AL +IRD ++ 
Sbjct: 236 VFIGQQILIQGQKVHKIDLVGNP-NNDGLLDLKWSGTGDTVLLRQGSIQALYEIRDRILV 294

Query: 285 IFQNQLDEMA 294
              N +D +A
Sbjct: 295 EKINAVDALA 304



 Score = 37.0 bits (84), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 28/37 (75%)

Query: 440 VGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +GVNL EE++ +++ +QSYN S ++I   ++ML T++
Sbjct: 596 MGVNLDEEMANMVQFQQSYNASARMISTLNEMLDTII 632


>gi|166712056|ref|ZP_02243263.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 624

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 101/238 (42%), Gaps = 25/238 (10%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   +++++ A D L
Sbjct: 137 NSLATRFKQLNGQMDGLSHEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQNAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDINFEKMNSY 243
           DQRD L+ K+    G + ++++   + V+T+ G  L          TV       K+   
Sbjct: 195 DQRDALVSKLVGYTGGTAVMQDGGFINVFTAGGQALVVATTSSKLTTVADPYQPSKLQVA 254

Query: 244 TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             T   N      V +S+N       G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 255 MQTQGQN------VSLSANS----LGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|284007169|emb|CBA72453.1| flagellar hook-associated protein FlgK [Arsenophonus nasoniae]
          Length = 545

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 157/318 (49%), Gaps = 35/318 (11%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT--MTTISPENVTVVTQRSENKNM 62
           ++ N A +    A    ++I  NI N+  ++Y R+ T   T  S  N+  V + S  +  
Sbjct: 4   SLMNTAMSGLKVAQTALSTIGSNIANSKVESYHRQTTTLATDGSNNNINGV-KVSGIQRE 62

Query: 63  FDKVLHAH-SSAI---GQQRLLQSFE-ALKEMMSADD-HYNNSPTHYISKLRD-SLESYS 115
           +D+ ++AH + A+   G++++   F   L ++MSA D    +S T + + L+  S ++ S
Sbjct: 63  YDEFINAHYNKAVTEQGERKIYAEFALELDKLMSASDTDLASSMTEFFTSLQTLSTDAAS 122

Query: 116 KNLSEDILGKT--VIDNAEEVVQNFNTSAREVQK-IRADADKEIELEISNLRRFLSELTV 172
             L  +++ K   +I   + V Q FNT  + +   I   ADK     +S L + +++L  
Sbjct: 123 APLRTEVINKAQAMISRFKSVEQQFNTMEQRLNGNIGQMADK-----VSQLAQQVAKLN- 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
             +  K K    +  ++ LD+RD L +++S + GIS ++R ++ + +  ++G +L     
Sbjct: 177 -GEMTKIKGLQGYVPNEMLDRRDQLTRELSTVAGIS-VIRQDDTININLANGLSL----- 229

Query: 233 RDINFEKMNSYT-VTSESNPIFI-----DGVVVSSN-QGSAVPKGKIKALLQIRDSVVPI 285
             +N  K N  T ++S ++P  I     DG+         ++  G++   L +RD V+  
Sbjct: 230 --VNGTKANKITAISSAADPAQITLAYDDGINPPREIDTRSITGGELAGALAVRDEVLQP 287

Query: 286 FQNQLDEMARVLIGSFSE 303
            + +++++  +L  S ++
Sbjct: 288 NRQKINQLGLILTESINQ 305


>gi|332284025|ref|YP_004415936.1| flagellar hook-associated protein FlgK [Pusillimonas sp. T7-7]
 gi|330427978|gb|AEC19312.1| flagellar hook-associated protein FlgK [Pusillimonas sp. T7-7]
          Length = 553

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/309 (20%), Positives = 127/309 (41%), Gaps = 31/309 (10%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------ISPENVTV 52
           L   N AQN    A         NI NA  + Y R+  ++            I      V
Sbjct: 8   LTGLNAAQNRLQTAGH-------NINNAATEGYNRQSVLSATAGASATSAGYIGRGVQAV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
             QR+ +  +F ++  A ++             +  +  AD     +P   + K  D ++
Sbjct: 61  TVQRAYDSFLFRQLTSAQTTGASLAAYGSEITQINNLF-ADRTVGITPA--LQKFFDGIQ 117

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + +   ++    + ++  A  +V   N +   +   R + + +I   ++ +  +   +  
Sbjct: 118 AVASAPADSAARQELLGRASSLVGQINDNNAFLDSQRGNINTQITTVVTQINSYAERIRD 177

Query: 173 VNDAIKFK--TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNN-DMVVYTS----DGT 225
           +N+ I     TAS+H+ +D LDQRD L+ ++ +++G+  I ++ N ++ V        G 
Sbjct: 178 LNNQITTARATASQHEPNDLLDQRDQLVAELGQLVGVKVIEQDGNFNLTVGNGQILLGGD 237

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
           T+F    +    +   + TV + + P+   GVV      S++  G +  LL  R   +  
Sbjct: 238 TVFPLHAQPSADDP--ARTVVAYTAPVN-GGVVTVELADSSIKGGALGGLLDYRREALDS 294

Query: 286 FQNQLDEMA 294
            QN+L  +A
Sbjct: 295 VQNKLGRLA 303


>gi|1518046|gb|AAB62740.1| FlgK protein [Borrelia burgdorferi]
          Length = 616

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESWH-DLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|58582202|ref|YP_201218.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|188576762|ref|YP_001913691.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188576954|ref|YP_001913883.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|58426796|gb|AAW75833.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188521214|gb|ACD59159.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188521406|gb|ACD59351.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 624

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 99/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   +++++ A D L
Sbjct: 137 NSLATRFKQLNGQMDGLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQNAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   + V+T+ G  L       +        TV     P
Sbjct: 195 DQRDALVSKLVGYTGGTAVMQDGGFINVFTAGGQALV------VATTSSKLTTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSANSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|295096219|emb|CBK85309.1| flagellar hook-associated protein FlgK [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 546

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 104/222 (46%), Gaps = 23/222 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   DD  +++     + L+D   SL++   N  +    +TV+  A+ +V  F T+ +
Sbjct: 90  QQMSKIDDVLSDTTNSLSANLQDFFKSLQTLVSNAEDPAARQTVLGKADGLVNQFKTNDQ 149

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKI 201
            ++   A  +  I   +  +  +  ++  +ND I   T     A  ++ LDQRD L+ ++
Sbjct: 150 YLRDQDAQVNTAISTSVDQINNYAKQIANLNDQISRLTGVGAGASPNELLDQRDQLVSEL 209

Query: 202 SEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP-----IFIDG 256
           ++I+G+   V+++    +  ++G TL +      N  ++ +  V S ++P      ++D 
Sbjct: 210 NKIVGVDVTVQDSGTYNISIANGYTLVQ----GSNASQLAA--VKSSADPARTTIAYVDA 263

Query: 257 ----VVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
               V +S  Q   +  G +  LL  R   +   +N L++MA
Sbjct: 264 AAGNVEISEKQ---ITTGSLGGLLTFRSQDLDQARNTLNQMA 302


>gi|254294559|ref|YP_003060582.1| flagellar hook-associated protein FlgK [Hirschia baltica ATCC
           49814]
 gi|254043090|gb|ACT59885.1| flagellar hook-associated protein FlgK [Hirschia baltica ATCC
           49814]
          Length = 714

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 127/293 (43%), Gaps = 21/293 (7%)

Query: 21  FASIVRNIENADNKNYVRRDT----MTTISPE-NVTVVTQRSENKNMFDKVLHAHSSAIG 75
            +++  N+ N + + Y R DT    +  +S    V V  QR+ +K +    +   ++ +G
Sbjct: 21  LSTVSTNVANVNTEGYTRLDTHFNSLGAVSGSFGVEVKVQRAADKFLAASEMRTAAT-VG 79

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
              +L  F    + +  +     S    +  + DS+ S + + S  +   + I + + ++
Sbjct: 80  ATSVLAGFMDRAQGLLGNPSDGGSVFASLDAVLDSMGSLALDPSSSLRQGSAISDIQNML 139

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
              N +A E+  +R +A+ ++   I      +  +  +N +I+    +  DA    +++ 
Sbjct: 140 NQVNQTADELSALREEANAQLRSVIGEANTLMETIAELNTSIQQSKIAGVDATQAENEQS 199

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
           +L+ ++SEI+ +    R    + + T++G  L       ++ E   S+++   S      
Sbjct: 200 ILIDRLSEIVDVRAQERPLGGVDLRTTNGYLL-------VSMEAA-SFSMGDVSGLQGYP 251

Query: 256 GVVVS-SNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
            V VS SN+ S +P       G+I  L+Q RD  +P       E A  L+ S 
Sbjct: 252 SVEVSHSNESSKLPLDKYIQSGEIMGLIQARDVDIPELSVAFGEYASGLVDSL 304


>gi|160878464|ref|YP_001557432.1| flagellar hook-associated protein FlgK [Clostridium phytofermentans
           ISDg]
 gi|160427130|gb|ABX40693.1| flagellar hook-associated protein FlgK [Clostridium phytofermentans
           ISDg]
          Length = 613

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 88/189 (46%), Gaps = 20/189 (10%)

Query: 107 LRDSLESYSKNLSEDILGKTVIDN-AEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           + +SL+  SK   ED+  +T + N A+      N+ +  + +++ + + EI+ ++  +  
Sbjct: 119 MYNSLQELSKQ-PEDLTVRTQVTNMAQSTCDYVNSLSTSLSRLQEECNFEIKNQVERVNS 177

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST---IVRNNNDMVVYTS 222
              ++ +V   I     +   A+D  DQR +++ ++S    +S    IV +N  +  YT 
Sbjct: 178 LAQQIAIVTKQINTIEVNGGTANDLRDQRALMVDELSGFATVSVNERIVGDNVGVTSYTV 237

Query: 223 --DGTTL--------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
             DG TL         + VPRD    K+N    T   N  + +G  V  N  S    G +
Sbjct: 238 KLDGQTLVDNYEANQLKVVPRDT---KVNQLDATGLFNVCWSNGQPVDLN--SPTMGGTL 292

Query: 273 KALLQIRDS 281
           KAL+Q+RD 
Sbjct: 293 KALIQVRDG 301


>gi|219685806|ref|ZP_03540615.1| flagellar hook-associated protein FlgK [Borrelia garinii Far04]
 gi|219672639|gb|EED29669.1| flagellar hook-associated protein FlgK [Borrelia garinii Far04]
          Length = 627

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 97/208 (46%), Gaps = 14/208 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+ ++L+    G    K +++  +   +   +    +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-QDLANQPQGLAERKIILERGKSFCELIRSRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  +I +
Sbjct: 165 IYIMANDEIKITTDEANNYIKNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNLISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  S+G  L + ++  +   E  N  T T  S       ++ ++N    
Sbjct: 225 SIENKQDPNEFLIHSEGRHLVQGSIANEFKLEATNGPTRTRWS-------ILWANNDKVN 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           +  GK+ +LL IRD  +    N+L+ +A
Sbjct: 278 LETGKLGSLLNIRDEEIKNEINELNNLA 305


>gi|225552251|ref|ZP_03773191.1| flagellar hook-associated protein FlgK [Borrelia sp. SV1]
 gi|225371249|gb|EEH00679.1| flagellar hook-associated protein FlgK [Borrelia sp. SV1]
          Length = 627

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|330889076|gb|EGH21737.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 546

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|220934400|ref|YP_002513299.1| flagellar hook-associated protein FlgK [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995710|gb|ACL72312.1| flagellar hook-associated protein FlgK [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 637

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 134/319 (42%), Gaps = 32/319 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVT-----VVT 54
           +S L  F +A  +  N          NI N+  + Y R R  ++T  P+           
Sbjct: 16  VSGLLAFQRALGVTGN----------NIANSATEGYSRQRIDLSTQIPQFAGNGYFGSGV 65

Query: 55  QRSENKNMFDKVLHAH----SSAIGQQRLLQSFEALKEMMSADDHYNNSPT--HYISKLR 108
           Q S    +FD+ +       +SA  Q  L   F    + + AD     +P    + + ++
Sbjct: 66  QVSGVNRIFDQFVETQLRNSTSASEQYALYYDFARRVDNLLADPDSGLAPGLQQFFAAVQ 125

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D     + N +  +L    I  AE +V  F+   + +++ R   + +I+  ++ +     
Sbjct: 126 DVANDPTSNAARQVL----ISEAESLVDRFSFLNQRLEEQRNLVNGQIQTTVAEINSLAE 181

Query: 169 ELTVVNDAI--KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            +  +N+ I            +D LDQRD L+ ++SE++ ++TI +++  + V+  +G  
Sbjct: 182 AIADLNEDIVSALGRGGGAPPNDLLDQRDRLVLQLSELVSVNTIEQDDGALNVFIGNGQN 241

Query: 227 L-FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
           L     P  +  + +       +   +     V  +   S +  G++ ALL +R SV+ +
Sbjct: 242 LVLGNRPTVLVADGLGPDPAQMQVGYVSPGATVDIT---SYMTGGRLGALLDLRTSVLDV 298

Query: 286 FQNQLDEMARVLIGSFSEK 304
            QN L   A  L  +F+++
Sbjct: 299 AQNSLGRTAIGLAQAFNDQ 317


>gi|323527706|ref|YP_004229859.1| flagellar hook-associated protein FlgK [Burkholderia sp. CCGE1001]
 gi|323384708|gb|ADX56799.1| flagellar hook-associated protein FlgK [Burkholderia sp. CCGE1001]
          Length = 657

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 62/133 (46%), Gaps = 5/133 (3%)

Query: 99  SPTHYISKLRDS----LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADK 154
           SPT  I+    S    +++ + N S     +T +  A+ +    N + ++   +R   + 
Sbjct: 101 SPTAGIASAITSYFTGMQNVANNASSLATRQTAMSGAQTLANQINAAGQQYDALRESVNT 160

Query: 155 EIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN 214
           ++   +S +  +  ++  +N  I   +      +  LDQRD+ +  +S++IG+  +V +N
Sbjct: 161 QLSNTVSQINSYTQQIAQLNGQINAASTQGQPPNQLLDQRDLAVSNLSQLIGVQ-VVNSN 219

Query: 215 NDMVVYTSDGTTL 227
               V+ S+G  L
Sbjct: 220 GAYSVFMSNGQPL 232


>gi|219684499|ref|ZP_03539442.1| flagellar hook-associated protein FlgK [Borrelia garinii PBr]
 gi|219671861|gb|EED28915.1| flagellar hook-associated protein FlgK [Borrelia garinii PBr]
          Length = 627

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 97/208 (46%), Gaps = 14/208 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+ ++L+    G    K +++  +   +   +    +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-QDLANQPQGLAERKIILERGKSFCELIRSRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  +I +
Sbjct: 165 IYIMANDEIKITTDEANNYIKNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNLISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  S+G  L + ++  +   E  N  T T  S       ++ ++N    
Sbjct: 225 SIENKQDPNEFLIHSEGRHLVQGSIANEFKLEATNGPTRTRWS-------ILWANNDKVN 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           +  GK+ +LL IRD  +    N+L+ +A
Sbjct: 278 LETGKLGSLLNIRDEEIKNEINELNNLA 305


>gi|15594526|ref|NP_212315.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi B31]
 gi|216264299|ref|ZP_03436291.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 156a]
 gi|221217529|ref|ZP_03588999.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 72a]
 gi|223889273|ref|ZP_03623861.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 64b]
 gi|226321499|ref|ZP_03797025.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi Bol26]
 gi|3915691|sp|P70859|FLGK_BORBU RecName: Full=Flagellar hook-associated protein 1; Short=HAP1
 gi|2688082|gb|AAC66579.1| flagellar hook-associated protein (flgK) [Borrelia burgdorferi B31]
 gi|215980772|gb|EEC21579.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 156a]
 gi|221192592|gb|EEE18809.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 72a]
 gi|223885306|gb|EEF56408.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 64b]
 gi|226232688|gb|EEH31441.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi Bol26]
 gi|312148243|gb|ADQ30902.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi JD1]
          Length = 627

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|218249283|ref|YP_002374709.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi ZS7]
 gi|218164471|gb|ACK74532.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi ZS7]
          Length = 627

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWTNNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|168699687|ref|ZP_02731964.1| probable flagellar hook-associated protein [Gemmata obscuriglobus
           UQM 2246]
          Length = 562

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 90/200 (45%), Gaps = 22/200 (11%)

Query: 109 DSLESYSKNLSE-----DILG--KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEIS 161
           D LES+   + E     D L   +T++  A ++    N +A ++ ++R+D  ++I   + 
Sbjct: 103 DKLESFFNQVEELTARPDSLASRRTILTAATDLSNQLNATAGDIDRLRSDLGRKIGATVD 162

Query: 162 NLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
            +    + +  +N  I  K      A+D  DQRDV +  +S++I +  +   N  + V +
Sbjct: 163 QVNTLATRIASLNTQILTKENRGLTANDLRDQRDVAIDDLSKLIDVKIVEVPNGQINVIS 222

Query: 222 SDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV---PKGKIKALLQI 278
            D   +          E  N +TV+  +N    D +V++    +A      G +   +Q 
Sbjct: 223 GDSAVVVG--------EFANRFTVSQNAN----DDIVITDTSAAATRTFRSGSLAGDVQS 270

Query: 279 RDSVVPIFQNQLDEMARVLI 298
            ++ +P  + +LD +A  LI
Sbjct: 271 FNTDIPALRARLDTLAGQLI 290


>gi|300693344|ref|YP_003749317.1| flagellar hook-filament junction protein 1 [Ralstonia solanacearum
           PSI07]
 gi|299075381|emb|CBJ34676.1| flagellar hook-filament junction protein 1 [Ralstonia solanacearum
           PSI07]
          Length = 642

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 95/218 (43%), Gaps = 20/218 (9%)

Query: 27  NIENADNKNYVRRDTMTTISPENVTVVTQR---------SENKNMFDKVLHAHSSAIGQQ 77
           NI NA    Y R++ + T   EN  + T           +  K ++D+ L A   +   Q
Sbjct: 26  NIANASTPGYSRQEAVQT---ENTPMATGAGYLGQGVNVTTVKRIYDQFLTAQVQS--GQ 80

Query: 78  RLLQSFEALKEMMSADDHY----NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
               + + L  ++S  D Y    N+     ++   ++ +S + N S     +  +  A  
Sbjct: 81  ASTSAADQLNSLVSGLDSYLSDSNSGLGSALTGFFNAADSLASNPSSTSARQVFLSAAST 140

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASK-HDAHDFL 191
           +   FN  A ++  +    + +++ +++++     ++  +ND I K + AS    A+D  
Sbjct: 141 LQTRFNAVAGQMNSLSTQVNTQVQTQVNSVNSTAQQIAALNDQIAKAEAASGGQPANDLR 200

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           DQRD L+Q +++ I  S +   +    +Y  +G  L +
Sbjct: 201 DQRDQLVQTLNQSIKTSVVQTGDGQYNIYVGNGQALVQ 238


>gi|51598442|ref|YP_072630.1| flagellar hook-associated protein FlgK [Borrelia garinii PBi]
 gi|51573013|gb|AAU07038.1| flagellar hook-associated protein [Borrelia garinii PBi]
          Length = 627

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 99/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+ ++L+    G    K +++  +   +   +    +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-QDLANQPQGLAERKIILERGKSFCELIRSRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  +I +
Sbjct: 165 IYIMANDEIKITTDEANNYIKNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNLISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  S+G  L + ++  +   E  N  T T  +       +  ++N  + 
Sbjct: 225 SIENKQDPNEFLIHSEGRHLVQGSIANEFKLEATNGPTRTKWN-------IFWANNDKAN 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LETGKLGSLLNIRDEEIKNEINELNNLAANII 309


>gi|224532827|ref|ZP_03673442.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi
           WI91-23]
 gi|224512216|gb|EEF82602.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi
           WI91-23]
          Length = 627

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|311280011|ref|YP_003942242.1| flagellar hook-associated protein FlgK [Enterobacter cloacae SCF1]
 gi|308749206|gb|ADO48958.1| flagellar hook-associated protein FlgK [Enterobacter cloacae SCF1]
          Length = 547

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 62/330 (18%), Positives = 138/330 (41%), Gaps = 26/330 (7%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTM-----TTISP-----ENVTVV- 53
           ++ N A +    A     ++  NI + +   Y R+ T+     +T+ P       VTV  
Sbjct: 3   SLINSAMSGLGAAQAALNTVSNNIASYNVSGYTRQTTVLAQSNSTLGPGGWVGNGVTVTG 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            QR  N  + +++  A + + G     Q    + +++S      NS +  +     SL++
Sbjct: 63  VQREYNAFITNQLRAAQNQSSGLTTRYQQMSKIDDVLS---DTTNSLSATLQDFFSSLQT 119

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              N  +    ++V+  A+ +V  F  + + ++      +  +   +  +  +  ++  +
Sbjct: 120 LVSNAEDPAARQSVLGKADGLVNQFKVTDQYLRDQDKQVNSAVASSVDQINNYAKQIASL 179

Query: 174 NDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++G +L +  
Sbjct: 180 NDKISKLTGVGAGASPNDLLDQRDQLVSQLNQIVGVEVNVQDGGTYNITMANGYSLVQGS 239

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK-----GKIKALLQIRDSVVPIF 286
                   + S    S +   ++D V  +      +P+     G +  LL  R   +   
Sbjct: 240 TAH-QLAAVPSSADPSRTTVAYVDNVAGNVE----IPEKLLTTGSLGGLLTFRSQDLDQT 294

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPG 316
           +N L++MA     +F+++     ++   PG
Sbjct: 295 RNSLNQMALAFADAFNQQHAKGVDANGDPG 324


>gi|195941912|ref|ZP_03087294.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 80a]
 gi|225549791|ref|ZP_03770755.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 118a]
 gi|225369599|gb|EEG99048.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi 118a]
 gi|312149645|gb|ADQ29716.1| flagellar hook-associated protein FlgK [Borrelia burgdorferi N40]
          Length = 627

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 93  DDHYNNSPTHYISK-LRDSLESYSKNLSEDILG----KTVIDNAEEVVQNFNTSAREVQK 147
           +D YN      I K L D  ES+  +L+    G    K +++  +   +        +++
Sbjct: 106 EDVYNEPEDQSIRKRLNDFWESW-HDLANQPQGLAERKIILERGKSFCEGIRNRFHSLER 164

Query: 148 IRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI 207
           I   A+ EI++       ++  +  +N  I    A K + +D +D RD++++K+  II +
Sbjct: 165 IYIMANDEIKITTDEANNYIRNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNIISV 224

Query: 208 STIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
           S   + + +  +  ++G  L + ++  +   E  N  T T  +       ++ ++N  + 
Sbjct: 225 SIENKQDPNEFLIHAEGRHLVQGSIANEFKLEATNGPTRTRWN-------ILWANNDKAY 277

Query: 267 VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +  GK+ +LL IRD  +    N+L+ +A  +I
Sbjct: 278 LKTGKLGSLLNIRDEEIKNEINELNNIAANII 309


>gi|257484939|ref|ZP_05638980.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|49205098|dbj|BAC75962.2| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tabaci]
 gi|330986475|gb|EGH84578.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011049|gb|EGH91105.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 686

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|71733906|ref|YP_275555.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298487849|ref|ZP_07005889.1| Flagellar hook-associated protein flgK [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71554459|gb|AAZ33670.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157574|gb|EFH98654.1| Flagellar hook-associated protein flgK [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320325100|gb|EFW81169.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 686

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|313106041|ref|ZP_07792300.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa
           39016]
 gi|310878802|gb|EFQ37396.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa
           39016]
          Length = 682

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 20/197 (10%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L++ + N S     + V+  AE + + FNT   ++ K  +  ++++    S +      
Sbjct: 116 ALQAAANNPSSTEAREAVLAQAEGLGKTFNTLYDQLDKQNSLINQQLGALASQVNHLSQS 175

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-- 227
           +   NDAI    ++    +D +D RD  ++K+SE+IG++ + +++N + ++   G  L  
Sbjct: 176 VASYNDAIAKAKSAGAVPNDLMDARDEAVRKLSEMIGVTAVTQDDNSVSLFIGSGQPLVV 235

Query: 228 ------FETVPRDINFEKMNSYTVT-SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                    VP     +    Y V  S  N I         N    V  G++  LL  R+
Sbjct: 236 GNTVSTLSVVP---GLDDPTRYQVQLSNGNSI--------QNVTGLVSGGEMGGLLAYRN 284

Query: 281 SVVPIFQNQLDEMARVL 297
           S +    N+L ++A  L
Sbjct: 285 SALDSSYNKLGQLAITL 301


>gi|158321541|ref|YP_001514048.1| flagellar hook-associated protein FlgK [Alkaliphilus oremlandii
           OhILAs]
 gi|158141740|gb|ABW20052.1| flagellar hook-associated protein FlgK [Alkaliphilus oremlandii
           OhILAs]
          Length = 522

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 88/419 (21%), Positives = 166/419 (39%), Gaps = 60/419 (14%)

Query: 101 THYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI 160
           T  I ++ +S    SKN +       V   A     + N +  +++K+  D + E++  +
Sbjct: 113 TKVIDQMFESFHELSKNPNNITTRALVRQRATTFTNSVNHTYNQLEKMVVDYNFEVQSMV 172

Query: 161 SNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST----------- 209
            ++  +  ++  +ND I        +A+D  DQR+VL+ ++S+I+ I             
Sbjct: 173 KSINTYGEQIARLNDQILRFEVDGSNANDLRDQRNVLIDELSKIVDIDVMEVTNPSTLGH 232

Query: 210 ---IVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS----YTVTSESNPIFIDGVVVSSN 262
              +++     +VY +D T L         F+ M+     Y +       F      S N
Sbjct: 233 KQMVIKVGGKPLVYHNDFTGLEAKQNLKKPFDGMDKSIHIYDIEWADGTSFYK----SEN 288

Query: 263 QGSAVPK--GKIKALLQIRDS------VVPIFQNQLDEMARVLIGSFSE--KDPIAGNSE 312
             + V K  G++ A+L +RD        VP + N+L++  +V     +E        + E
Sbjct: 289 VDTDVDKIGGELGAILTMRDGKDGKNKGVPHYINELNKFVKVFANRINEIHLKGYGLDGE 348

Query: 313 NVPGLFIADGI--------KDLDNKLCQGISETICVNPQYRSNPSFLRD-------GGSV 357
                F A GI        KD D ++    +    +     SN     D         S 
Sbjct: 349 AGRAFFTAKGISTPTGAATKDADGRVTSVDATVAGLGNINASNIRISLDIEDPNNIAASK 408

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
            K  L N  ++    D++N   D            G+ T     ++ ++ IG L   + +
Sbjct: 409 EKNLLPNDGSI--MLDIVNLRHDQ-----------GMFTEGKPEDFIKSLIGTLGVEKEE 455

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +        V+ N I +   +  GV+  EEL+ ++K + +YN S +++   D+ML  L+
Sbjct: 456 AGRNADNQAVLLNEIDKKRMSISGVSEDEELANMVKFQHAYNASARMMTTIDEMLDVLI 514


>gi|107100531|ref|ZP_01364449.1| hypothetical protein PaerPA_01001556 [Pseudomonas aeruginosa PACS2]
 gi|13183733|gb|AAK15324.1|AF332547_1 flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa]
          Length = 682

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 20/197 (10%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L++ + N S     + V+  AE + + FNT   ++ K  +  ++++    S +      
Sbjct: 116 ALQAAANNPSSTEAREAVLAQAEGLGKTFNTLYDQLDKQNSLINQQLGALASQVNHLSQS 175

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-- 227
           +   NDAI    ++    +D +D RD  ++K+SE+IG++ + +++N + ++   G  L  
Sbjct: 176 VASYNDAIAKAKSAGAVPNDLMDARDEAVRKLSEMIGVTAVTQDDNSVSLFIGSGQPLVV 235

Query: 228 ------FETVPRDINFEKMNSYTVT-SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                    VP     +    Y V  S  N I         N    V  G++  LL  R+
Sbjct: 236 GNTVSTLSVVP---GLDDPTRYQVQLSNGNSI--------QNVTGLVSGGEMGGLLAYRN 284

Query: 281 SVVPIFQNQLDEMARVL 297
           S +    N+L ++A  L
Sbjct: 285 SALDSSYNKLGQLAITL 301


>gi|146335607|gb|ABQ23406.1| FlgK [Pseudomonas syringae pv. averrhoi]
          Length = 686

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|320329359|gb|EFW85352.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 686

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|42527853|ref|NP_972951.1| flagellar hook-associated protein FlgK [Treponema denticola ATCC
           35405]
 gi|41818681|gb|AAS12870.1| flagellar hook-associated protein FlgK [Treponema denticola ATCC
           35405]
          Length = 623

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 61/293 (20%), Positives = 120/293 (40%), Gaps = 23/293 (7%)

Query: 10  AQNICNNASQQFASIVRNIENAD---NKNYVRRDTMTTISPENVTVVTQRSENKNMFDKV 66
             NI N++++ +     N+E  +     +  R +T   I  + VT+ +       + D+ 
Sbjct: 25  GHNISNSSTKGYTRQRVNLEAFEPIYRPDLTRAETPGQIG-QGVTIASITRLRDELLDQR 83

Query: 67  LHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR-----DSLESYSKNLSED 121
           +   +  +G      S+ AL E +      +N P     + R     ++ +  S     D
Sbjct: 84  IIGATDDLGYWETRNSYIALLEQV------HNEPEDISVRTRMDQFWEAWQELSLYPESD 137

Query: 122 ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKT 181
              + V    E +    +   R +Q IR     +IE  +  +      +  +N+ I    
Sbjct: 138 AARQVVRTRTETLTDAIHHQFRGLQGIRDMVHGDIEATVKQVNDLTGRIAKLNEEIVKVK 197

Query: 182 ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET-VPRDINFEKM 240
           A   + +D +D+RD+L +K+S +I IS   R+ ++  V  + G  + +    R  NF+  
Sbjct: 198 AMGDNPNDLMDKRDLLTEKLSSLIDISVDKRDEDETYVIHTAGLEIVQGRTHRTFNFK-- 255

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                 S  N  + D +   S   +    GK+ AL+++RD+ +     +LD M
Sbjct: 256 -----ASTENDKYADVIWEDSGNLAHFESGKLAALIELRDTDIRDEIRKLDTM 303


>gi|71282480|ref|YP_268228.1| flagellar hook-associated protein [Colwellia psychrerythraea 34H]
 gi|71148220|gb|AAZ28693.1| flagellar hook-associated protein [Colwellia psychrerythraea 34H]
          Length = 665

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 125/298 (41%), Gaps = 29/298 (9%)

Query: 17  ASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV-----------TQRSENKNMFDK 65
           A QQ A+   NI N +   Y R+      + +N TV            T   +   ++D+
Sbjct: 16  AQQQLATTGHNISNVNTDGYNRQR-----AEQNATVGLNNGNNYIGGGTYIQDITRLYDQ 70

Query: 66  VLHAHSSAIGQQRLLQSFEALKEMMSADDHY----NNSPTHYISKLRDSLESYSKNLSED 121
              +H   I  Q  L + ++L   ++  D       N+    + +   +L   + N ++ 
Sbjct: 71  F--SHKEQITNQSKLGNADSLHARLTQLDQVMSTSGNAVVGSLDQFYQALNGVADNPNDS 128

Query: 122 ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKT 181
            L   V++ A  +  +FN     + ++    + EIE   S +     EL  +N+ I   +
Sbjct: 129 GLRSIVLNQANTLSNDFNQLTNNLDQMTKSINGEIEQVASKISEISQELAKINETI-MHS 187

Query: 182 ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV-PRDINFEKM 240
                 +D LD+RD L+ ++S    ++T+   NN M V    GTTL   + P  +   ++
Sbjct: 188 QQGGQPNDLLDKRDQLIGELSNYTQVNTVKDANNVMTVMIGQGTTLVAGITPMTL---QV 244

Query: 241 NSYTVTSESNPI-FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           N+    S+   +  + G    + +GS +  G + A  + RD  +   + ++D +A  +
Sbjct: 245 NAGDPDSQQTELRLVSGSSSVALKGSTL-GGSLAASFEFRDEHLSQTRTEIDRLAMAI 301


>gi|116049015|ref|YP_792183.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115584236|gb|ABJ10251.1| flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 683

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 119/297 (40%), Gaps = 33/297 (11%)

Query: 18  SQQFASIV-RNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQ 76
           SQ + +I   NI N     Y R+D +        +          + D    A     GQ
Sbjct: 15  SQTWLTITGHNITNVKTPGYSRQDAIQQTQVPQFSGAGYMGSGSQIVDVRRLASDFLTGQ 74

Query: 77  QR-----------LLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGK 125
            R            L   + L  ++ AD+    SP   + +   +L++ ++N S     +
Sbjct: 75  LRNATSQNSELSAFLGQIDQLNSLL-ADNTTGVSPA--MQRFFSALQTAAQNPSSTEARE 131

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            V+  A+ + + FNT   ++ K  +  ++++    S +      +   NDAI    ++  
Sbjct: 132 AVLAQAQGLSKTFNTLYDQLDKQNSLINQQLGALTSQVNNLSQSVAEYNDAIAKAKSAGA 191

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDINF 237
             +D LD RD  ++K+SE++G++ + +++N + ++   G  L           VP   + 
Sbjct: 192 VPNDLLDARDEAVRKLSEMVGVTAVTQDDNSVSLFIGSGQPLVVGNTVSTLSVVPGLDDP 251

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            +        +S          + N    V  G++  LL  RD+V+    N+L ++A
Sbjct: 252 TRYQVQLTLGDS----------TQNVTRLVSGGQMGGLLAYRDTVLDSSYNKLGQLA 298


>gi|254239444|ref|ZP_04932766.1| flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           2192]
 gi|126192822|gb|EAZ56885.1| flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           2192]
          Length = 682

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 20/197 (10%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L++ + N S     + V+  AE + + FNT   ++ K  +  ++++    S +      
Sbjct: 116 ALQAAANNPSSTEAREAVLAQAEGLGKTFNTLYDQLDKQNSLINQQLGALASQVNHLSQS 175

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-- 227
           +   NDAI    ++    +D +D RD  ++K+SE+IG++ + +++N + ++   G  L  
Sbjct: 176 VASYNDAIAKAKSAGAVPNDLMDARDEAVRKLSEMIGVTAVTQDDNSVSLFIGSGQPLVV 235

Query: 228 ------FETVPRDINFEKMNSYTVT-SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                    VP     +    Y V  S  N I         N    V  G++  LL  R+
Sbjct: 236 GNTVSTLSVVP---GLDDPTRYQVQLSNGNSI--------QNVTGLVSGGEMGGLLAYRN 284

Query: 281 SVVPIFQNQLDEMARVL 297
           S +    N+L ++A  L
Sbjct: 285 SALDSSYNKLGQLAITL 301


>gi|288940415|ref|YP_003442655.1| flagellar hook-associated protein FlgK [Allochromatium vinosum DSM
           180]
 gi|288895787|gb|ADC61623.1| flagellar hook-associated protein FlgK [Allochromatium vinosum DSM
           180]
          Length = 723

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 103/226 (45%), Gaps = 33/226 (14%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           +++ AE +   F      + + R  A+ +IE  I  + ++   +  +N  I  ++ +   
Sbjct: 132 LLNEAETLTGRFEAINGRLDEQRRLANGQIETSIEEINQYAESVADLNKQIIARSTAGSP 191

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-FETVPRDINFEKMNSYTV 245
            +D LD+RD +L+K+SE + +S   +++  + V+   G  L   T   ++ F  ++    
Sbjct: 192 PNDLLDRRDTILRKLSEKVDVSLSTQDDGAVNVFIGSGQGLVVGTNASELTFSNLS---- 247

Query: 246 TSESNPIFIDGVVVSSNQGSA-------VPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
               +P+  D + + + QG+        V  G+I  LL+ R +++   QN+L   A  L 
Sbjct: 248 ---GDPVNWD-IGLRAAQGNEPINITRFVTGGEIGGLLETRSNLLDKAQNELGLTALNLA 303

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE--TICVNP 342
             F+E++ +        GL       DLD +L   I E   + VNP
Sbjct: 304 DRFNEQNRL--------GL-------DLDGELGGDIFELPEVVVNP 334


>gi|226327737|ref|ZP_03803255.1| hypothetical protein PROPEN_01610 [Proteus penneri ATCC 35198]
 gi|225203441|gb|EEG85795.1| hypothetical protein PROPEN_01610 [Proteus penneri ATCC 35198]
          Length = 463

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 104/220 (47%), Gaps = 25/220 (11%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE 157
           N  +  I +   SL + + N  ++    TVI  AE +V  F   A+  Q +R D +K+I 
Sbjct: 105 NDVSSAIDEFFTSLPNVTNNAEDNPARTTVIGKAEAMVNMF---AKADQSLR-DLEKDIN 160

Query: 158 LEISNLRRFLSELT-----VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVR 212
            +++N  + ++E T     + N+  + K  +  D +D LDQRD L+Q+++ ++ +    +
Sbjct: 161 SQVTNTSKNINEYTKQIAKLNNEISRSKGFNGADPNDLLDQRDRLIQELNTLVDVQVTQQ 220

Query: 213 NNNDMVVYTSDGTTL--------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQG 264
           +   + V  ++G  L           +P + N E++    V   SN I      V     
Sbjct: 221 DGGFVNVTFANGLPLVSGTRSYEVSAIPSNKNSERL----VLGYSNGID----EVREVDA 272

Query: 265 SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             +  G++    + R+ V+   +NQL+++A VL   F+++
Sbjct: 273 KRIKGGELGGAYRSREEVLDPSRNQLNQLALVLGDQFNKQ 312


>gi|289627770|ref|ZP_06460724.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330866430|gb|EGH01139.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 686

 Score = 47.0 bits (110), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|157959896|ref|YP_001499930.1| flagellar hook-associated protein FlgK [Shewanella pealeana ATCC
           700345]
 gi|157844896|gb|ABV85395.1| flagellar hook-associated protein FlgK [Shewanella pealeana ATCC
           700345]
          Length = 457

 Score = 47.0 bits (110), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 95/391 (24%), Positives = 161/391 (41%), Gaps = 42/391 (10%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE 157
           NS +  +  L  SL S  +  +E  L + V++ A+ + Q FN+ +  V       + +I 
Sbjct: 100 NSISAGLDLLFASLNSAMEQPNEIALRQGVLNEAKALTQRFNSISEGVHTQVNQIEGQIG 159

Query: 158 LEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDM 217
                +   L  ++  N+ I+   AS +     LD RD  +  +S+II ++ IV + N+M
Sbjct: 160 ASAKEINAQLETISSFNEQIQASNASGNVPLSLLDARDAAIDDLSKIIDVN-IVHDANNM 218

Query: 218 VVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP-----KGKI 272
           V       +L +  P                SNP+F   + V   Q S+ P      G +
Sbjct: 219 V-----NISLVQGQPLLSGTTASKIQVSPDPSNPLFSQ-LSVQFGQ-SSFPLDESAGGSL 271

Query: 273 KALLQIRD-SVVP--IFQNQLDE-MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDN 328
            ALL  RD S+V    F N+L + MA            + GN+            +DL  
Sbjct: 272 GALLDYRDNSLVESIAFNNELAQTMADEFNTILKAGTDLNGNTPT----------QDLFT 321

Query: 329 KLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIF 388
                 + T+ ++  ++  P  L  G   +     N+K L    D          K+F F
Sbjct: 322 YDPTNPAGTLKISADFK--PDMLAFGQDGTPGDNSNLKALVELAD----------KSFTF 369

Query: 389 DPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEEL 448
           D + GI+   T+ +   + IG L      +      ++ V       +++T GVN+ EE 
Sbjct: 370 DSM-GID--ATMGDAFASKIGELGSASRQAKMAKETAEKVQIEAQSQWASTSGVNMDEEG 426

Query: 449 SFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             LI  +QSY  + K+I   D++ QT+L  +
Sbjct: 427 VNLIIYQQSYQANAKVISTADQLFQTILNSI 457


>gi|153951647|ref|YP_001398768.1| flagellar hook-associated protein FlgK [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939093|gb|ABS43834.1| putative flagellar hook-associated protein FlgK [Campylobacter
           jejuni subsp. doylei 269.97]
          Length = 608

 Score = 47.0 bits (110), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 1/84 (1%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N+T+ EY R   G +  +  +++ ++  ++ ++N +   Y +  GVN  EEL  LI+ + 
Sbjct: 525 NLTMEEYYRKLTGKIASDGENNNVVNSSNETLYNSVYSEYQSKSGVNTNEELVALIQYQS 584

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           SY  + K++   D+ML TLL G+K
Sbjct: 585 SYGAAAKIVSTVDQMLDTLL-GLK 607


>gi|82702459|ref|YP_412025.1| flagellar hook-associated protein FlgK [Nitrosospira multiformis
           ATCC 25196]
 gi|82410524|gb|ABB74633.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 638

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 136/303 (44%), Gaps = 40/303 (13%)

Query: 27  NIENADNKNYVRRDTMTTISPENVTV-----------VTQRSENKNMFDKVLHAHSSAIG 75
           NI N     Y R+  + + S    T              +R+ N+ +  +V  A + +  
Sbjct: 26  NISNTATPGYTRQQVIQSTSDARATGSGFIGQGVQVDTVKRAYNQFLSRQVAQAGTES-- 83

Query: 76  QQRLLQSFEALKEMMS--ADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
             +L   F  +K++ S  AD    +  +  +     SL+  + N +E    ++++ NAE 
Sbjct: 84  -SQLETYFSQMKQIDSLLADSMGGSGLSPALQDFFGSLQEMATNPAEVASRQSMLSNAEM 142

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK--TASKHDAHDFL 191
           +V+ F++   ++ +I+   +++IE   + +    +++  +N+ I     +A+   A+D  
Sbjct: 143 LVRQFHSMNSQLNEIQEGVNRQIENSTALINTLGAQIAKLNETIHMAESSANGQPANDLR 202

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ ++++ +  +T+V+++    V+   G  L            M S      + P
Sbjct: 203 DQRDELVAQLNDEV-RATVVQSDEGYSVFLGGGQPLV-----------MGSQASQLTARP 250

Query: 252 IFIDG---VVVSSNQGSAVP-------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +D     ++    GS++P        GK+  LLQ R+ ++   +N L  +A  L G+F
Sbjct: 251 SAMDADRLEIIHVMGGSSIPLKEANLDGGKLGGLLQFRNEIIDTVRNGLGRVAIGLAGTF 310

Query: 302 SEK 304
           +E+
Sbjct: 311 NEQ 313


>gi|28869148|ref|NP_791767.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967575|ref|ZP_03395723.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato T1]
 gi|301385720|ref|ZP_07234138.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060067|ref|ZP_07251608.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato K40]
 gi|302134826|ref|ZP_07260816.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852388|gb|AAO55462.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927876|gb|EEB61423.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           tomato T1]
 gi|331017018|gb|EGH97074.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 686

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 65/318 (20%), Positives = 130/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNGYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++     + +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSSFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  +  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNEAVRQLNGLVGVKVV-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVITGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|296390550|ref|ZP_06880025.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa
           PAb1]
          Length = 683

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 119/297 (40%), Gaps = 33/297 (11%)

Query: 18  SQQFASIV-RNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQ 76
           SQ + +I   NI N     Y R+D +        +          + D    A     GQ
Sbjct: 15  SQTWLTITGHNITNVKTPGYSRQDAIQQTRIPQFSGAGYMGSGSQIVDVRRLASDFLTGQ 74

Query: 77  QR-----------LLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGK 125
            R            L   + L  ++ AD+    SP   + +   +L++ ++N S     +
Sbjct: 75  LRNATSQNSELNAFLGQIDQLNSLL-ADNTTGVSPA--MQRFFSALQTAAQNPSSTEARE 131

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            V+  A+ + + FNT   ++ K  +  ++++    S +      +   NDAI    ++  
Sbjct: 132 AVLAQAQGLSKTFNTLYDQLDKQNSLINQQLGALTSQVNNLSQSVAEYNDAIAKAKSAGA 191

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDINF 237
             +D LD RD  ++K+SE++G++ + +++N + ++   G  L           VP   + 
Sbjct: 192 VPNDLLDARDEAVRKLSEMVGVTAVTQDDNSVSLFIGSGQPLVVGNTVSTLSVVPGLDDP 251

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            +        +S          + N    V  G++  LL  RD+V+    N+L ++A
Sbjct: 252 TRYQVQLTLGDS----------TQNVTRLVSGGQMGGLLAYRDTVLDSSYNKLGQLA 298


>gi|302391042|ref|YP_003826862.1| flagellar hook-associated protein FlgK [Acetohalobium arabaticum
           DSM 5501]
 gi|302203119|gb|ADL11797.1| flagellar hook-associated protein FlgK [Acetohalobium arabaticum
           DSM 5501]
          Length = 801

 Score = 46.6 bits (109), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 103/208 (49%), Gaps = 16/208 (7%)

Query: 107 LRDSLESYSKNLSE-------DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELE 159
           LR+S++ +  +L E       + +  TV   A  +   FN    +++  R   + +++ +
Sbjct: 114 LRNSMDEFWNSLQELNNNPESEAVRATVRQRALSLTDTFNHLDDQLRDYRTSLNNQLKTK 173

Query: 160 ISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVV 219
           ++++  +   +  +N  I    +   + +D  D+RD+L++K+S+I  + T   +N  + V
Sbjct: 174 VNDINSYGQRIADLNAQISRIESMDQNPNDLRDKRDLLVEKLSKITSVQTNEMDNGAVTV 233

Query: 220 YTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVV---SSNQGSAVPKGKIKALL 276
              +G +L   V +D    K+ +   T+ S+  F   V V    +N+      G+++ LL
Sbjct: 234 NI-EGQSL---VWQD-EVSKLKTVE-TASSDSKFDKTVEVRWDKTNEEVNFTNGEMQGLL 287

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           + RD  VP +  QLD MA+ L  +F+++
Sbjct: 288 EARDEEVPKYVEQLDNMAQELAATFNDQ 315



 Score = 40.0 bits (92), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 34/55 (61%)

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           +V+  ++ +   +  GV+L EE+S +IK +QSY  + K     D++L TL+ G+K
Sbjct: 746 EVLTKNLKQQRDSISGVSLDEEMSKMIKYQQSYTAAAKFTSTMDEILNTLVNGIK 800


>gi|110641258|ref|YP_668988.1| flagellar hook-associated protein FlgK [Escherichia coli 536]
 gi|191172473|ref|ZP_03034014.1| flagellar hook-associated protein FlgK [Escherichia coli F11]
 gi|300982573|ref|ZP_07176195.1| flagellar hook-associated protein FlgK [Escherichia coli MS 200-1]
 gi|110342850|gb|ABG69087.1| flagellar hook-associated protein 1 [Escherichia coli 536]
 gi|190907357|gb|EDV66955.1| flagellar hook-associated protein FlgK [Escherichia coli F11]
 gi|300307154|gb|EFJ61674.1| flagellar hook-associated protein FlgK [Escherichia coli MS 200-1]
 gi|324013281|gb|EGB82500.1| flagellar hook-associated protein FlgK [Escherichia coli MS 60-1]
          Length = 547

 Score = 46.6 bits (109), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSTADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A    G+F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAGAFNTQ 312


>gi|302871568|ref|YP_003840204.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574427|gb|ADL42218.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 525

 Score = 46.6 bits (109), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 81/421 (19%), Positives = 165/421 (39%), Gaps = 68/421 (16%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +
Sbjct: 117 IDQFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEI 176

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   VV  + 
Sbjct: 177 NSIASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFVVQIAG 236

Query: 224 GTTL--------FET----VPRDINFEKMNSYTVTSESNPIF------IDGVVV----SS 261
           G TL         ET    + R   F+     T     +P+       + G+ V     +
Sbjct: 237 GETLVNHFTVYELETDKSKIMRKSGFDSSGQPTGFKPDDPLSQQNLYDVPGLFVVMWKDT 296

Query: 262 NQGSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVL 297
            Q   +  G++K LL +RD V                        +P + N+L+E A+ L
Sbjct: 297 GQVLNIKSGELKGLLDMRDGVGGLDEDVSVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKL 356

Query: 298 IGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG 355
           I  F+E      + N +N        GI    N     + +T       + + + + D  
Sbjct: 357 IEKFNELHTQGWSLNGQNT-------GI----NFFEPPVGQTFFYARYIKVSDAIMNDLN 405

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +++    ++  NL G  DL+       N   IF             ++ ++ I  L  + 
Sbjct: 406 NIATT--YDASNLPGGNDLVVDMLKLRNDTSIF-------KEGKFEDFLKSLISNLGVDS 456

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             + +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  +
Sbjct: 457 QGAKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVI 516

Query: 476 L 476
           +
Sbjct: 517 V 517


>gi|310767296|gb|ADP12246.1| flagellar hook-associated protein FlgK [Erwinia sp. Ejp617]
          Length = 551

 Score = 46.6 bits (109), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 105/225 (46%), Gaps = 19/225 (8%)

Query: 86  LKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREV 145
           + +MMS      N+ +  I  L  SL++ + N S+    + V+  AE +V  F  +   +
Sbjct: 95  IDDMMSGT---TNTLSTTIQDLFKSLQTLASNASDSSSRQAVLGKAEGLVNQFKATDTYL 151

Query: 146 QKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTA-SKHDAHDFLDQRDVLLQKISE 203
             + +  +  ++  +  +  +  ++  VN  I K K A +  + +D LD+RD+L+ ++++
Sbjct: 152 TNVESGLNTSVKSTVEQVNNYAKQIANVNQQIAKLKGAGAGSEPNDLLDKRDLLVSQLNK 211

Query: 204 IIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           ++G++   ++     +   +G +L   V  D  FE++ +  V S ++P       V S  
Sbjct: 212 LVGVNVSQQDGGSYSISIGNGISL---VQGD-RFEQLAA--VPSSADPARTTIASVDSVT 265

Query: 264 G-------SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
           G       S    G +  LL  R  +  + +NQ+ ++A  L  SF
Sbjct: 266 GAKTEIAESQFTSGSLGGLLAFRHDLDGV-RNQIGQLALALGSSF 309


>gi|331657144|ref|ZP_08358106.1| flagellar hook-associated protein FlgK [Escherichia coli TA206]
 gi|324007922|gb|EGB77141.1| flagellar hook-associated protein FlgK [Escherichia coli MS 57-2]
 gi|331055392|gb|EGI27401.1| flagellar hook-associated protein FlgK [Escherichia coli TA206]
          Length = 547

 Score = 46.6 bits (109), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A    G+F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAGAFNTQ 312


>gi|254234222|ref|ZP_04927545.1| flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           C3719]
 gi|126166153|gb|EAZ51664.1| flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           C3719]
          Length = 683

 Score = 46.6 bits (109), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 94/211 (44%), Gaps = 20/211 (9%)

Query: 92  ADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRAD 151
           AD+    SP   + +   +L++ ++N S     + V+  A+ + + FNT   ++ K  + 
Sbjct: 100 ADNTTGVSPA--MQRFFSALQTAAQNPSSTEAREAVLAQAQGLSKTFNTLYDQLDKQNSL 157

Query: 152 ADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV 211
            ++++    S +      +   NDAI    ++    +D LD RD  ++K+SE++G++ + 
Sbjct: 158 INQQLGALTSQVNNLSQSVAEYNDAIAKAKSAGAVPNDLLDARDEAVRKLSEMVGVTAVT 217

Query: 212 RNNNDMVVYTSDGTTL--------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           +++N + ++   G  L           VP   +  +        +S          + N 
Sbjct: 218 QDDNSVSLFIGSGQPLVVGNTVSTLSVVPGLDDPTRYQVQLTLGDS----------TQNV 267

Query: 264 GSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
              V  G++  LL  RD+V+    N+L ++A
Sbjct: 268 TRLVSGGQMGGLLAYRDTVLDSSYNKLGQLA 298


>gi|328543140|ref|YP_004303249.1| flagellar hook-associated protein FlgK [polymorphum gilvum
           SL003B-26A1]
 gi|326412886|gb|ADZ69949.1| Flagellar hook-associated protein FlgK [Polymorphum gilvum
           SL003B-26A1]
          Length = 617

 Score = 46.6 bits (109), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 108/232 (46%), Gaps = 25/232 (10%)

Query: 84  EALKEMMSADDHYNNSP------THYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQN 137
           E L E+    D+ ++ P      T  +S L ++ +SY+         + V+  A+ + + 
Sbjct: 91  ERLDEIFGTIDNSSSLPSLMSDLTAGLSTLVNTPDSYAAR-------QEVLSVADTLARQ 143

Query: 138 FNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVL 197
            N+S   +Q +R + D  I +++  + + L ++ ++++ I+   A   +  + +DQRD  
Sbjct: 144 LNSSYELLQSMRQETDSLIRMQVGEVNQLLGQIELIDEKIEAAKAVGANTANLVDQRDRY 203

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLF-ETVPRDINFEKMNSYTVTSESNPIFIDG 256
           L+++S    IS     +  + + T +G  L+ +     ++F+   +             G
Sbjct: 204 LEQLSGYADISITQDGSGGLQINTRNGQMLYGDGHASSLSFDPTGTLGAGQPGG-----G 258

Query: 257 VVVSSNQGS------AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFS 302
           + V++  G+      +   G + ALL++RD  +   Q QLDE+A  L  +FS
Sbjct: 259 ITVTTYGGTRYDLGASSSSGSLMALLELRDDALVQAQAQLDEIAAQLSLAFS 310


>gi|222032835|emb|CAP75574.1| flagellar hook-associated protein 1 [Escherichia coli LF82]
 gi|312945644|gb|ADR26471.1| flagellar hook-associated protein FlgK [Escherichia coli O83:H1
           str. NRG 857C]
          Length = 547

 Score = 46.6 bits (109), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSTADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A    G+F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAGAFNTQ 312


>gi|325923280|ref|ZP_08184953.1| flagellar hook-associated protein FlgK [Xanthomonas gardneri ATCC
           19865]
 gi|325546207|gb|EGD17388.1| flagellar hook-associated protein FlgK [Xanthomonas gardneri ATCC
           19865]
          Length = 624

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 96/236 (40%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLTNRV--DSLYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I    +  + + D L
Sbjct: 137 NSLATRFKQLNGQMDSLSNEVNNGLTSSVDEVNRLTQQIAKINGTIG--NSVDNASPDLL 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ K+    G + ++++   M V+T+ G  L       +        TV     P
Sbjct: 195 DQRDALVSKLVGFTGGTAVIQDGGFMNVFTAGGQALV------VGTTAAKLTTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G++  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VALQTQGQNVSLSANSLGGQMGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|90021849|ref|YP_527676.1| hypothetical protein Sde_2204 [Saccharophagus degradans 2-40]
 gi|89951449|gb|ABD81464.1| Flagellar hook-associated protein [Saccharophagus degradans 2-40]
          Length = 920

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 8/178 (4%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           VI  +E +   FNT       I    ++ +++ ++        +  +N  +     S   
Sbjct: 134 VISESENLASRFNTIHSRFAAIEESVEEGLQVAVAEANALAKNIADINRKVAEAFGSGDK 193

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-FETVPRDINFEKMNSYTV 245
            +D LDQRD  + K+S+II I T  + N ++ V   +G  L      R +    ++S   
Sbjct: 194 PNDLLDQRDETILKLSKIISIQTFTQGNGEVNVLIGNGQNLVVGDTARTLGL--VDSEED 251

Query: 246 TSESNPIFIDG--VVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
            S+ +  F  G  V V +N    V  G+I  LL+ RD+ +    N+   +A  L  +F
Sbjct: 252 ASKKDLTFTTGGSVQVLTN---IVSGGEIGGLLRFRDTAMTDTYNEFGRIAVTLADTF 306


>gi|317492422|ref|ZP_07950851.1| flagellar hook-associated protein FlgK [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919761|gb|EFV41091.1| flagellar hook-associated protein FlgK [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 561

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 99/222 (44%), Gaps = 29/222 (13%)

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           NNS +  +     +L++   N S+    +TV+  A  +V  F T+   ++ + ++A+  +
Sbjct: 103 NNSLSANMQDFFSNLQNLVSNPSDPAARQTVLAKANGLVNQFKTTDEYLKNLESNANVTV 162

Query: 157 ELEISNLRRFLSELTVVNDAI-KFKTASKHDA-HDFLDQRDVLLQKISEIIGISTIVRNN 214
              +  +  +  ++  +ND I +   AS   A +D LD RD +  ++++I  +  I   +
Sbjct: 163 SNSVEQINNYTKQIASLNDQISRLTGASGGSAPNDLLDLRDQMATQLNQIANVE-ITMQD 221

Query: 215 NDMVVYTSDGTTL--------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
             M V  + G +L         E +P   N +++   T+          G    S   S 
Sbjct: 222 GAMNVSFAGGLSLVQGNDAYKLEAIPSSANPQRL---TI----------GYNRGSGTASE 268

Query: 267 VPKGKI-----KALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           VP+G+I       +LQ R   +   +NQL ++A  +  SF++
Sbjct: 269 VPEGRITGGSLSGILQFRSGALDNARNQLGQIALSMADSFNK 310


>gi|170288661|ref|YP_001738899.1| flagellar hook-associated protein FlgK [Thermotoga sp. RQ2]
 gi|170176164|gb|ACB09216.1| flagellar hook-associated protein FlgK [Thermotoga sp. RQ2]
          Length = 858

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 123/323 (38%), Gaps = 53/323 (16%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSEN 59
           MS+  + N A    +        +  NI NA    Y R R  +    P  +T +TQ S  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNVVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPS-- 61

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPT-----HYISKL-----RD 109
              F   +   +      RL  +F  + +    ++ YN   T     H+I +L      D
Sbjct: 62  ---FPLQMGTGAKVKTIVRLRDAFLDV-QYRQVNNRYNYWDTVLSNLHFIEQLLAEPGED 117

Query: 110 SLESYSKNL-----------SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIEL 158
            + S   N            S       V+  A+++V         ++++R D D EI  
Sbjct: 118 GIRSLVDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDDEIVQ 177

Query: 159 EISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIS--------TI 210
            +S + + +  L  +N+ I+         +D LD+RD +L ++S +  I+          
Sbjct: 178 RVSEINQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQIT 237

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
           +R  N +V+   +G+T  E    +  + K         S  I  DG              
Sbjct: 238 LRIGNQIVL---NGSTYRELRALERPYGKGYHELFVGNSQLILSDG-------------- 280

Query: 271 KIKALLQIRDSVVPIFQNQLDEM 293
           K+KAL+ +RDS +  +  +LDE 
Sbjct: 281 KLKALMDLRDSSIVKYMRKLDEF 303


>gi|170742313|ref|YP_001770968.1| flagellar hook-associated protein FlgK [Methylobacterium sp. 4-46]
 gi|168196587|gb|ACA18534.1| flagellar hook-associated protein FlgK [Methylobacterium sp. 4-46]
          Length = 623

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 126/307 (41%), Gaps = 35/307 (11%)

Query: 24  IVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQS 82
           + +N+ N     YVRR T+T +S P N  V T          + L A  SA+ Q RL  +
Sbjct: 23  VSQNVANQGTPGYVRR-TLTPVSQPGNSGVAT------GTVTRALDA--SALRQLRLETA 73

Query: 83  FEALKEMMSA-----DDHYNNSPT-HYISKLRDSLESYSKNLSEDILGKT----VIDNAE 132
             A  +++S+     D  Y    +   +  + ++  +  + L+ D          +  A 
Sbjct: 74  GAAYTDLVSSVHAQIDALYGPPGSDSALDGITNAFAASLRTLASDPASAANRSAAVTAAG 133

Query: 133 EVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD--AHDF 190
            +      +A  VQ++R+  + ++  ++++    LS +  +N  I        D  A D 
Sbjct: 134 RLAGKVADAANGVQQLRSGLETQLGADVASASTLLSRIADLNLRIAAAGGGAGDSRAADL 193

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTS-- 247
            DQRD  +  +++ + + T    +  + V T  G TL +      + F+   +   +S  
Sbjct: 194 ADQRDQAITDLAKYMDVQTSPAADGTVSVQTGSGVTLVDHGAAASLRFDGRGALGPSSRY 253

Query: 248 --ESNPIFIDGVVVSSNQGS--------AVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             ++    +  +   +  G+         +  G I A + +RD  +   Q QLD++A  L
Sbjct: 254 GTDATARGVGTITAVTPSGARIDLLADQGIRSGAIAAAVSLRDDTLVQAQRQLDDLAAGL 313

Query: 298 IGSFSEK 304
             + S++
Sbjct: 314 SRAMSDR 320


>gi|254785378|ref|YP_003072807.1| flagellar hook-associated protein FlgK [Teredinibacter turnerae
           T7901]
 gi|237685158|gb|ACR12422.1| flagellar hook-associated protein FlgK [Teredinibacter turnerae
           T7901]
          Length = 1060

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 85/190 (44%), Gaps = 20/190 (10%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + ++  +E +   FNT     Q I  + D+ ++  ++ +   ++ +   N  I   TA  
Sbjct: 132 QLILSESENLADRFNTLYDRFQTIENNVDEALKAAVAQVNALVANIAEFNLNIADATAIG 191

Query: 185 HDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV--------PRD 234
           + A  +D LD+RD  L++++E++ I T     N + V    G  L            P D
Sbjct: 192 NGAPPNDLLDKRDEALRQLAELVPIQTYEEGLNQINVVFGSGQNLVVGAKARELTLQPGD 251

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            N+ ++++   + + + +  D V     QG     G+I  LL+ RD  +    N+   +A
Sbjct: 252 DNYARLDAVFKSEQGSEVVTDLV-----QG-----GEIGGLLRFRDETLQNVFNEFGRIA 301

Query: 295 RVLIGSFSEK 304
            V+  SF++ 
Sbjct: 302 LVMADSFNQA 311


>gi|281412143|ref|YP_003346222.1| flagellar hook-associated protein FlgK [Thermotoga naphthophila
           RKU-10]
 gi|281373246|gb|ADA66808.1| flagellar hook-associated protein FlgK [Thermotoga naphthophila
           RKU-10]
          Length = 858

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 123/323 (38%), Gaps = 53/323 (16%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSEN 59
           MS+  + N A    +        +  NI NA    Y R R  +    P  +T +TQ S  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNVVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPS-- 61

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPT-----HYISKL-----RD 109
              F   +   +      RL  +F  + +    ++ YN   T     H+I +L      D
Sbjct: 62  ---FPLQMGTGAKVKTIVRLRDAFLDV-QYRQVNNRYNYWDTVLSNLHFIEQLLAEPGED 117

Query: 110 SLESYSKNL-----------SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIEL 158
            + S   N            S       V+  A+++V         ++++R D D EI  
Sbjct: 118 GIRSLVDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDDEIVQ 177

Query: 159 EISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIS--------TI 210
            +S + + +  L  +N+ I+         +D LD+RD +L ++S +  I+          
Sbjct: 178 RVSEINQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQIT 237

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
           +R  N +V+   +G+T  E    +  + K         S  I  DG              
Sbjct: 238 LRIGNQIVL---NGSTYRELRALERPYGKGYHELFVGNSQLILSDG-------------- 280

Query: 271 KIKALLQIRDSVVPIFQNQLDEM 293
           K+KAL+ +RDS +  +  +LDE 
Sbjct: 281 KLKALMDLRDSSIVKYMRKLDEF 303


>gi|255021361|ref|ZP_05293409.1| Flagellar hook-associated protein flgK [Acidithiobacillus caldus
           ATCC 51756]
 gi|254969224|gb|EET26738.1| Flagellar hook-associated protein flgK [Acidithiobacillus caldus
           ATCC 51756]
          Length = 684

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 87/199 (43%), Gaps = 20/199 (10%)

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS---KLRDSL 111
           QR+ +  +  +V  A + A GQ  L  S + L   +S      +S   + S   ++  S 
Sbjct: 67  QRAYSSFLQSQVWSATAQASGQSTLSTSLQGLLGTLSGG-AIASSINQFFSGAAQVAASP 125

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           ES           + ++ NA+ + Q FN+ A+++  I    +++I   +  +    + + 
Sbjct: 126 ESVPAR-------QALLSNAQSLSQTFNSLAQQLDFINTGVNQQISQSVQEINTLSNGIA 178

Query: 172 VVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--- 227
            +N  I   +     + +  LDQRD L+ +++  +G+  + ++   + VY S+G  L   
Sbjct: 179 QLNSQIASLQGQGNGNPNSLLDQRDQLITELNAQVGVQVLPQSGGQVNVYLSNGQVLVAD 238

Query: 228 -----FETVPRDINFEKMN 241
                 +T P   + + +N
Sbjct: 239 SKAFSLQTQPNPYDGQSLN 257


>gi|254508414|ref|ZP_05120534.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus 16]
 gi|219548624|gb|EED25629.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus 16]
          Length = 624

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 80/171 (46%), Gaps = 6/171 (3%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           K V++ +  + QN N     V++     +K+++L I  + +   E+  ++  +  +T   
Sbjct: 133 KVVLEKSTLITQNLNDFHETVRRQSDVTNKKLDLGIERINQLALEIRDIH-RLMMRTPGP 191

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMV-VYTSDGTTLFETVPRDINFEKMNSY 243
           H+  DF+DQ + L+ ++SE   ++   R N +   V+  +G TL            ++ Y
Sbjct: 192 HN--DFMDQHEKLINELSEYTKVTVTPRKNAEGFNVHIGNGHTLVSGTEAS-KLTMIDGY 248

Query: 244 TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
               E     I+G  + +     +  GK+ A+L +RD  +P   ++L +MA
Sbjct: 249 PDVHERRLAMIEGKGIKAITSKDI-DGKLGAMLTMRDEKIPQLMDELGKMA 298


>gi|15596283|ref|NP_249777.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa
           PAO1]
 gi|218892950|ref|YP_002441819.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa
           LESB58]
 gi|9947002|gb|AAG04475.1|AE004539_17 flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           PAO1]
 gi|218773178|emb|CAW28990.1| flagellar hook-associated protein 1 FlgK [Pseudomonas aeruginosa
           LESB58]
          Length = 683

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 94/211 (44%), Gaps = 20/211 (9%)

Query: 92  ADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRAD 151
           AD+    SP   + +   +L++ ++N S     + V+  A+ + + FNT   ++ K  + 
Sbjct: 100 ADNTTGVSPA--MQRFFSALQTAAQNPSSTEAREAVLAQAQGLSKTFNTLYDQLDKQNSL 157

Query: 152 ADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV 211
            ++++    S +      +   NDAI    ++    +D LD RD  ++K+SE++G++ + 
Sbjct: 158 INQQLGALTSQVNNLSQSVAEYNDAIAKAKSAGAVPNDLLDARDEAVRKLSEMVGVTAVT 217

Query: 212 RNNNDMVVYTSDGTTL--------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           +++N + ++   G  L           VP   +  +        +S          + N 
Sbjct: 218 QDDNSVSLFIGSGQPLVVGNTVSTLSVVPGLDDPTRYQVQLTLGDS----------TQNV 267

Query: 264 GSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
              V  G++  LL  RD+V+    N+L ++A
Sbjct: 268 TRLVSGGQMGGLLAYRDTVLDSSYNKLGQLA 298


>gi|120603465|ref|YP_967865.1| flagellar hook-associated protein FlgK [Desulfovibrio vulgaris DP4]
 gi|120563694|gb|ABM29438.1| flagellar hook-associated protein FlgK [Desulfovibrio vulgaris DP4]
          Length = 698

 Score = 46.2 bits (108), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 115/262 (43%), Gaps = 29/262 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQ----- 55
           MS+ ++FN   N  N A     +   NI N +   Y R++     +P       Q     
Sbjct: 1   MSISSLFNLGWNALNGAQSAIQTTGNNIANVNTPGYSRQEVRFEEAPTLDKFGGQMGQGV 60

Query: 56  ------RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
                 R  NK +F   L  +S+   QQR  + +E   E+   ++ +N + T  I+    
Sbjct: 61  YAAEVIRHFNKFLFSSYLDKYST---QQRWEKQYE---ELQGVENLFNEANTSGINAALT 114

Query: 110 SLESYSKNLSEDILGKTV-------IDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
           +  +  + LS+    K+V        DN  ++++N + +   +Q+   + D++I  ++  
Sbjct: 115 TFFNDWQELSKRPDDKSVREALLAHSDNLTKLIRNADDTMLRMQQ---EIDQQIGQDVDA 171

Query: 163 LRRFLSELTVVNDAIKFK-TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
           +   L  +  +N  +       +++A+   DQRD L++K++E + ++ +     +  V T
Sbjct: 172 VNDMLRSIADINRQLNIHDDPGRNNANTLYDQRDQLVRKLAEKLDVTVVDNGGGNYTVNT 231

Query: 222 SDGTTLFE-TVPRDINFEKMNS 242
             G TL + TV  ++ F+   S
Sbjct: 232 KAGQTLVDGTVAYELRFDGPKS 253



 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           Q + + I    S+  GVNL EE++ L+K + SY  + KL+   D+M Q LL G+K
Sbjct: 644 QAMSDDIDSRMSSVSGVNLDEEMASLVKFQHSYKAAAKLVTTADEMFQVLL-GLK 697


>gi|46578934|ref|YP_009742.1| flagellar hook-associated protein FlgK [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46448346|gb|AAS95001.1| flagellar hook-associated protein FlgK, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311232792|gb|ADP85646.1| flagellar hook-associated protein FlgK [Desulfovibrio vulgaris
           RCH1]
          Length = 698

 Score = 46.2 bits (108), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 115/262 (43%), Gaps = 29/262 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQ----- 55
           MS+ ++FN   N  N A     +   NI N +   Y R++     +P       Q     
Sbjct: 1   MSISSLFNLGWNALNGAQSAIQTTGNNIANVNTPGYSRQEVRFEEAPTLDKFGGQMGQGV 60

Query: 56  ------RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
                 R  NK +F   L  +S+   QQR  + +E   E+   ++ +N + T  I+    
Sbjct: 61  YAAEVIRHFNKFLFSSYLDKYST---QQRWEKQYE---ELQGVENLFNEANTSGINAALT 114

Query: 110 SLESYSKNLSEDILGKTV-------IDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
           +  +  + LS+    K+V        DN  ++++N + +   +Q+   + D++I  ++  
Sbjct: 115 TFFNDWQELSKRPDDKSVREALLAHSDNLTKLIRNADDTMLRMQQ---EIDQQIGQDVDA 171

Query: 163 LRRFLSELTVVNDAIKFK-TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
           +   L  +  +N  +       +++A+   DQRD L++K++E + ++ +     +  V T
Sbjct: 172 VNDMLRSIADINRQLNIHDDPGRNNANTLYDQRDQLVRKLAEKLDVTVVDNGGGNYTVNT 231

Query: 222 SDGTTLFE-TVPRDINFEKMNS 242
             G TL + TV  ++ F+   S
Sbjct: 232 KAGQTLVDGTVAYELRFDGPKS 253



 Score = 42.4 bits (98), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           Q + + I    S+  GVNL EE++ L+K + SY  + KL+   D+M Q LL
Sbjct: 644 QAMSDDIDSRMSSVSGVNLDEEMASLVKFQHSYKAAAKLVTTADEMFQVLL 694


>gi|268317787|ref|YP_003291506.1| flagellar hook-associated protein FlgK [Rhodothermus marinus DSM
           4252]
 gi|262335321|gb|ACY49118.1| flagellar hook-associated protein FlgK [Rhodothermus marinus DSM
           4252]
          Length = 464

 Score = 46.2 bits (108), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 97/515 (18%), Positives = 199/515 (38%), Gaps = 92/515 (17%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR----------DT--MTTISPE 48
           MSL  +F+  +           ++ +N+ NA+ + Y RR          DT   T + P 
Sbjct: 1   MSLNQLFSLTRRSFQTIQAAMNTVGQNVANANTEGYARRRVTLQAVNIRDTGIYTALPPR 60

Query: 49  -----NVTVVTQRSENKNMFDKVLHAHSSAIG----QQRLLQSFEALKEMMSADDHYNNS 99
                 V+V T      ++ D       +++G    + R+ Q  E+L   ++ADD     
Sbjct: 61  SATGLGVSVATYERLRDHLLDVAAWDARASLGAADEETRIYQVLESL---LAADDD---- 113

Query: 100 PTHYISKLRDSLESYSK---NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
            T   + L D    +S    N ++  + + +   A+ ++  F+  AR++  +     + +
Sbjct: 114 -TGLAALLNDFWNRWSDLADNPTDTGVREALRGQAQTLIDTFHRLARDLDTLTIQTTETL 172

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL--DQRDVLLQKISEIIGISTIVRNN 214
              +      L EL  +N  I+   A +    D +  D+RD L+ +++E++ +      +
Sbjct: 173 RDAVDQANSLLEELASLNATIQ--AARQKGNPDLVAEDRRDQLVHELAELLPVQVHALED 230

Query: 215 NDMVVYTSDGTTLFE---TVPRDINFEKMNSYTVTSESNPIFI---DGVVVSSNQGSAVP 268
               + T  G  L +    +P  ++          S   P       G+   + +G    
Sbjct: 231 GSYQL-TVGGMALVQGDQVMPLTLDL---------SGGTPSLTFGNTGIAFRAPEGQ--- 277

Query: 269 KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDN 328
            G+I A L++    +P  + +LD +A  L+           NS +  G  +         
Sbjct: 278 DGRIGAQLRMLTQTIPDVRQRLDTLAATLVNEV--------NSRHASGYGL--------- 320

Query: 329 KLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIF 388
               G++     +P   +  +      ++S   L + + +A   D       +   N + 
Sbjct: 321 ---DGLTGRAFFDPAGTTASTI-----ALSADVLADSRAIAASGD-----PTAPGDNSVA 367

Query: 389 DPVAGINTNV-------TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVG 441
             +AG+   +       T   YA N  G +     D+     +S+   +H+       +G
Sbjct: 368 LQIAGLRDALLFNGGTETAETYAINLAGIIGAAAKDATGRLERSRATIDHLDALQQGVMG 427

Query: 442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           V+L EEL+ +I+ +Q+Y  + +++     M+ TLL
Sbjct: 428 VSLDEELTNMIRFQQAYAATARVLDTARSMMDTLL 462


>gi|148269976|ref|YP_001244436.1| flagellar hook-associated protein FlgK [Thermotoga petrophila
           RKU-1]
 gi|147735520|gb|ABQ46860.1| flagellar hook-associated protein FlgK [Thermotoga petrophila
           RKU-1]
          Length = 858

 Score = 46.2 bits (108), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 123/323 (38%), Gaps = 53/323 (16%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSEN 59
           MS+  + N A    +        +  NI NA    Y R R  +    P  +T +TQ S  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNVVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPS-- 61

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPT-----HYISKL-----RD 109
              F   +   +      RL  +F  + +    ++ YN   T     H+I +L      D
Sbjct: 62  ---FPLQMGTGAKVKTIVRLRDAFLDV-QYRQVNNRYNYWDTVLSNLHFIEQLLAEPGED 117

Query: 110 SLESYSKNL-----------SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIEL 158
            + S   N            S       V+  A+++V         ++++R D D EI  
Sbjct: 118 GVRSLVDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDDEIVQ 177

Query: 159 EISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIS--------TI 210
            +S + + +  L  +N+ I+         +D LD+RD +L ++S +  I+          
Sbjct: 178 RVSEINQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQIT 237

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
           +R  N +V+   +G+T  E    +  + K         S  I  DG              
Sbjct: 238 LRIGNQIVL---NGSTYRELRALERPYGKGYHELFVGNSQLILSDG-------------- 280

Query: 271 KIKALLQIRDSVVPIFQNQLDEM 293
           K+KAL+ +RDS +  +  +LDE 
Sbjct: 281 KLKALMDLRDSSIVKYMRKLDEF 303


>gi|117923397|ref|YP_864014.1| flagellar hook-associated protein FlgK [Magnetococcus sp. MC-1]
 gi|117607153|gb|ABK42608.1| flagellar hook-associated protein FlgK [Magnetococcus sp. MC-1]
          Length = 588

 Score = 46.2 bits (108), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 65/138 (47%), Gaps = 18/138 (13%)

Query: 153 DKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVR 212
           D+EI++ ++ +   L  L  V+ AI+ +  + + A D  DQRD +++++S +I +  +  
Sbjct: 169 DQEIDVLVNTINTKLKSLAEVDSAIQLREKTNNPALDLKDQRDEMIRELSGMIDVQVLSN 228

Query: 213 NNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPI----FIDGVVVSSNQGSAVP 268
            +    + T+ G  L +           + +T T     +       G+ V+   G    
Sbjct: 229 QDGSTTLMTAGGELLMD-----------HGFTATFGRGALDTTTGFAGITVNGKSGDYTD 277

Query: 269 K---GKIKALLQIRDSVV 283
           K   G +KALL++RD VV
Sbjct: 278 KLSSGSLKALLEVRDQVV 295



 Score = 38.1 bits (87), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 52/84 (61%)

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           ++TL  +  ++I  L   ++ + +    +   +N + +  ++  GV+L+EEL+ L++ ++
Sbjct: 505 SLTLSAHYASTISQLGAEQASNEEQLGAATSTYNFMQQVRASISGVSLEEELTDLMRFQR 564

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           ++  S+K+++  D++LQ+++  V+
Sbjct: 565 AFQASSKMVVTADELLQSVIGMVR 588


>gi|330967097|gb|EGH67357.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 686

 Score = 46.2 bits (108), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 65/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNGYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  +  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNEAVRQLNGLVGVKVV-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVITGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|218674738|ref|ZP_03524407.1| flagellar hook-associated protein FlgK [Rhizobium etli GR56]
          Length = 68

 Score = 46.2 bits (108), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (56%)

Query: 1  MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV 53
          MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV
Sbjct: 1  MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVV 53


>gi|238794003|ref|ZP_04637621.1| hypothetical protein yinte0001_21180 [Yersinia intermedia ATCC
           29909]
 gi|238726635|gb|EEQ18171.1| hypothetical protein yinte0001_21180 [Yersinia intermedia ATCC
           29909]
          Length = 555

 Score = 45.8 bits (107), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++
Sbjct: 118 LQNLVSNSGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKITESVTQINNYADQI 177

Query: 171 TVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
             +ND I + + +S  + +  LDQRD L+ ++++I+G+ T+ + + D
Sbjct: 178 AKLNDQITRLRGSSGSEPNALLDQRDQLVTELNQIVGV-TVTQQDGD 223


>gi|37525847|ref|NP_929191.1| flagellar hook-associated protein FlgK [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785276|emb|CAE14217.1| Flagellar hook-associated protein 1 (HAP1) [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|37681983|gb|AAQ97871.1| FlgK [Photorhabdus luminescens]
          Length = 549

 Score = 45.8 bits (107), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 103/212 (48%), Gaps = 11/212 (5%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE 157
           N+ ++ I     SL++   N  +D    T I  ++ +V    ++   ++K+  + ++ I 
Sbjct: 105 NNLSNTIDDFFTSLQNVVSNAEDDAARTTAIGKSKGLVNQLQSADAFLRKMENNINRGIA 164

Query: 158 LEISNLRRFLSELTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
               ++  +  +L  +N  I + +     + +  LDQRD L+ ++++++G+S I ++ + 
Sbjct: 165 NSAESINNYAQQLAKLNGEITRMRGGGSAEPNALLDQRDQLVNELNKLVGVSVIQQDGDS 224

Query: 217 MVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID-----GVVVSSNQGSAVPKGK 271
             V  + G TL +         ++ + +  ++S+ I +      G VV  ++   + KG+
Sbjct: 225 YNVSFAGGLTLVQGTTA----YRVEAISSNADSSRITLGYDRGFGDVVEIDE-KFIDKGQ 279

Query: 272 IKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           +   L+ R  V+   +NQL+ +A VL   F++
Sbjct: 280 LGGTLRARSEVLDNSRNQLNRLALVLGDQFNQ 311


>gi|313200557|ref|YP_004039215.1| flagellar hook-associated protein flgk [Methylovorus sp. MP688]
 gi|312439873|gb|ADQ83979.1| flagellar hook-associated protein FlgK [Methylovorus sp. MP688]
          Length = 647

 Score = 45.8 bits (107), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 104/227 (45%), Gaps = 18/227 (7%)

Query: 90  MSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIR 149
           M AD     SP   +    DS++  + N       + ++ ++E +   F + +  + ++ 
Sbjct: 99  MLADSSAGLSPA--LQDFFDSVQDLTNNPGSASSRQAMLSSSEALASRFQSLSSRLTEME 156

Query: 150 ADADKEIELEISNLRRFLSELTVVNDAIK-FKTASKHDAHDFLDQRDVLLQKISEIIGIS 208
              + ++    S +  +  ++  +ND+I     A+    +D +DQRD+L+ K+S  I  +
Sbjct: 157 NSVNSQLRSSTSLVNSYAQQIASLNDSINNAMGATGKTPNDLMDQRDLLVSKMSSQI-KT 215

Query: 209 TIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS--- 265
           TIV++ N   V+  +G      +P  ++ E  +   V S ++   ++ V  S   G+   
Sbjct: 216 TIVQSGNSYNVFVGNG------LPLVVDKESYSLSVVNSPTDSTRLE-VAYSGKGGTPII 268

Query: 266 ----AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIA 308
               +V  G +  L+Q R+  +   +NQL ++A  L  +F+ +  + 
Sbjct: 269 LGENSVTGGTLGGLVQFRNHSLDTTKNQLGQIAISLTETFNAQQKLG 315


>gi|218689035|ref|YP_002397247.1| flagellar hook-associated protein FlgK [Escherichia coli ED1a]
 gi|218426599|emb|CAR07427.1| flagellar hook-filament junction protein 1 [Escherichia coli ED1a]
          Length = 547

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   ++DG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYVDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A    G+F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAGAFNTQ 312


>gi|253998482|ref|YP_003050545.1| flagellar hook-associated protein FlgK [Methylovorus sp. SIP3-4]
 gi|253985161|gb|ACT50018.1| flagellar hook-associated protein FlgK [Methylovorus sp. SIP3-4]
          Length = 647

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 104/227 (45%), Gaps = 18/227 (7%)

Query: 90  MSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIR 149
           M AD     SP   +    DS++  + N       + ++ ++E +   F + +  + ++ 
Sbjct: 99  MLADSSAGLSPA--LQDFFDSVQDLTNNPGSASSRQAMLSSSEALASRFQSLSSRLTEME 156

Query: 150 ADADKEIELEISNLRRFLSELTVVNDAIK-FKTASKHDAHDFLDQRDVLLQKISEIIGIS 208
              + ++    S +  +  ++  +ND+I     A+    +D +DQRD+L+ K+S  I  +
Sbjct: 157 NSVNSQLRSSTSLVNSYAQQIASLNDSINNAMGATGKTPNDLMDQRDLLVSKMSSQI-KT 215

Query: 209 TIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS--- 265
           TIV++ N   V+  +G      +P  ++ E  +   V S ++   ++ V  S   G+   
Sbjct: 216 TIVQSGNSYNVFVGNG------LPLVVDKESYSLSVVNSPTDSTRLE-VAYSGKGGTPII 268

Query: 266 ----AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIA 308
               +V  G +  L+Q R+  +   +NQL ++A  L  +F+ +  + 
Sbjct: 269 LGENSVTGGTLGGLVQFRNHSLDTTKNQLGQIAISLTETFNAQQKLG 315


>gi|94495405|ref|ZP_01301985.1| flagellar hook-associated protein 1 [Sphingomonas sp. SKA58]
 gi|94424793|gb|EAT09814.1| flagellar hook-associated protein 1 [Sphingomonas sp. SKA58]
          Length = 445

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 77/197 (39%), Gaps = 15/197 (7%)

Query: 21  FASIVRNIENADNKNYVRRDTMTTISPENVTVV-----------TQRSENKNMFDKVLHA 69
            A+I  NI NA    Y RR   T  S  + + +           TQ        D  L A
Sbjct: 19  MAAISENIANAGTDGYARRTVTTAESGASTSTMSLYIAKANFGGTQVMGVDRASDPYLDA 78

Query: 70  HSSAIGQQRLLQSFEALKEMMSADDHYNNSPT---HYISKLRDSLESYSKNLSEDILGKT 126
                G   L  +   L+ +  A+   N+S T     ++ +  ++E  + +  +  L  T
Sbjct: 79  TVRTTGMN-LGSATARLRWLTDAETAMNDSSTGVGQLMTSMFQNMEKLAASPGDTSLRVT 137

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
            +D+   V Q+FN +A ++  +      E    +  + R LS L  +N+++         
Sbjct: 138 TLDSISRVAQSFNQTAADLTNVSDGIATEATASVQTINRSLSALANINNSLLRAQPGTSA 197

Query: 187 AHDFLDQRDVLLQKISE 203
               LD RD  LQ +SE
Sbjct: 198 YAQLLDSRDAALQDLSE 214


>gi|315125990|ref|YP_004067993.1| lateral flagellar hook-associated protein [Pseudoalteromonas sp.
           SM9913]
 gi|315014504|gb|ADT67842.1| lateral flagellar hook-associated protein [Pseudoalteromonas sp.
           SM9913]
          Length = 435

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 89/412 (21%), Positives = 168/412 (40%), Gaps = 74/412 (17%)

Query: 81  QSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNF-- 138
           QS+    E +   D  N    + ++ L D+L + +         +  + +AE  +Q+   
Sbjct: 81  QSYLGFIEQIIGTDSLN--LNNSLASLTDALNAAATKPDSQAFRQQFLSSAEGFMQDIAQ 138

Query: 139 --NTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDV 196
                A +  K+ A     + L +S++ + ++E   +N +I   TA+K    +  D R+ 
Sbjct: 139 INGALAGQATKLNAQM-SNVALNVSSITKQIAE---INSSIGLATANKQSTAELKDNRER 194

Query: 197 LLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDG 256
           L+ ++S  IG+S + R+N  + + T  G  L                 V S++  I ++G
Sbjct: 195 LVNQLSGHIGVSIVERDNGFIDISTLSGAPL----------------VVGSKAASISVNG 238

Query: 257 VVVSSN---QGSAVPK---GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGN 310
             V+SN   Q   + K   G+   L+ + + V+      L+ +   L    +       +
Sbjct: 239 TTVTSNFIGQEFTLDKNVGGQFGGLISVDNDVIKPTLATLNSLVADLADDMNGALQSGFD 298

Query: 311 SENVPG--LFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNL 368
             N PG  LF  + +  L          TI +NP   ++    +D  +       N+ N 
Sbjct: 299 LNNDPGEALFTYNPLNPLG---------TIEINPAITTDKLGFKDSSTSGPGDNSNIAN- 348

Query: 369 AGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE-KNRSDSHDLHMKSQV 427
                             I   +AG     TLL      +G L   ++ + + +   + +
Sbjct: 349 ------------------IVASMAGKGDKFTLL------VGDLAITSKQNLNSITTATNL 384

Query: 428 VFNHIS--ESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
             N I+  +SYS   GVNL EE + L+  +Q Y+ + K+I   D+M ++LL+
Sbjct: 385 SENAIAARDSYS---GVNLDEEAANLMHFQQMYSANAKVISTADQMFKSLLQ 433


>gi|220905263|ref|YP_002480575.1| flagellar hook-associated protein FlgK [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869562|gb|ACL49897.1| flagellar hook-associated protein FlgK [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 715

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           + +  ++  GVNL EE+S LIK + SY  + KLI   D+MLQTLL G+K
Sbjct: 667 LEDRVTSVTGVNLDEEMSNLIKFQHSYTAAAKLITTADQMLQTLL-GLK 714


>gi|187478191|ref|YP_786215.1| flagellar hook-associated protein FlgK [Bordetella avium 197N]
 gi|115422777|emb|CAJ49305.1| flagellar hook-associated protein 1 [Bordetella avium 197N]
          Length = 550

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 127/312 (40%), Gaps = 31/312 (9%)

Query: 16  NASQQFASIV-RNIENADNKNYVRRDTMTTISPENVTV------VTQRSENKNMFDKVLH 68
           NASQ   S+   NI NA    Y R+  +T+ +  + T         Q    K  FD  L+
Sbjct: 12  NASQAGLSVTSHNINNAATDGYSRQRVVTSTAGASATSQGYFGRGVQVDTVKRQFDGFLY 71

Query: 69  AH-SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN--------LS 119
                A G    L +   L +M + ++ + +      + L     S +          + 
Sbjct: 72  KQLVGASGSAAQLST--QLDQMTAVNNLFADRTVGVSAALSGMFSSLNSAASAPADPAVR 129

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +D+ GKT       +V   N + +++Q  R   + +I   ++ +  +L  +  +N  I  
Sbjct: 130 QDLTGKT-----NSLVAQINGAYQQLQNQRDGLNTQISTTVTQVNSYLERINDLNQQITI 184

Query: 180 -KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD-----GTTLFETVPR 233
            +  S    +D +DQRD  L  ++E++G+    + ++  +   S      G T++     
Sbjct: 185 ARGKSGQAPNDLMDQRDQALADLNELVGVRWYEQGDSINISLQSGQTVLAGRTIYPLAA- 243

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            +N     +    + S P    G      +   V  GK+  LL  R+S +   Q+QL ++
Sbjct: 244 -VNSAADPTRVALAYSMPDGNGGTQTIELKDEQVNGGKLGGLLSFRNSALDAVQDQLGQL 302

Query: 294 ARVLIGSFSEKD 305
           A  L  +F+E++
Sbjct: 303 AIGLALAFNEQN 314


>gi|15642858|ref|NP_227899.1| flagellar hook-associated protein 1 [Thermotoga maritima MSB8]
 gi|4980572|gb|AAD35177.1|AE001695_3 flagellar hook-associated protein 1 [Thermotoga maritima MSB8]
          Length = 858

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 125/331 (37%), Gaps = 53/331 (16%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSEN 59
           MS+  + N A    +        +  NI NA    Y R R  +    P  +T +TQ S  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNIVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPS-- 61

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPT-----HYISKL-----RD 109
              F   +   +      RL  +F  + +    ++ YN   T     H+I +L      D
Sbjct: 62  ---FPLQMGTGARVKTIVRLRDAFLDV-QYRQVNNRYNYWDTVLSNLHFIEQLLAEPGED 117

Query: 110 SLESYSKNL-----------SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIEL 158
            + S   N            S       V+  A+++V         ++++R D D EI  
Sbjct: 118 GIRSLVDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDAEIVQ 177

Query: 159 EISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIS--------TI 210
            +S + + +  L  +N+ I+         +D LD+RD +L ++S +  I+          
Sbjct: 178 RVSEINQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQIT 237

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
           +R  N +V+   +G+T  E    +  + K         S  I  DG              
Sbjct: 238 LRIGNQIVL---NGSTYRELRALERPYGKGYHELFVGNSQLILSDG-------------- 280

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
           K+KAL+ +RDS +  +  +LDE    +  S 
Sbjct: 281 KLKALIDLRDSSIVKYMRKLDEFVLFITDSL 311


>gi|297531376|ref|YP_003672651.1| flagellar hook-associated protein FlgK [Geobacillus sp. C56-T3]
 gi|297254628|gb|ADI28074.1| flagellar hook-associated protein FlgK [Geobacillus sp. C56-T3]
          Length = 531

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 92/456 (20%), Positives = 184/456 (40%), Gaps = 67/456 (14%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPT-HYISKLRDSLESYSKNLS---EDILGKTVI-D 129
           G+   L  +EA  + +S  +   N P+   ++K  D      ++LS   E+   ++V+  
Sbjct: 87  GENSKLGYWEARADAVSKMEDIMNEPSDSGLAKTTDQFWQALQDLSTHPENEGARSVVRQ 146

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
               VV+ F+  +  + +IR D   +I   ++ +   L++++ +N+ I     + +  +D
Sbjct: 147 RGLAVVETFHYLSNSLTQIRTDIGTQIGTTVTEINSLLNQISALNERIAEIEPNGYLPND 206

Query: 190 FLDQRDVLLQKISEI--IGISTIVRNNNDMV-------VYTSDGTTLFETV--------- 231
             D+RD L+ ++S+   IG+       N +        VY  +G+     V         
Sbjct: 207 LYDERDRLVDQLSQYMEIGVEKHPTGGNALPMAEGTYDVYVMNGSAKVYLVQGRTASVVS 266

Query: 232 ---PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ----------- 277
                D++ + +      S  N + + G  VS    S++P GK++ L++           
Sbjct: 267 FSDGSDVDGDGVKEMPPASGVNTLDVSGTTVSF---SSLPNGKLRGLIEGYGYQTGTDAS 323

Query: 278 ---IRDSVVPIFQNQLDEMARVLIGSFS---EKDPIAGNSENVPGLFIADGIKDLDN--- 328
              I   + P     LD++A      F+   ++      S N P     DGI  +     
Sbjct: 324 GQPIVKGLYPDMLANLDKLAYTFGTVFNDVHQQGYGLNGSTNHP---FFDGISAVSGAAK 380

Query: 329 --KLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNF 386
             KL   I +   +    +S  +    G   +   L NV++L     L+++   S     
Sbjct: 381 TIKLAADIDDLANIAASTKSGET----GNGNNAINLANVRSL-----LLSNATVSLQDGI 431

Query: 387 IFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD---LHMKSQVVFNHISESYSNTVGVN 443
             + +A +N  ++      N  GW+ +   D      +   S+ +   + E   +   V+
Sbjct: 432 SVN-LASLNLPLSSGTVETNYQGWIGQLGVDGEQANRMKTNSETLRQSVEEKRQSVSSVS 490

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           L EE+  +IK + +YN + + I   D+ML  L+ G+
Sbjct: 491 LDEEMMNMIKYQHAYNAAARQITVIDEMLDKLINGM 526


>gi|297618069|ref|YP_003703228.1| flagellar hook-associated protein FlgK [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145906|gb|ADI02663.1| flagellar hook-associated protein FlgK [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 618

 Score = 45.8 bits (107), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 50/244 (20%), Positives = 113/244 (46%), Gaps = 31/244 (12%)

Query: 83  FEALKEMMSADDHYNNSPTHYISKLRDSLESYSK---NLSE----DILGKTVIDNAEEVV 135
           ++AL+  +   +   N P+     LR  L+++ +   +LSE    + + + V      V 
Sbjct: 95  WQALQTALDKIEAVINEPSD--EGLRGVLDNFWQAWQDLSESPENESVRQVVAQRGMAVA 152

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRD 195
             F+    ++Q++R D + +++ ++  L  + +++  +N  I+  T +  + +D  D+RD
Sbjct: 153 DTFHHIYNQLQELREDLNSQVKAKVDELNSYATQIADLNLQIQAITIAGKEPNDLKDRRD 212

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE---TVPRDINFEKMNSYTVTSESNPI 252
           +LL ++++I+  + IV   + MV     GT L +   T+   +N +    Y V  + +P 
Sbjct: 213 LLLDQLAKIVD-AKIVYELDGMVTVMVGGTPLVQGITTMKVGLNADTNGIYKVVWDPDPS 271

Query: 253 FIDGVVVSSNQGS-------AVPKGKIKALLQIRD-----------SVVPIFQNQLDEMA 294
              G  ++ +           +  G++  LL+ R            ++VP   N+L+ MA
Sbjct: 272 GHPGTSITGDPADDPGYTELHLKSGELLGLLEARGPADHSTLGSERNLVPDLMNRLNLMA 331

Query: 295 RVLI 298
           + ++
Sbjct: 332 KTVV 335


>gi|242278491|ref|YP_002990620.1| flagellar hook-associated protein FlgK [Desulfovibrio salexigens
           DSM 2638]
 gi|242121385|gb|ACS79081.1| flagellar hook-associated protein FlgK [Desulfovibrio salexigens
           DSM 2638]
          Length = 704

 Score = 45.8 bits (107), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           T  TL+EY   ++  +  +   +       + + + ++E   +  GVN+ EE+S LIK +
Sbjct: 620 TKQTLIEYYDGTVAVVGADTGTAKFNKNFQETLASDLNEKQQSVSGVNIDEEMSNLIKYQ 679

Query: 456 QSYNISNKLIMFTDKMLQTLLEGVK 480
            SY  + KLI   D+MLQTLL G+K
Sbjct: 680 HSYTAAAKLITTADQMLQTLL-GMK 703


>gi|167553029|ref|ZP_02346779.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205322438|gb|EDZ10277.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 553

 Score = 45.8 bits (107), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQELDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|84624094|ref|YP_451466.1| flagellar hook-associated protein FlgK [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|84368034|dbj|BAE69192.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 624

 Score = 45.8 bits (107), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 99/236 (41%), Gaps = 21/236 (8%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYI---SKLRDSLESYSKNLSEDILGKTVIDNA 131
           G+   LQ   +L   +  D  Y+N+ T+     S   DS  + S N S     ++++D+ 
Sbjct: 79  GELSRLQQLSSLSNRV--DALYSNTATNVAGLWSNFFDSTSAVSSNASSTAERQSMLDSG 136

Query: 132 EEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFL 191
             +   F     ++  +  + +  +   +  + R   ++  +N  I   +++++ A D L
Sbjct: 137 NSLATRFKQLNGQMDGLSNEVNSGLTSSVDEVNRLTQQIAKLNGTIG--SSAQNAAPDML 194

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           DQRD L+ ++    G + ++++   + V+T+ G  L       +        TV     P
Sbjct: 195 DQRDALVSELVGYTGGTAVMQDGGFINVFTAGGQALV------VATTSSKLTTVADPYQP 248

Query: 252 IFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             +   V    QG  V        G+I  LL+ R SV+   Q +L  +A  +  +F
Sbjct: 249 TKLQ--VAMQTQGQNVSLSANSLGGQIGGLLEFRSSVLEPTQAELGRLAVGMASTF 302


>gi|56421672|ref|YP_148990.1| flagellar hook-associated protein FlgK [Geobacillus kaustophilus
           HTA426]
 gi|56381514|dbj|BAD77422.1| flagellar hook-associated protein 1 (HAP1) [Geobacillus
           kaustophilus HTA426]
          Length = 531

 Score = 45.8 bits (107), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 107/526 (20%), Positives = 207/526 (39%), Gaps = 80/526 (15%)

Query: 18  SQQFA--SIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHS---- 71
           +QQ A  +   NI NA+ + Y R+      +P   T    R          + A S    
Sbjct: 17  AQQAALYTTGHNIANANTEGYTRQRVQLKATPPFPTPGLNRPNIPGQMGTGVEASSVERV 76

Query: 72  -------SAIGQQRLLQSFEALKEMMSADDHYNNSPT-HYISKLRDSLESYSKNLS---E 120
                     G+   L  +EA  + +S  +   N P+   ++K  D      ++LS   E
Sbjct: 77  REYFLDIQYRGENSKLGYWEARADAVSKMEDIMNEPSDSGLAKTMDQFWQALQDLSTHPE 136

Query: 121 DILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   ++V+      VV+ F+  +  + +IR D   +I   ++ +   L++++ +N+ I  
Sbjct: 137 NEGARSVVRQRGLAVVETFHYLSNSLAQIRTDLGTQIGTTVTEINSLLNQISALNERIAE 196

Query: 180 KTASKHDAHDFLDQRDVLLQKISEI--IGISTIVRNNNDMV-------VYTSDGTTLFET 230
              + +  +D  D+RD L+ ++S+   IG+       N +        VY  +G+     
Sbjct: 197 IEPNGYLPNDLYDERDRLIDQLSQYMEIGVEKHPTGGNALPMAEGTYDVYVMNGSAKVYL 256

Query: 231 V------------PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ- 277
           V              D++ + +         N + + G  VS    S++P GK++ L++ 
Sbjct: 257 VQGRTASVVSFSDGSDVDGDGVKEMPPDLGINTLDVSGTTVSF---SSLPNGKLRGLIEG 313

Query: 278 -------------IRDSVVPIFQNQLDEMARVLIGSFS---EKDPIAGNSENVPGLFIAD 321
                        I   + P     LD++A      F+   ++      S N P     D
Sbjct: 314 YGYQTGTDASGQPIVKGLYPDMLANLDKLAYTFGKVFNDVHQQGYGLNGSTNHP---FFD 370

Query: 322 GIKDLDN-----KLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLIN 376
           GI  +       KL   I +   +    +S  +    G   +   L NV++L     L++
Sbjct: 371 GIGAVSGAAKTIKLAADIDDLANIAASTKSGET----GNGNNAINLANVRSL-----LLS 421

Query: 377 HYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLH-MK--SQVVFNHIS 433
           +   S       + +A +N  ++      N  GW+ +   D    + MK  S+++   + 
Sbjct: 422 NATVSLQDGISVN-LASLNLPLSSGTVETNYQGWIGQLGVDGEQANRMKSNSEILRQSVE 480

Query: 434 ESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           E   +   V+L EE+  +IK + +YN + + I   D+ML  L+ G+
Sbjct: 481 EKRQSVSSVSLDEEMMNMIKFQHAYNAAARQITVIDEMLDKLINGM 526


>gi|152989404|ref|YP_001349644.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa PA7]
 gi|150964562|gb|ABR86587.1| flagellar hook-associated protein FlgK [Pseudomonas aeruginosa PA7]
          Length = 682

 Score = 45.8 bits (107), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 88/197 (44%), Gaps = 20/197 (10%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L++ + N S     + V+  A+ + + FNT   ++ K  +  ++++    S +      
Sbjct: 116 ALQTAANNPSSTEAREAVLAQAQGLGKTFNTLYDQLDKQNSLINQQLGALASQVNHLSQS 175

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-- 227
           +   NDAI    ++    +D +D RD  ++K+SE+IG++ + +++N + ++   G  L  
Sbjct: 176 VASYNDAIAKAKSAGAVPNDLMDARDEAVRKLSEMIGVTAVTQDDNSVSLFIGSGQPLVV 235

Query: 228 ------FETVPRDINFEKMNSYTVT-SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                    VP     +  + Y V  S  N I         N    V  G++  LL  R+
Sbjct: 236 GNTVSTLSVVP---GLDDPSRYQVQLSNGNSI--------QNVTGLVSGGEMGGLLAYRN 284

Query: 281 SVVPIFQNQLDEMARVL 297
           S +    N+L ++A  L
Sbjct: 285 SALDSSYNKLGQLAITL 301


>gi|315186992|gb|EFU20749.1| flagellar hook-associated protein FlgK [Spirochaeta thermophila DSM
           6578]
          Length = 624

 Score = 45.4 bits (106), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 91/193 (47%), Gaps = 23/193 (11%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D+ +  S +  E      VI+NA+ +V   +     +  IR   ++++++ ++ +  +++
Sbjct: 126 DAWQELSIHPDEVAARHAVIENAKALVDGIHGRYHALSSIRKMIEEDVQVTVNEVNDYIA 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL- 227
            +  +N+ I    A   + +D +D+RD+L++K++++I I+   R+ ++  ++   G  L 
Sbjct: 186 RIAHLNEQIVKVKAMGDNPNDLMDRRDLLVEKLAKLINITVDKRDPDEFTIHVG-GRHLV 244

Query: 228 -------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                  F   PR  N E  ++      +  + ++G             GK+ ALL++RD
Sbjct: 245 QGKVYHPFILDPRPQN-EGFSAVLWEGSTEEVRLEG-------------GKLAALLELRD 290

Query: 281 SVVPIFQNQLDEM 293
             V     +LD M
Sbjct: 291 GDVRGEIQKLDTM 303


>gi|332982896|ref|YP_004464337.1| flagellar hook-associated protein FlgK [Mahella australiensis 50-1
           BON]
 gi|332700574|gb|AEE97515.1| flagellar hook-associated protein FlgK [Mahella australiensis 50-1
           BON]
          Length = 495

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 97/518 (18%), Positives = 197/518 (38%), Gaps = 103/518 (19%)

Query: 16  NASQQFASI-VRNIENADNKNYVRRDTMT--TISPENVTV--VTQR---------SENKN 61
           N  QQ  ++   NI NA    Y R+  ++   + P  + +  +  R          E + 
Sbjct: 16  NLQQQALNVTAHNIANAGTPGYTRQQVISEAIVPPSTLGMGYIYGRWQVGGGADIQEIRQ 75

Query: 62  MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSP-----THYISKLRDSLESYSK 116
           + D  L A   +  + +LL  +E  ++M+   +   N P     T  + +   SLE  SK
Sbjct: 76  LRDGYLDAQFRS--ESQLLGQWEVRRDMLQHLEGIFNEPSETGITTVVEQFFSSLEELSK 133

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N     +   V +    +         +++ +++ AD+ + + + ++   + ++  +N+ 
Sbjct: 134 NPESMSVRALVRERGITLADTIRHVYNQLEGLQSQADQGVAITVQDINSHIEQIRDLNEQ 193

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-------FE 229
           I         A+D  D+R++L+ ++S++I I+     +    V   D   +        E
Sbjct: 194 IFKYELGGTKANDLRDRRNLLVDELSKMIDITVNEDIDGHFSVKMGDKELVNHFDMHELE 253

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV------- 282
             PR +  EK+N   V      I  DG  ++++    +  G+++  + IRD +       
Sbjct: 254 IEPRAVG-EKLNEADVDGLLK-IMWDGADITAD----ITGGQLRGYIDIRDGIGPAAVGD 307

Query: 283 ------VPIFQNQLDEMARVLIGSFSEK----------------DPIAGNSENVPGLFIA 320
                 VP +  + +E A+  +  F+E+                +P          + ++
Sbjct: 308 QNETVGVPYYMAKWNEWAKAFVTEFNEQHKAGYGLNDATDKLFFEPADAAGWTAKDMKVS 367

Query: 321 DGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD 380
             I DL+N      S      P    N   L     +  K +        + D IN    
Sbjct: 368 SDIDDLNNIAASATSG----EPGNNGNALALL---QIRDKAIAFTGQSGSFEDYINSLIS 420

Query: 381 SFNKNFIFDPVAGINTN--VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSN 438
           +           G+++   + +++  +  IG +E  R                  +S S 
Sbjct: 421 TL----------GVDSQQAIRMVDNEQALIGQIEGKR------------------QSISG 452

Query: 439 TVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +   L EEL  ++K +QSYN + ++I   D+ML  L+
Sbjct: 453 VL---LDEELMNMVKFQQSYNAAARVITAMDEMLDVLV 487


>gi|329849966|ref|ZP_08264812.1| flagellar hook-associated protein FlgK [Asticcacaulis biprosthecum
           C19]
 gi|328841877|gb|EGF91447.1| flagellar hook-associated protein FlgK [Asticcacaulis biprosthecum
           C19]
          Length = 713

 Score = 45.4 bits (106), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 64/309 (20%), Positives = 130/309 (42%), Gaps = 28/309 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR---DTMTTISPENVTVVTQR- 56
           MSL ++ N   +    A +Q      NI N +   Y+R+    T   I  + + V + + 
Sbjct: 1   MSLTSIMNIGVSGLMTAQEQLRITSDNISNVNTPGYIRKVSHQTAVNIGGKGMGVTSGQV 60

Query: 57  --SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSA----DDHYN--NSPTHYISKLR 108
             + ++ +    L A S+A        ++E L ++ S      D  N  N     +S + 
Sbjct: 61  TLAADRYLQAAQLKATSTAAAADV---TYELLDQIQSQFGDITDTSNVFNQAASALSTMA 117

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           ++ E  + N S     +T+ + +  + +    SAR +Q IR DAD  I   + ++   L 
Sbjct: 118 EAAEDPTSNASRQ---QTLSNLSSFLSEGSRISAR-IQTIRGDADARISSSVKSVNDLLK 173

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
            ++ +N  I   T +  DA      +   +  +S+++ ++     N  + V T  G  L 
Sbjct: 174 NISDLNATISAATVAGDDATGAQTTQAKYIDDLSKLMDVNVTQNENGGVTVRTGTGMYLS 233

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVV-----VSSNQGSAVPKGKIKALLQIRDSVV 283
                 ++++   +   T+    I + G+      ++ N    +  G+IK L++IRD+  
Sbjct: 234 GDKYATLSYQPSGNVDATTSFGAIVVTGINGEKRDLADN----IQSGEIKGLMEIRDTTS 289

Query: 284 PIFQNQLDE 292
               +QL++
Sbjct: 290 VAVNDQLNQ 298


>gi|283478787|emb|CAY74703.1| Flagellar hook-filament junction protein 1 [Erwinia pyrifoliae DSM
           12163]
          Length = 512

 Score = 45.4 bits (106), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 105/225 (46%), Gaps = 19/225 (8%)

Query: 86  LKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREV 145
           + +MMS      N+ +  I  L  SL++ + N S+    + V+  AE +V  F  +   +
Sbjct: 56  IDDMMSGT---TNTLSTTIQDLFKSLQTLASNASDSSSRQAVLGKAEGLVNQFKATDTYL 112

Query: 146 QKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTA-SKHDAHDFLDQRDVLLQKISE 203
             + +  +  ++  +  +  +  ++  VN  I K K A +  + +D LD+RD+L+ ++++
Sbjct: 113 TNVDSGLNTSVKSTVEQVNNYAKQIANVNQQIAKLKGAGAGSEPNDLLDKRDLLVSQLNK 172

Query: 204 IIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           ++G++   ++     +   +G +L   V  D  FE++ +  V S ++P       V S  
Sbjct: 173 LVGVNVSQQDGGSYSISIGNGISL---VQGD-RFEQLAA--VPSSADPARTTIANVDSVT 226

Query: 264 G-------SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
           G       S    G +  LL  R  +  + +NQ+ ++A  L  SF
Sbjct: 227 GAKTEIAESQFTSGSLGGLLAFRHDLEGV-RNQIGQLALALGSSF 270


>gi|289651639|ref|ZP_06482982.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 686

 Score = 45.4 bits (106), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNSYLDAQLQTSTALSADAVAYSGQASKT----DTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  I  NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNETVRQLNGLVGVKVI-ENNGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VIGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVISGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|89902483|ref|YP_524954.1| flagellar hook-associated protein [Rhodoferax ferrireducens T118]
 gi|89347220|gb|ABD71423.1| Flagellar hook-associated protein [Rhodoferax ferrireducens T118]
          Length = 644

 Score = 45.4 bits (106), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 105 SKLRDSLESYS--KNLSEDILGKTV-IDNAEEVVQNFNTSAREVQKIRADADKEIELEIS 161
           + + D L ++S   N   D+  +TV +   +E  +   T+++ +  +++   +E+  ++S
Sbjct: 108 AAINDMLNAFSDVANAPTDLTARTVALTRVDEAAKRMRTASQNLDDLQSGVAQELSQKVS 167

Query: 162 NLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY 220
           N+      +  +ND I     S    +D LDQRD L++ +++ +  S+I  ++  + ++
Sbjct: 168 NINSLAKSIADINDKIARTQGSGQPPNDLLDQRDQLVRDLNQYVQTSSITASDGTVGIF 226


>gi|16760059|ref|NP_455676.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16764539|ref|NP_460154.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142170|ref|NP_805512.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56413830|ref|YP_150905.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62179700|ref|YP_216117.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|167994047|ref|ZP_02575139.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234109|ref|ZP_02659167.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237266|ref|ZP_02662324.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244782|ref|ZP_02669714.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168264024|ref|ZP_02685997.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168467136|ref|ZP_02700978.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168822627|ref|ZP_02834627.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194442729|ref|YP_002040437.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448239|ref|YP_002045182.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194736355|ref|YP_002114182.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249622|ref|YP_002146860.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197362753|ref|YP_002142390.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198241785|ref|YP_002215954.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200390530|ref|ZP_03217141.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|207857309|ref|YP_002243960.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213051794|ref|ZP_03344672.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213648932|ref|ZP_03378985.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865497|ref|ZP_03387616.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224584313|ref|YP_002638111.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238910997|ref|ZP_04654834.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289828575|ref|ZP_06546400.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|61224025|sp|P0A1J5|FLGK_SALTY RecName: Full=Flagellar hook-associated protein 1; Short=HAP1
 gi|61224026|sp|P0A1J6|FLGK_SALTI RecName: Full=Flagellar hook-associated protein 1; Short=HAP1
 gi|25300786|pir||AH0640 flagellar hook-associated protein 1 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|47679|emb|CAA36025.1| HAP1 (AA 1-553) [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|16419700|gb|AAL20113.1| hook-filament junction protein 1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16502353|emb|CAD08307.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137800|gb|AAO69361.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56128087|gb|AAV77593.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62127333|gb|AAX65036.1| flagellar biosynthesis, hook-filament junction protein 1
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194401392|gb|ACF61614.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406543|gb|ACF66762.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194711857|gb|ACF91078.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630439|gb|EDX49065.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197094230|emb|CAR59735.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213325|gb|ACH50722.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197289876|gb|EDY29237.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197936301|gb|ACH73634.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199602975|gb|EDZ01521.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205328045|gb|EDZ14809.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331904|gb|EDZ18668.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336421|gb|EDZ23185.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205341046|gb|EDZ27810.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205347332|gb|EDZ33963.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709112|emb|CAR33445.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224468840|gb|ACN46670.1| flagellar hook-associated protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261246394|emb|CBG24203.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267992957|gb|ACY87842.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157724|emb|CBW17216.1| flagellar hook-associated protein 1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912170|dbj|BAJ36144.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320086377|emb|CBY96150.1| Flagellar hook-associated protein 1 HAP1 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321223801|gb|EFX48864.1| Flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616553|gb|EFY13462.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620506|gb|EFY17370.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622500|gb|EFY19345.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629651|gb|EFY26426.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632629|gb|EFY29375.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636876|gb|EFY33579.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641586|gb|EFY38224.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646487|gb|EFY42997.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650024|gb|EFY46442.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653949|gb|EFY50272.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322663339|gb|EFY59541.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670073|gb|EFY66213.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674863|gb|EFY70954.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676667|gb|EFY72734.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682589|gb|EFY78608.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686658|gb|EFY82637.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322714170|gb|EFZ05741.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129453|gb|ADX16883.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195772|gb|EFZ80948.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198336|gb|EFZ83440.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204842|gb|EFZ89836.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209183|gb|EFZ94120.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323213433|gb|EFZ98229.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217857|gb|EGA02572.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222145|gb|EGA06529.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224917|gb|EGA09175.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229659|gb|EGA13782.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323232884|gb|EGA16980.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240619|gb|EGA24661.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242933|gb|EGA26954.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250251|gb|EGA34140.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252625|gb|EGA36463.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258847|gb|EGA42500.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261036|gb|EGA44629.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266945|gb|EGA50430.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269986|gb|EGA53435.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326623702|gb|EGE30047.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332988074|gb|AEF07057.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 553

 Score = 45.4 bits (106), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|289679013|ref|ZP_06499903.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           syringae FF5]
          Length = 560

 Score = 45.4 bits (106), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 137/316 (43%), Gaps = 34/316 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  +TT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVLTTASAQIALGQGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L      S+A+    +  S +A K     D   ++S T    +L D
Sbjct: 58  GTTLSDVRRIYNGYLDTQLQSSTALSADAVAYSGQASKT----DTLLSDSATGISVQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + + ++     + +  A  +   FN+ + ++     + + +++     +   
Sbjct: 114 FFTKMQGIATSATQSAERSSFLTQAGALSARFNSVSSQLSTQNDNVNTQLDTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I   +A     +  LD R   ++K++E++G+  +V NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQASAGNATPNTLLDSRSEAVRKLNELVGVK-VVENNGNFDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-----GSAVPKGKIKALLQIRDS 281
           L   V    ++ KM++    S S+P+  + V V+  Q      S +  G I  LL+ R+ 
Sbjct: 233 L---VSGGTSY-KMSAS--PSPSDPLQYN-VQVAYGQTQTDVTSVLTGGSIGGLLRYRNE 285

Query: 282 VVPIFQNQLDEMARVL 297
           V+    N+L   A VL
Sbjct: 286 VLVPATNELGRTAMVL 301


>gi|222529660|ref|YP_002573542.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456507|gb|ACM60769.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 525

 Score = 45.4 bits (106), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 79/421 (18%), Positives = 167/421 (39%), Gaps = 68/421 (16%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +
Sbjct: 117 IDQFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEI 176

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + 
Sbjct: 177 NSIASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAG 236

Query: 224 GTTL--------FET----VPRDINFEKMNSYTVTSESNPIF------IDGVVV----SS 261
           G TL         ET    + R   F+     T  +  +P+       + G+ V     +
Sbjct: 237 GETLVNHFTVYQLETDKSKIMRKSGFDSSGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDT 296

Query: 262 NQGSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVL 297
            Q   +  G++K LL +RD V                        +P + N+L+E A+ L
Sbjct: 297 GQVLNIKSGELKGLLDVRDGVGGLDEDVSVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKL 356

Query: 298 IGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG 355
           I  F+E      + N +N        GI    N     + +T       + + + + D  
Sbjct: 357 IEKFNELHTQGWSLNGQNT-------GI----NFFEPPVGQTFFYARYIKVSDAIMNDLN 405

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +++    ++  +L G  DL+       N N +F             ++ ++ I  L  + 
Sbjct: 406 NIATT--YDASSLPGGNDLVVDMLKLRNDNSVF-------KEGKFEDFLKSLISNLGVDS 456

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             + +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  +
Sbjct: 457 QGAKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVI 516

Query: 476 L 476
           +
Sbjct: 517 V 517


>gi|170768131|ref|ZP_02902584.1| flagellar hook-associated protein FlgK [Escherichia albertii
           TW07627]
 gi|170122897|gb|EDS91828.1| flagellar hook-associated protein FlgK [Escherichia albertii
           TW07627]
          Length = 547

 Score = 45.4 bits (106), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 104/232 (44%), Gaps = 29/232 (12%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  AE +V  F T+  
Sbjct: 90  EQMSKIDNMLSGSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDAH--DFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A   D LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVNQVNNYAKQIASLNDQISRLTGVGAGASPDDLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFET--------VPRDINFEKMNSYTVTSES 249
           + ++++I+G+   V+++    +  ++G +L ++        VP   +  +     V + +
Sbjct: 206 VSELNQIVGVEVSVQDSGTYNITMANGYSLVQSSTARQLAAVPSSTDPSRTTIAYVDASA 265

Query: 250 NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
             I I   +++S        G +  +L  R   +   +N L ++A     +F
Sbjct: 266 GDIEIPDKLLTS--------GSLGGILTFRSQDLDQTRNTLGQLALAFAEAF 309


>gi|161614593|ref|YP_001588558.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363957|gb|ABX67725.1| hypothetical protein SPAB_02343 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 553

 Score = 45.4 bits (106), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQDLDKTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|299068738|emb|CBJ39977.1| flagellar hook-filament junction protein 1 [Ralstonia solanacearum
           CMR15]
          Length = 642

 Score = 45.4 bits (106), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 97/218 (44%), Gaps = 20/218 (9%)

Query: 27  NIENADNKNYVRRDTMTTISPENVTVVTQR---------SENKNMFDKVLHAHSSAIGQQ 77
           NI NA    Y R++ + T   EN+ + T           +  K ++D+ L A   +   Q
Sbjct: 26  NISNASTAGYSRQEAVQT---ENIPMATGAGYLGQGVNVTTVKRIYDQFLTAQVQS--GQ 80

Query: 78  RLLQSFEALKEMMSADDHY----NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
               + + L  ++S  D Y    N+     ++   ++ +S + N S     +  +  A  
Sbjct: 81  AASSAADQLNSLVSGLDTYMSDSNSGLGSALTSFFNAADSLASNPSSTSARQVFLSAAST 140

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASK-HDAHDFL 191
           +   FN  + ++  +    + +++ +++++     ++  +ND I K + AS    A+D  
Sbjct: 141 LQTRFNAISGQMASLSNQVNTQVQTQVNSVNSTTQQIAALNDQIAKAEAASGGQPANDLR 200

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           DQRD L+Q +++ I  S +  ++    +Y  +G  L +
Sbjct: 201 DQRDQLVQTLNQSIKASVVQTSDGQYNIYVGNGQALVQ 238


>gi|213024454|ref|ZP_03338901.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 403

 Score = 45.1 bits (105), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 127 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 182

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 183 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 242

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 243 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 295

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 296 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 337


>gi|302339108|ref|YP_003804314.1| flagellar hook-associated protein FlgK [Spirochaeta smaragdinae DSM
           11293]
 gi|301636293|gb|ADK81720.1| flagellar hook-associated protein FlgK [Spirochaeta smaragdinae DSM
           11293]
          Length = 627

 Score = 45.1 bits (105), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 104/226 (46%), Gaps = 26/226 (11%)

Query: 18  SQQFASIVRNIENADNKNYVR-RDTMTTISPENVT--------------VVTQR--SENK 60
           +Q  +++  NI NA  + Y R R  M+   P  V               VVT+R    + 
Sbjct: 19  AQGLSTVGHNITNAATEGYSRQRVEMSPYEPIYVPGLNREETAGQMGQGVVTERISRAHD 78

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS- 119
           ++ ++ + + SS  G   +  S+     ++ A+  YN      +  L D      ++LS 
Sbjct: 79  SILERRIVSQSSGKGYWDVRDSY-----ILMAEQVYNEPSELSVRGLMDKFWESWQDLSL 133

Query: 120 --EDILGK-TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
             ED   +  +I+  + ++   +     ++ IR   +++I++ +  +    S++  +N  
Sbjct: 134 HPEDNASRLAIIERGDSLMDGIHRRYEGLKDIREMLEQDIQVTVDRVNNITSDIADLNRE 193

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           I    A   + +D LD+RD+L++K+++II IS   R+ ++  V++ 
Sbjct: 194 IIKVKAMGDEPNDLLDRRDLLVRKLADIIDISVDDRDPDEFTVHSG 239


>gi|259908806|ref|YP_002649162.1| flagellar hook-associated protein FlgK [Erwinia pyrifoliae Ep1/96]
 gi|224964428|emb|CAX55937.1| Flagellar hook-filament junction protein 1 [Erwinia pyrifoliae
           Ep1/96]
          Length = 551

 Score = 45.1 bits (105), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 105/225 (46%), Gaps = 19/225 (8%)

Query: 86  LKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREV 145
           + +MMS      N+ +  I  L  SL++ + N S+    + V+  AE +V  F  +   +
Sbjct: 95  IDDMMSGT---TNTLSTTIQDLFKSLQTLASNASDSSSRQAVLGKAEGLVNQFKATDTYL 151

Query: 146 QKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTA-SKHDAHDFLDQRDVLLQKISE 203
             + +  +  ++  +  +  +  ++  VN  I K K A +  + +D LD+RD+L+ ++++
Sbjct: 152 TNVDSGLNTSVKSTVEQVNNYAKQIANVNQQIAKLKGAGAGSEPNDLLDKRDLLVSQLNK 211

Query: 204 IIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           ++G++   ++     +   +G +L   V  D  FE++ +  V S ++P       V S  
Sbjct: 212 LVGVNVSQQDGGSYSISIGNGISL---VQGD-RFEQLAA--VPSSADPARTTIANVDSVT 265

Query: 264 G-------SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSF 301
           G       S    G +  LL  R  +  + +NQ+ ++A  L  SF
Sbjct: 266 GAKTEIAESQFTSGSLGGLLAFRHDLEGV-RNQIGQLALALGSSF 309


>gi|321313088|ref|YP_004205375.1| flagellar hook-associated protein FlgK [Bacillus subtilis BSn5]
 gi|320019362|gb|ADV94348.1| flagellar hook-associated protein FlgK [Bacillus subtilis BSn5]
          Length = 507

 Score = 45.1 bits (105), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 79/404 (19%), Positives = 152/404 (37%), Gaps = 60/404 (14%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  S N +E+     V    + V + FN  +  +  ++++   E+   + ++   LS
Sbjct: 126 NSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVNSLLS 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++GT   
Sbjct: 186 QLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAEGTVSI 245

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           E + ++    K +  TV    N    +      N+   V        + I D+ V +   
Sbjct: 246 EILDKN----KQSLGTVLDGKNYEVSELAANYDNETGLVSS------ISIGDTAVQVE-- 293

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADG---------IKDLDNKLCQGISETIC 339
                      SFS K  + G  E+  G   ADG         + DLDN     +     
Sbjct: 294 -----------SFSSKGSLLGFIESY-GYITADGQEKGVYPEMLSDLDN---MALEFAKA 338

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWN----VKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
            N  +R+  +   + G     F        K  AG   + +   DS   N  F      N
Sbjct: 339 FNEVHRNGVTKSGEQGGDFFDFTGGETEPAKGAAGKIKVADSIIDSKGANIAFSLTGAAN 398

Query: 396 TNV--------------------TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
            N                     ++L+Y    IG L     +++ L   ++   N    +
Sbjct: 399 DNANATKLANVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADIN 458

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                 V+L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 459 RQQMSAVSLDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGM 502


>gi|194468525|ref|ZP_03074509.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194454889|gb|EDX43728.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
          Length = 553

 Score = 45.1 bits (105), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|255022062|ref|ZP_05294068.1| Flagellar hook-associated protein flgK [Acidithiobacillus caldus
           ATCC 51756]
 gi|254968548|gb|EET26104.1| Flagellar hook-associated protein flgK [Acidithiobacillus caldus
           ATCC 51756]
          Length = 661

 Score = 45.1 bits (105), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 74/163 (45%), Gaps = 6/163 (3%)

Query: 67  LHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKT 126
           + A SS  G+   LQ   +L  + S     +++    IS    + ++ S N S     ++
Sbjct: 84  MAAASS--GEVNTLQQLSSLFPVTSGQSGLSSA----ISNFYAAFQTLSTNPSSIPDRQS 137

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+  A+ +   +  S   +  ++    ++++  +  +    S+L  +N +I    +    
Sbjct: 138 VLSQAQSLTAQYQNSINTIASVKNGLVQQMQQSVGTINALSSQLAKINQSILATPSGSSI 197

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
            +  LD +   L ++S+ IGI+TI  ++  ++V T  G TL +
Sbjct: 198 PNSLLDSQAAALDQLSKQIGINTITTSDGTLIVTTKSGATLVD 240



 Score = 37.7 bits (86), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            V +  + + SN  GVNL EE + ++   Q+Y  ++ +I  T+ + Q+LL+ V
Sbjct: 609 AVLSQATTALSNISGVNLNEEAAQVVNYTQAYQAASAIIQTTNTLFQSLLQAV 661


>gi|255654320|ref|ZP_05399729.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-23m63]
          Length = 315

 Score = 45.1 bits (105), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%)

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           ES SK+++ D     V++NA  +    + S +++ K++ D D  I+ EI  +   L  L 
Sbjct: 8   ESLSKDINSDSKKSLVVENASNLATLISESYKKLDKLKGDIDSNIDTEIKQINEMLKSLE 67

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKIS 202
            +N +I   + S    +D LD+RD +L  +S
Sbjct: 68  DLNKSIDIISGSGSMPNDLLDERDRILDNLS 98


>gi|256750927|ref|ZP_05491811.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750262|gb|EEU63282.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 480

 Score = 45.1 bits (105), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 97/485 (20%), Positives = 192/485 (39%), Gaps = 74/485 (15%)

Query: 27  NIENADNKNYVRRDT-MTTISP---------------ENVTVVTQRSENKNMFDKVLHAH 70
           NI NA+   Y R+   M +I+P               E V +   R       D      
Sbjct: 27  NIANANTPGYTRQVVDMASIAPPTTFGMYDQWGKAIGEGVKIQDIRQIRDQFLDNQFRRE 86

Query: 71  SSAIGQQRLLQSFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGK 125
           +  +G+      +E   ++++A +   N P+       ++   +SL+  SKN     +  
Sbjct: 87  NKFLGE------WETKAQVLAAVEDIFNEPSDSGINTVLNDFFNSLQELSKNPESLTVRA 140

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            V + A  +   FNT  + +     + +  I+  I+ +  +   ++ +N+ I     +  
Sbjct: 141 EVRERAIALADTFNTVYQHLYDKLNELNSTIQSRIAEINSYAERISKLNNEIYRFELTGQ 200

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-----DGTTLFETVPRDINFEKM 240
            A+D  DQR++L+ ++S+++ I+T   +N +  +  +     DG+T F            
Sbjct: 201 TANDLRDQRNLLVDQLSKLVNITTYEDSNRNFRIDIAGQALVDGSTAF------------ 248

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAV--PKGKIKALLQIRDS-------VVPIFQNQLD 291
                 S +N     G VV    G+ V    G +K LL +RD         VP + N+ +
Sbjct: 249 ----TMSLNNT----GAVVWDLTGAPVNPSSGILKGLLDMRDGDGTNGIKGVPYYINEWN 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           ++A  +  + +E    AG      GL  + GI  L          T+      + +   L
Sbjct: 301 KLAYSIAQAINEVHK-AGY-----GLDGSTGIP-LFTDFTTPYDSTVQYAKLIKVSSDIL 353

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
              G      L  +   +    L     ++     + D    +    T  ++AR+ I  L
Sbjct: 354 AADG------LEKIAAASSMATLPGDNTNALKLIALRDQGNAVLNGATFDDFARSLISNL 407

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
             +   ++ +    + +   I  +  +  GV+L EE++ ++K ++SY  S ++I   D++
Sbjct: 408 GVDAQQANLMQKNQEFMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYAASARVITAIDEL 467

Query: 472 LQTLL 476
           L TL+
Sbjct: 468 LDTLI 472


>gi|17548572|ref|NP_521912.1| flagellar hook-associated protein FlgK [Ralstonia solanacearum
           GMI1000]
 gi|17430820|emb|CAD17502.1| probable flagellar hook-associated protein 1 [Ralstonia
           solanacearum GMI1000]
          Length = 642

 Score = 45.1 bits (105), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 97/218 (44%), Gaps = 20/218 (9%)

Query: 27  NIENADNKNYVRRDTMTTISPENVTVVTQR---------SENKNMFDKVLHAHSSAIGQQ 77
           NI NA    Y R++ + T   EN+ + T           +  K ++D+ L A   +   Q
Sbjct: 26  NISNASTAGYSRQEAVQT---ENIPMATGAGYLGQGVNVTTVKRIYDQFLTAQVQS--GQ 80

Query: 78  RLLQSFEALKEMMSADDHY----NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
               + + L  ++S  D Y    N+     ++   ++ +S + N S     +  +  A  
Sbjct: 81  AASSAADQLNSLVSGLDTYLSDSNSGLGSALTSFFNAADSLASNPSSTSARQVFLSAAST 140

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASK-HDAHDFL 191
           +   FN  + ++  +    + +++ +++++     ++  +ND I K + AS    A+D  
Sbjct: 141 LQTRFNAISGQMASLSNQVNTQVQTQVNSVNSTTQQIAALNDQIAKAEAASGGQPANDLR 200

Query: 192 DQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           DQRD L+Q +++ I  S +  ++    +Y  +G  L +
Sbjct: 201 DQRDQLVQTLNQSIKASVVQTSDGQYNIYVGNGQALVQ 238


>gi|73539456|ref|YP_299823.1| flagellar hook-associated protein FlgK [Ralstonia eutropha JMP134]
 gi|72122793|gb|AAZ64979.1| Protein of unknown function DUF1078 [Ralstonia eutropha JMP134]
          Length = 631

 Score = 45.1 bits (105), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 60/332 (18%), Positives = 138/332 (41%), Gaps = 49/332 (14%)

Query: 1   MSLLAV----FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT----- 51
           MSL ++     N AQN     S  FA       NA  + Y R++T+   +    T     
Sbjct: 1   MSLFSIGLSGLNTAQNALTTTSHNFA-------NAATEGYSRQNTIVASAGGQYTSQGFF 53

Query: 52  -VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMS----------ADDHYNNSP 100
            + +  +    ++D+ L       GQ R  QS  +     S          AD     +P
Sbjct: 54  GMGSNTTTVARVYDQFL------TGQLRGAQSAGSALSTYSDQIGQIDNLLADQKGGLAP 107

Query: 101 THYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI 160
              + K   ++++ +   ++    + ++   + +V    +++   +++++  +++I   +
Sbjct: 108 --LMQKFFSAVQAVADTPADPAARQGMLSAGQALVGQVRSASNYFKQLQSGVNEQIGTAV 165

Query: 161 SNLRRFLSELTVVNDAI-KFKTASK-HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMV 218
             +  +  +++ +N  I K K  S     +D LDQRD  + ++++++G   +V++     
Sbjct: 166 DQINSYSKQISNLNGEIAKLKALSGGQPPNDLLDQRDQAVSELTKLVGAKVVVQDGGTYN 225

Query: 219 VYTSDGTTLFETVPRDINFEKMNSYTVTSESNP------IFIDGVVVSSNQGSAVPKGKI 272
           V+  +G       P  +  E  +   V S ++P        + G  +  ++  A+  G +
Sbjct: 226 VFIGNGQ------PLVMGNESYDLKAVASAADPGRTVVAYTVPGGGLRESESGAITGGSL 279

Query: 273 KALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             LLQ R   +   QN +  ++  +  +F+++
Sbjct: 280 GGLLQFRSETLDSAQNSIGRLSLAIGQAFNDQ 311


>gi|330975982|gb|EGH76048.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 686

 Score = 45.1 bits (105), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 137/316 (43%), Gaps = 34/316 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  +TT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVLTTASAQIALGQGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L      S+A+    +  S +A K     D   ++S T    +L D
Sbjct: 58  GTTLSDVRRIYNGYLDTQLQSSTALSADAVAYSGQASKT----DTLLSDSATGISVQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + + ++     + +  A  +   FN+ + ++     + + +++     +   
Sbjct: 114 FFTKMQGIATSATQSAERSSFLTQAGALSARFNSVSSQLSTQNDNVNTQLDTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I   +A     +  LD R   ++K++E++G+  +V NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQASAGNATPNTLLDSRSEAVRKLNELVGVK-VVENNGNFDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-----GSAVPKGKIKALLQIRDS 281
           L   V    ++ KM++    S S+P+  + V V+  Q      S +  G I  LL+ R+ 
Sbjct: 233 L---VSGGTSY-KMSAS--PSPSDPLQYN-VQVAYGQTQTDVTSVLTGGSIGGLLRYRNE 285

Query: 282 VVPIFQNQLDEMARVL 297
           V+    N+L   A VL
Sbjct: 286 VLVPATNELGRTAMVL 301


>gi|329890330|ref|ZP_08268673.1| flagellar hook-associated protein FlgK [Brevundimonas diminuta ATCC
           11568]
 gi|328845631|gb|EGF95195.1| flagellar hook-associated protein FlgK [Brevundimonas diminuta ATCC
           11568]
          Length = 735

 Score = 45.1 bits (105), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 132/308 (42%), Gaps = 23/308 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRR-DTMTTISPENVTVVTQRSEN 59
           MSL ++ N A +  N A  Q   +  N+ N +   YVR+     + + + V    + +  
Sbjct: 1   MSLNSIMNIATSGMNAAQTQLRVVSDNVSNVNTPGYVRKIADQQSWASQGVGAGVEIARI 60

Query: 60  KNMFDKVLHA----HSSAIGQQRL-LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
           +   D+ L A     S+  G+Q +  + ++ ++ M    D  +NS   + S++     ++
Sbjct: 61  RLATDRFLQAASLNASADAGRQTVRYELYDRIQSMFG--DPGSNS--GFFSQIDSVFAAF 116

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAR---EVQKIRADADKEIELEISNLRRFLSELT 171
           + +      G    D   +    F+ +AR   ++Q +R DAD  I+  +      L ++ 
Sbjct: 117 AASAENATSGPARQDAIWKTQALFDEAARINSQIQSVREDADARIKSAVETANSLLEQIE 176

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N  I   T    D+      +  L+ ++S ++ +    R    + + T  G  L    
Sbjct: 177 KLNVEIAKATVINADSSGAQTAQAALIDQLSGLMDVRITGRAVGGVEIRTGAGILLAGQG 236

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA------VPKGKIKALLQIRDSVVPI 285
              +++ +  +  V++E+  +F + +V+    G A      +  G+IK LL++RD   P 
Sbjct: 237 AAKLDYVRAGA--VSAET--VFNEVMVIEPPAGKARSLAEGLGSGEIKGLLELRDGEAPA 292

Query: 286 FQNQLDEM 293
              +L E+
Sbjct: 293 TAERLAEL 300


>gi|213585978|ref|ZP_03367804.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 546

 Score = 45.1 bits (105), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|304310891|ref|YP_003810489.1| Flagellar hook-associated protein 1 [gamma proteobacterium HdN1]
 gi|301796624|emb|CBL44836.1| Flagellar hook-associated protein 1 [gamma proteobacterium HdN1]
          Length = 668

 Score = 45.1 bits (105), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + ++  A  +   FNT   ++ +     +  ++   S +    SEL  +N A+K  T + 
Sbjct: 131 QVMLSEANALTNRFNTVYEQLYQQNQALNTAMQTITSEITERASELASLNLALKVATTNG 190

Query: 185 HDAH--DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
             A   D LDQRD  L+ +S ++GIS  V  N D  V  S GT     +  D       S
Sbjct: 191 VGAQPNDLLDQRDQALKDLSTLVGIS--VSYNPDNTVDVSVGTGQPLVLGGD-------S 241

Query: 243 YTVTSESN-------PIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV-PIFQNQLDEMA 294
           + +T++ N        + +    ++++  S +  G++  LL++RD ++ P+F N+L  ++
Sbjct: 242 FQLTADDNVTGYNHLGVKLTTANLTTDISSQISGGRLGGLLKVRDELIDPVF-NELGRLS 300

Query: 295 RVL 297
            V+
Sbjct: 301 MVI 303


>gi|157693942|ref|YP_001488404.1| flagellar hook-associated protein FlgK [Bacillus pumilus SAFR-032]
 gi|157682700|gb|ABV63844.1| flagellar hook-associated protein 1 [Bacillus pumilus SAFR-032]
          Length = 506

 Score = 45.1 bits (105), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 77/384 (20%), Positives = 158/384 (41%), Gaps = 54/384 (14%)

Query: 125 KTVID-NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTAS 183
           +TV+  +A+ +V  F      +  I+ +   E++    N+   LS++  VN  I     +
Sbjct: 143 RTVVKTSAQALVDQFRLLNSSLTTIQKNLKTELDSTAKNVNTILSQIDEVNKQIAAVEPN 202

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
            +  +D  D RD L+ ++S  + I      +    +  ++GT   + +  +         
Sbjct: 203 GYLPNDLYDTRDALVDQLSSFVDIKVSYNPSGGNALKIAEGTVNIDIIGANGQSAGTILN 262

Query: 244 TVTSESNPIFID-----GVVVSSNQGSAV-------PKGKIKALLQ--------IRDSVV 283
            +T+E + + I      G+V S   G+           GK+KAL++            + 
Sbjct: 263 GITNEKSELQISYDNTTGLVNSLQFGTTTIAADQLQVNGKVKALVEAYGYMSNGTEKGMY 322

Query: 284 PIFQNQLDEMARVLIGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN 341
           P    +LDE+A+V + +F++  K     N  +    F  +     +N+L +G++  I   
Sbjct: 323 PEMLAELDEVAQVFMDTFNDVHKQGYTLNGTSGQDFFDIEN----NNELNKGLAARI--- 375

Query: 342 PQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD------PVAGIN 395
                          VS   L +  N+A    L     D  N   + +      P+ G  
Sbjct: 376 --------------KVSDVILASTDNIA--ASLNQTQGDGSNATKLANIQDLKLPIGGNT 419

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           T  T+ +Y +N I  +      +  L   S  + N  +E   +T  V++ EE++ +I+ +
Sbjct: 420 T--TIQDYYQNVIAEMGIQGKKNMTLESSSAALVNSANERRMSTSAVSIDEEMTNMIQFQ 477

Query: 456 QSYNISNKLIMFTDKMLQTLLEGV 479
            +YN + +++   D++L  ++ G+
Sbjct: 478 HAYNAAARVVTLQDEILDKVINGM 501


>gi|77165832|ref|YP_344357.1| hypothetical protein Noc_2369 [Nitrosococcus oceani ATCC 19707]
 gi|254433787|ref|ZP_05047295.1| flagellar hook-associated protein FlgK [Nitrosococcus oceani AFC27]
 gi|76884146|gb|ABA58827.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gi|207090120|gb|EDZ67391.1| flagellar hook-associated protein FlgK [Nitrosococcus oceani AFC27]
          Length = 647

 Score = 45.1 bits (105), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 65/124 (52%), Gaps = 16/124 (12%)

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTS 247
           +D LDQRD L+Q +S+   ++ + +++  + V+   G +L   V  D      +S+++T+
Sbjct: 198 NDLLDQRDQLIQDLSQKAAVTVLPQDDGSLNVFIGKGQSL---VTGD------HSHSLTT 248

Query: 248 ESNPIFIDGVVVS-SNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
            +NP     + V  + +G   P       G++ ALL  RD V+   +N L ++A  +  S
Sbjct: 249 LANPYEASRLEVGYAAKGGVAPISDSIQGGELGALLSFRDEVLSSSRNALGQLAVGVAQS 308

Query: 301 FSEK 304
           F+E+
Sbjct: 309 FNEQ 312


>gi|170722885|ref|YP_001750573.1| flagellar hook-associated protein FlgK [Pseudomonas putida W619]
 gi|169760888|gb|ACA74204.1| flagellar hook-associated protein FlgK [Pseudomonas putida W619]
          Length = 682

 Score = 45.1 bits (105), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 101/205 (49%), Gaps = 11/205 (5%)

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           N   T  ++    +L+S +   +ED   + ++ NA+ +   FN+ + + ++   + +  +
Sbjct: 103 NTGITGALTNFFSALQSAANKPTEDASRQLLLSNADALANRFNSLSAQFKEQNTNINGNL 162

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
               + +    S +   N+ I   +A     +D LDQR+  +++++E++G+ T+ R+ N 
Sbjct: 163 SSMTARINELTSSIAQYNEQISKVSAINGQPNDLLDQRNEAVRQLNELVGVQTVERDGN- 221

Query: 217 MVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNP----IFIDGVVVSSNQGSAVPKGKI 272
           + VY  +G +L   + +  N  KM++    S ++P    I +D    + +  +++  G++
Sbjct: 222 IDVYLKNGQSLV--LGKTTN--KMSAE--PSATDPTQFAIKLDRGSTTMDITNSITGGEM 275

Query: 273 KALLQIRDSVVPIFQNQLDEMARVL 297
             LL+ R   +    N+L  +A V+
Sbjct: 276 GGLLRYRSETLAPAMNELGRIALVV 300


>gi|330943214|gb|EGH45621.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 686

 Score = 45.1 bits (105), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 137/316 (43%), Gaps = 34/316 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  +TT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVLTTASAQIALGQGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L      S+A+    +  S +A K     D   ++S T    +L D
Sbjct: 58  GTTLSDVRRIYNGYLDTQLQSSTALSADAVAYSGQASKT----DTLLSDSATGISVQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + + ++     + +  A  +   FN+ + ++     + + +++     +   
Sbjct: 114 FFTKMQGIATSATQSAERSSFLTQAGALSARFNSVSSQLSTQNDNVNTQLDTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I   +A     +  LD R   ++K++E++G+  +V NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQASAGNATPNTLLDSRSEAVRKLNELVGVK-VVENNGNFDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-----GSAVPKGKIKALLQIRDS 281
           L   V    ++ KM++    S S+P+  + V V+  Q      S +  G I  LL+ R+ 
Sbjct: 233 L---VSGGTSY-KMSAS--PSPSDPLQYN-VQVAYGQTQTDVTSVLTGGSIGGLLRYRNE 285

Query: 282 VVPIFQNQLDEMARVL 297
           V+    N+L   A VL
Sbjct: 286 VLVPATNELGRTAMVL 301


>gi|308273550|emb|CBX30152.1| hypothetical protein N47_D29610 [uncultured Desulfobacterium sp.]
          Length = 584

 Score = 44.7 bits (104), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
           SIG      S+S D +   +V+F+ IS    +   V+L EE++ LIK +Q+Y  + KLI 
Sbjct: 515 SIGTASAGVSNSKDFN---KVMFDKISGLRDSISAVSLDEEMANLIKFQQAYTAAAKLIS 571

Query: 467 FTDKMLQTLL 476
             D+ML TLL
Sbjct: 572 IADEMLDTLL 581



 Score = 37.0 bits (84), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 72/178 (40%), Gaps = 18/178 (10%)

Query: 133 EVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLD 192
           ++    NT    ++++  +    I   I N+ +  SE+   N  I     S   A+D  D
Sbjct: 143 QLADQLNTLDLSMRQVEINLTNSISSGIGNINQLTSEIAKTNKQI-VGMESASIANDLRD 201

Query: 193 QRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF------ETVPRDINFEKMNSYTVT 246
           +R+ L+ ++S  I + +  ++N  + V T+ G  L       E     +N  K+      
Sbjct: 202 KRNELISQLSGYIDVKSFEQDNGTLTVVTARGCVLVNGNDSSELALGGVNGNKVEWQGSG 261

Query: 247 SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             +  I              +  GK+   L +RD ++  +Q  +D + + L  S +++
Sbjct: 262 GSTTDIT-----------GYITNGKLGGWLDMRDQILSKYQLDMDSLTKELAWSVNQQ 308


>gi|197262560|ref|ZP_03162634.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|204930865|ref|ZP_03221738.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|197240815|gb|EDY23435.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|204320324|gb|EDZ05528.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 553

 Score = 44.7 bits (104), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 102/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL +    R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGATARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|332704817|ref|ZP_08424905.1| flagellar hook-associated protein FlgK [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332554966|gb|EGJ52010.1| flagellar hook-associated protein FlgK [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 725

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (72%), Gaps = 1/40 (2%)

Query: 441 GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           GVNL EE+S LIK + SY  + KLI   D+MLQTLL G+K
Sbjct: 686 GVNLDEEMSNLIKFQHSYTAAAKLISTADQMLQTLL-GLK 724



 Score = 37.7 bits (86), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 41/216 (18%), Positives = 98/216 (45%), Gaps = 12/216 (5%)

Query: 26  RNIENADNKNYVRRDTMTTIS------PENVTVVTQRSENKNMFDKVLHAH--SSAIGQQ 77
           +NI N +   Y RR      S      P  + +  + +E    FD+ +  +    +  QQ
Sbjct: 27  QNISNVNTVGYSRRYVRLEESLQLDYRPGQIGMGVEAAEVLRHFDRFIETNYLDKSTMQQ 86

Query: 78  RLLQSFEALKEMMSA--DDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVV 135
           R    F +LK + S   +       + Y+S+     +  +       + +T++ +   ++
Sbjct: 87  RYDTLFGSLKSVDSLLYESEKVGGISSYLSQFFGDWQKLTSETDNYAVRETLLSDTNNLL 146

Query: 136 QNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK-FKTASKHDAHDFLDQR 194
              + +  ++ +++  A++ I+ ++ ++ R L ++  +N  +K  +   +++A+   D R
Sbjct: 147 SVIHQADAQMTRMQEQANQFIQQDVDDVNRILEKIAGINGQLKQVEIPGQNNANALRDDR 206

Query: 195 DVLLQKISEIIGISTIVRNN-NDMVVYTSDGTTLFE 229
           D L+++++  + I+ I R N  D  + T  G TL +
Sbjct: 207 DRLVRELAGKLDINVITRGNEQDFTITTKAGHTLLQ 242


>gi|89092142|ref|ZP_01165097.1| flagellar hook-associated protein [Oceanospirillum sp. MED92]
 gi|89083877|gb|EAR63094.1| flagellar hook-associated protein [Oceanospirillum sp. MED92]
          Length = 750

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 84/174 (48%), Gaps = 11/174 (6%)

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
           I   E +VQ FN     +++     +  +E  ++ +    + +  +N  I    AS +  
Sbjct: 125 IAQTEALVQRFNDLDANIRRQNDTINGRLESNVAAINVISANIAQLNQDIAVAQASGNVN 184

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTS 247
            + LD+RD  L+++S  IG +TI +   ++ V+  +G    E +   ++  +M +    +
Sbjct: 185 SELLDKRDAELEELSTYIGFTTIEQPTGEVSVFVGNG----EPLVVGLSANQMTTLFSPA 240

Query: 248 ESNPIFIDGVVVSSNQG---SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           +S+ + I G+ + ++ G   + +  GKI  ++  RD    I  + LDEM R+ +
Sbjct: 241 DSSQLNI-GLQIGNSVGDITNQLSGGKIGGVIDYRDD---ILGDTLDEMGRIAL 290


>gi|94500248|ref|ZP_01306781.1| Flagellar hook-associated protein [Oceanobacter sp. RED65]
 gi|94427547|gb|EAT12524.1| Flagellar hook-associated protein [Oceanobacter sp. RED65]
          Length = 991

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 72/143 (50%), Gaps = 11/143 (7%)

Query: 159 EISNLRRFLSELTVVNDAIKFKTASKHD--AHDFLDQRDVLLQKISEIIGISTIVRNNND 216
           +++ L   +SEL   N  I+F TAS      ++ LD+RD+ +++ISE++ ++   ++N+ 
Sbjct: 168 QLNTLAESISEL---NTQIQFATASAQGNYPNELLDKRDLAIKEISELVSVTVATQDNDS 224

Query: 217 MVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFI--DGVVVSSNQGSAVPKGKIKA 274
           + ++  +G  L   V +D+N   +         N ++   DGVV   N  + V  GK+  
Sbjct: 225 VNIFIGNGQPL--VVGKDVNRVSVAPGQQDPSRNALYFERDGVV--QNITNEVEGGKLGG 280

Query: 275 LLQIRDSVVPIFQNQLDEMARVL 297
           LL  R  V+    +Q+   A  L
Sbjct: 281 LLAYRREVLDPVISQIGRAAIAL 303


>gi|94987189|ref|YP_595122.1| flagellar hook-associated protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731438|emb|CAJ54801.1| Flagellar hook-associated protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 705

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%)

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           + + N + +   +  GVNL EE++ LIK + SY  + KLI   D+MLQTLL
Sbjct: 651 KTLSNELEQQALSITGVNLDEEMTQLIKFQHSYTAAAKLITTADQMLQTLL 701


>gi|167038179|ref|YP_001665757.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039112|ref|YP_001662097.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X514]
 gi|300913298|ref|ZP_07130615.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X561]
 gi|307723688|ref|YP_003903439.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X513]
 gi|320116588|ref|YP_004186747.1| flagellar hook-associated protein FlgK [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166853352|gb|ABY91761.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X514]
 gi|166857013|gb|ABY95421.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|300889983|gb|EFK85128.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X561]
 gi|307580749|gb|ADN54148.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X513]
 gi|319929679|gb|ADV80364.1| flagellar hook-associated protein FlgK [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 480

 Score = 44.7 bits (104), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 97/485 (20%), Positives = 192/485 (39%), Gaps = 74/485 (15%)

Query: 27  NIENADNKNYVRRDT-MTTISP---------------ENVTVVTQRSENKNMFDKVLHAH 70
           NI NA+   Y R+   M +I+P               E V +   R       D      
Sbjct: 27  NIANANTPGYTRQVVDMASIAPPTTFGMYDQWGKAIGEGVKIQDIRQIRDQFLDNQFRRE 86

Query: 71  SSAIGQQRLLQSFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGK 125
           +  +G+      +E   ++++A +   N P+       ++   +SL+  SKN     +  
Sbjct: 87  NKFLGE------WETKAQVLAAVEDIFNEPSDSGINTVLNDFFNSLQELSKNPESLTVRA 140

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
            V + A  +   FNT  + +     + +  I+  I+ +  +   ++ +N+ I     +  
Sbjct: 141 EVRERAIALADTFNTVYQHLYDKLNELNSTIQSRIAEINSYAERISKLNNEIYRFELTGQ 200

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-----DGTTLFETVPRDINFEKM 240
            A+D  DQR++L+ ++S+++ I+T   +N +  +  +     DG+T F            
Sbjct: 201 TANDLRDQRNLLVDQLSKLVNITTYEDSNRNFRIDIAGQALVDGSTAF------------ 248

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAV--PKGKIKALLQIRDS-------VVPIFQNQLD 291
                 S +N     G VV    G+ V    G +K LL +RD         VP + N+ +
Sbjct: 249 ----TMSLNNT----GAVVWDLTGAPVNPSSGILKGLLDMRDGDGTNGIKGVPYYINEWN 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           ++A  +  + +E    AG      GL  + GI  L          T+      + +   L
Sbjct: 301 KLAYSIAQAINEVHK-AGY-----GLDGSTGIP-LFTDFTTPYDSTVQYAKLIKVSSDIL 353

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
              G      L  +   +    L     ++     + D    +    T  ++AR+ I  L
Sbjct: 354 AADG------LEKIAAASSTATLPGDNTNALKLIALRDQGNAVLNGATFDDFARSLISNL 407

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
             +   ++ +    + +   I  +  +  GV+L EE++ ++K ++SY  S ++I   D++
Sbjct: 408 GVDAQQANLMQKNQEFMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYAASARVITAIDEL 467

Query: 472 LQTLL 476
           L TL+
Sbjct: 468 LDTLI 472


>gi|192361114|ref|YP_001982394.1| flagellar hook-associated protein 1 FlgK [Cellvibrio japonicus
           Ueda107]
 gi|190687279|gb|ACE84957.1| flagellar hook-associated protein 1 FlgK [Cellvibrio japonicus
           Ueda107]
          Length = 923

 Score = 44.7 bits (104), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 78/165 (47%), Gaps = 22/165 (13%)

Query: 138 FNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD--AHDFLDQRD 195
           FN+  + +  I    + E++   S +      +  +N +I  K AS      +D +D+RD
Sbjct: 145 FNSLYQRLADIEKSINGEVKTITSQMTALAKSIAELNQSIAEKRASGQGNMPNDLMDKRD 204

Query: 196 VLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID 255
             L+++S ++ I  + + + D+ V+  +G  L       I   +++S++VT+       D
Sbjct: 205 EALRQLSGLVSIQVVNQGDGDVNVFIGNGQPL-------IVGSQVSSFSVTN-------D 250

Query: 256 GVVVSSNQGSA------VPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           G +   + GSA      +  G+I  LL  R+ V+   QN+L  +A
Sbjct: 251 GKIQLVSNGSAADITSQISGGQIGGLLSYRNEVLYPAQNELGRVA 295


>gi|260774944|ref|ZP_05883845.1| flagellar hook-associated protein FlgK [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609199|gb|EEX35357.1| flagellar hook-associated protein FlgK [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 624

 Score = 44.7 bits (104), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 81/171 (47%), Gaps = 6/171 (3%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           K V++ A+ + QN N     +++     +K+++L I  + +   E+  ++  +  +T   
Sbjct: 133 KVVLEKADLITQNLNDFHETIRRQSDVTNKKLDLGIERVNQLALEIRDLH-RLMMRTPGP 191

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMV-VYTSDGTTLFETVPRDINFEKMNSY 243
           H+  D +DQ + L+ ++SE   ++   R N +   V+  +G TL          + ++ Y
Sbjct: 192 HN--DLMDQHEKLIAELSEYTKVTVTPRKNAEGFNVHIGNGHTLVSGTEAS-QLKMIDGY 248

Query: 244 TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
               +     I+G  + +     +  GK+ A+L +RD  +P   ++L +MA
Sbjct: 249 PDVHQRRLAMIEGKGIKAITTKDI-DGKLGAMLTMRDEKIPYLMDELGKMA 298


>gi|77457733|ref|YP_347238.1| flagellar hook-associated protein FlgK [Pseudomonas fluorescens
           Pf0-1]
 gi|77381736|gb|ABA73249.1| putative flagellar hook-associated protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 681

 Score = 44.7 bits (104), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 88/209 (42%), Gaps = 19/209 (9%)

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           N   T  + K   S++  S + ++D   ++V+  A+ +   FN  A+++    A  +  +
Sbjct: 102 NTGLTGVLQKFFTSMQGVSTSATDDTSRQSVLTGAQALTSRFNALAKQMNDQNATLNGNL 161

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
               S + +  + +  +N  I   + S    +D LD R+  ++++SE+ G + +V     
Sbjct: 162 SDMASQVNKLATSIATLNQKIGEISTSGGQPNDLLDSRNEAVRQLSELTG-AQVVERGTS 220

Query: 217 MVVYTSDG--------TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP 268
             +Y   G        T    TVP   +  +M           I +D    + +  SA+ 
Sbjct: 221 FDIYIGSGQPLVIGNTTNTLSTVPLKGDPSRMG----------IQMDRGSSTIDITSAMT 270

Query: 269 KGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            G+I  LL  R  V+    N+L  +A V+
Sbjct: 271 GGEIGGLLTYRKEVLDPALNELGRVALVV 299


>gi|92114092|ref|YP_574020.1| flagellar hook-associated protein [Chromohalobacter salexigens DSM
           3043]
 gi|91797182|gb|ABE59321.1| Flagellar hook-associated protein [Chromohalobacter salexigens DSM
           3043]
          Length = 539

 Score = 44.7 bits (104), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 137/306 (44%), Gaps = 11/306 (3%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRS--ENKN 61
           +++F+   +  + A    ++   N+ N   + Y R+ T+   S  N +  T  S  E + 
Sbjct: 1   MSIFSIGLSGLSAAQSALSTTSNNLSNVYTEGYNRQLTILGESYSNGSTGTGVSVDEVQR 60

Query: 62  MFDK-VLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD---SLESYSKN 117
            F+  V   ++ A  Q+  L+S+++  ++   DD   +S       ++D   SL+  +  
Sbjct: 61  QFNSYVTEQYNDANSQKSALESYQS--QVSQIDDLLADSDAGLAPLVQDFFSSLDDLTGA 118

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S+    + V+ +A  +   F +    +  +R+  + ++E  ++++    +++  +ND I
Sbjct: 119 ASDPAARQGVLGSASSMAAQFRSFDSYLGDMRSSLNGQLESTVTDINNTATQIAKLNDQI 178

Query: 178 -KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
            + +  S  + +  LD+RD L+  ++E++G    +++ +   +   +G  L  +  +  +
Sbjct: 179 TQARAKSGEEPNSLLDKRDKLVSDLNELVGADLNIQDGDTYNINLENGQPLV-SGTQSYD 237

Query: 237 FEKMNSYTVTSESNPIFIDGVV-VSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
            E + S    S +   + D    V+    SA   G++  LL  R   +   QNQL  M  
Sbjct: 238 LEAVESNEDPSRTVIAYRDAAGNVNQIDDSAFENGELGGLLSFRSETLDSVQNQLGRMTV 297

Query: 296 VLIGSF 301
           VL   F
Sbjct: 298 VLGSEF 303


>gi|215486291|ref|YP_002328722.1| flagellar hook-associated protein FlgK [Escherichia coli O127:H6
           str. E2348/69]
 gi|312968844|ref|ZP_07783051.1| flagellar hook-associated protein FlgK [Escherichia coli 2362-75]
 gi|215264363|emb|CAS08720.1| flagellar hook-filament junction protein 1 [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312286246|gb|EFR14159.1| flagellar hook-associated protein FlgK [Escherichia coli 2362-75]
          Length = 547

 Score = 44.7 bits (104), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   +  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSSAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSTADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A    G+F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAGAFNTQ 312


>gi|119389100|pdb|2D4Y|A Chain A, Crystal Structure Of A 49k Fragment Of Hap1 (Flgk)
 gi|119389101|pdb|2D4Y|B Chain B, Crystal Structure Of A 49k Fragment Of Hap1 (Flgk)
          Length = 463

 Score = 44.3 bits (103), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 52  SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 107

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 108 YAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 167

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 168 GYTLVQGSTARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 220

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 221 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 262


>gi|238927685|ref|ZP_04659445.1| flagellar hook-associated protein 1 [Selenomonas flueggei ATCC
           43531]
 gi|238884401|gb|EEQ48039.1| flagellar hook-associated protein 1 [Selenomonas flueggei ATCC
           43531]
          Length = 579

 Score = 44.3 bits (103), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 89/191 (46%), Gaps = 11/191 (5%)

Query: 127 VIDNAEEVVQNFNTSAREVQ-KIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
           V+     +V    T AR++Q +I A  D E+ ++++       ++ V+N  I     +  
Sbjct: 131 VVQKGNNLVDRIKTGARQLQDQINAQYD-EMRIQVNKANSITEKIAVLNKNIMLAETNGG 189

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV 245
            A+D  DQRD+L+ K+SEI  ++ +  +        S+G TL   V RD N     S  +
Sbjct: 190 KANDLRDQRDLLVDKLSEITNVN-VYEDATGQYTVVSNGMTL---VQRDSNLTIEMSPPI 245

Query: 246 TSESNPIFIDGVVVSSNQGSA-VPKGKIKALLQIRDSVV--PIFQNQLDEMARVLIGSFS 302
            +E   I    + +    G   VP+G +   LQ  D++V    + + L +++  L+ +F+
Sbjct: 246 NNERYGINDYTLRIKEAGGMGYVPQGGVLKALQ--DTIVQDKKYIDNLADISATLMTTFN 303

Query: 303 EKDPIAGNSEN 313
           +   +    +N
Sbjct: 304 DVHKLGAGIDN 314


>gi|323697478|ref|ZP_08109390.1| flagellar hook-associated protein FlgK [Desulfovibrio sp. ND132]
 gi|323457410|gb|EGB13275.1| flagellar hook-associated protein FlgK [Desulfovibrio desulfuricans
           ND132]
          Length = 711

 Score = 44.3 bits (103), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%)

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           T+ T+L+Y    +G +  + + +       Q + N +++      GVNL EE+S LI+ +
Sbjct: 627 TSQTILDYYNGIVGNVGTDTNRAQFNQNFYQTLANDLNDRQQEVSGVNLDEEMSDLIRYQ 686

Query: 456 QSYNISNKLIMFTDKMLQTLL 476
            SY  + KLI   D+MLQT+L
Sbjct: 687 ASYTAAAKLITTADEMLQTIL 707


>gi|283784870|ref|YP_003364735.1| flagellar hook-associated protein 1 [Citrobacter rodentium ICC168]
 gi|282948324|emb|CBG87909.1| flagellar hook-associated protein 1 [Citrobacter rodentium ICC168]
          Length = 546

 Score = 44.3 bits (103), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 43/218 (19%), Positives = 95/218 (43%), Gaps = 18/218 (8%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           SL++   N  +    +T+I  A  +V  F T+ + ++      +  I   +  +  +  +
Sbjct: 116 SLQTLISNAEDPAARQTLIGKANGLVNQFKTTDQYLRDQERQINTSIASSVQQINNYSQQ 175

Query: 170 LTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
           +  +N+ I   T     A  +D LDQRD L+ ++++I+G+   +++     +  ++G +L
Sbjct: 176 IANLNEQISRLTGVGAGAAPNDLLDQRDQLVSELNKIVGVEVSIQDGGTYNITMANGYSL 235

Query: 228 FE--------TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIR 279
            +         VP   +  +     V S++  I I   ++S+        G +  LL  R
Sbjct: 236 VQGSNARQLAAVPSQADPSRTTVAYVDSQAGNIEIPEKLIST--------GSLGGLLTFR 287

Query: 280 DSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
              +   +N L ++A     +F+ +     ++E  PG+
Sbjct: 288 SHELDQTRNTLGQLALAFADAFNNQHNAGFDAEGNPGM 325


>gi|66046700|ref|YP_236541.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257407|gb|AAY38503.1| Flagellar basal body rod protein:Protein of unknown function
           DUF1078 [Pseudomonas syringae pv. syringae B728a]
          Length = 686

 Score = 44.3 bits (103), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 137/316 (43%), Gaps = 34/316 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  +TT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVLTTASAQIALGQGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L      S+A+    L  S +A K     D   ++S T    +L D
Sbjct: 58  GTTLSDVRRIYNSYLDTQLQSSTALSADALAYSGQASKT----DTLLSDSATGISVQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + + ++     + +  A  +   FN+ + ++     + + +++     +   
Sbjct: 114 FFTKMQGIATSATQSAERSSFLTQAGALSARFNSVSSQLSTQNDNVNTQLDTFTKKVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I   +A     +  LD R   +++++E++G+  +V NN +  +YT  G +
Sbjct: 174 TTTLASLNKQITQASAGNATPNTLLDSRSEAVRQLNELVGVK-VVENNGNFDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-----GSAVPKGKIKALLQIRDS 281
           L   V    ++ KM++    S S+P+  + V ++  Q      S +  G I  LL+ R+ 
Sbjct: 233 L---VSGGTSY-KMSAS--PSPSDPLQYN-VQIAYGQTQTDVTSVLTGGSIGGLLRYRNE 285

Query: 282 VVPIFQNQLDEMARVL 297
           V+    N+L   A VL
Sbjct: 286 VLVPATNELGRTAMVL 301


>gi|258592553|emb|CBE68862.1| putative Flagellar hook-associated protein 1 (HAP1) [NC10 bacterium
           'Dutch sediment']
          Length = 466

 Score = 44.3 bits (103), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 92/207 (44%), Gaps = 19/207 (9%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEI 156
           N  ++ +S L  S +  + N   D+  ++V+ D A  +   F+      ++++ D   EI
Sbjct: 109 NGLSNSMSALFASFQDLA-NYPTDLAVRSVVRDKAMALADQFHRLDDGFERLKIDLHNEI 167

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
           ++ +  +     ++  +N  I         A+D  DQRD  L ++S+++G S +      
Sbjct: 168 QVVVKQVNGLAQQIADLNRQIAMSEGGAGSANDLRDQRDQALDELSKLVGGSLVEDIGGQ 227

Query: 217 MVVYTSDGTTLFETVPRDINFEKMNSYTVTSE-SNPIFIDGVVVSSNQGSAVP-KGKIKA 274
           + V    G TL          + + S  +T + ++P +   V +S       P  G++  
Sbjct: 228 VRVTVGGGLTL---------VDGLTSVPITVDTTDPAY---VRLSLGGNLLTPGGGRLAG 275

Query: 275 LLQIR---DSVVPIFQNQLDEMARVLI 298
           LL  R   D  V  FQ+QLD +A+ ++
Sbjct: 276 LLNSRNASDGFVKGFQSQLDALAKAIV 302


>gi|295401181|ref|ZP_06811154.1| flagellar hook-associated protein FlgK [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294976774|gb|EFG52379.1| flagellar hook-associated protein FlgK [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 530

 Score = 44.3 bits (103), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 85/448 (18%), Positives = 188/448 (41%), Gaps = 68/448 (15%)

Query: 80  LQSFEALKEMMSADDHYNNSPTHY-----ISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
           L  + A  E ++  +   N P+ +     +++  +SL+  S N   +     V      V
Sbjct: 92  LGYWSARSEAIAKMEDIMNEPSEFGLSKAMTQFWESLQDLSANPENEGARAVVRQRGIAV 151

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
            ++FN     ++++R D  +EI+  +  +   L +++ +ND IK    + +  +D  D+R
Sbjct: 152 AESFNYLYNSLKQVRDDLGQEIKTGLLEVNSILKQISELNDQIKAIEPNGYLPNDLYDKR 211

Query: 195 DVLLQKISEI--IGISTIVRNNN---------DMVVYTSDGTTLFETVPRDINFEKMNSY 243
           D L+ ++S+   + + T+    N         ++ +   DG+T+ + V ++  + K++ +
Sbjct: 212 DALIDELSKYFQVKVETVPSGGNALDIAEGIYEISLVNQDGSTIGKIVTKN-GYSKLSVF 270

Query: 244 TVTSESNP------IFIDGVV------VSSNQGSAVPKGKIKALLQIRD---------SV 282
                +NP      I I+  +      +S ++ + +  G+IK+L++              
Sbjct: 271 --PDPTNPDAYVSEIRIEDALGNITTTISYDKFNDLANGRIKSLIESYGYGSDPNNVKGY 328

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC-----QGISET 337
            P     LD+MA      F+E+       +   GL  + G    D  L      +G + T
Sbjct: 329 YPEMLADLDKMAYSFAKMFNEQ------HQKGYGLNGSTGKNFFDMTLSGPPTEKGAAAT 382

Query: 338 ICVNPQYRSNPSFL-------RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP 390
           I V+     N S +         G   +  +L  +K++      I +   +        P
Sbjct: 383 IKVHKDIMDNLSNIAASSNSGESGNGNNALYLSMIKDVQ-----ITNGSATLPSG---QP 434

Query: 391 VAG--INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEEL 448
           V+G    T+ T+  + +  IG +  +   +  +   ++ +   +     +   V+L EE+
Sbjct: 435 VSGSLPITSGTVQTFYQGLIGKIGADGQQAERMKTNAETLATSVDNKRQSVSSVSLDEEM 494

Query: 449 SFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           + +IK + +YN + ++I   D+ML  ++
Sbjct: 495 TNMIKFQHAYNAAARMITAIDEMLDKII 522


>gi|310644334|ref|YP_003949093.1| flagellar hook-associated protein flgk [Paenibacillus polymyxa SC2]
 gi|309249285|gb|ADO58852.1| Flagellar hook-associated protein FlgK [Paenibacillus polymyxa SC2]
          Length = 522

 Score = 44.3 bits (103), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 92/200 (46%), Gaps = 25/200 (12%)

Query: 105 SKLRDSLESYSKNLS------EDILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIE 157
           + +R  L+++ K+ S      E +  +T++ +NA  +    N  ++++  + AD    +E
Sbjct: 115 TGIRKVLDNFYKSWSDLSKDPESVTARTIVKENALALTDAMNHMSKQLSNLSADLTSNVE 174

Query: 158 LEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDM 217
            + S L+ +++ +  +N +I        +A+D  DQRD+++ KIS+I+ ++  V + +  
Sbjct: 175 AKSSELQSYVNSIADLNQSITKIEGLGDNANDLRDQRDLIVDKISKIVNVT--VTDTDQG 232

Query: 218 VVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ 277
                 G  L         FE       T+  N  F+     S++    +  G++  ++ 
Sbjct: 233 YNVNMGGQALV------TGFEP------TTGINGAFLQAAFASND----LQGGEVHGMIF 276

Query: 278 IRDSVVPIFQNQLDEMARVL 297
            RD  V  +  Q+D +A  L
Sbjct: 277 SRDRFVADYTAQMDNLANTL 296


>gi|325474917|gb|EGC78103.1| flagellar hook-associated protein FlgK [Treponema denticola F0402]
          Length = 623

 Score = 44.3 bits (103), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 118/293 (40%), Gaps = 23/293 (7%)

Query: 10  AQNICNNASQQFASIVRNIENAD---NKNYVRRDTMTTISPENVTVVTQRSENKNMFDKV 66
             NI N++++ +     N+E  +     +  R +T   I  + VT+ +       + D+ 
Sbjct: 25  GHNISNSSTKGYTRQRVNLEAFEPIYRPDLTRAETPGQIG-QGVTIASITRLRDELLDQR 83

Query: 67  LHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR-----DSLESYSKNLSED 121
           +   +  +G      S+ AL E +      +N P     + R     ++ +  S     D
Sbjct: 84  IIGATDDLGYWETRNSYIALLEQV------HNEPEDISVRTRMDQFWEAWQELSLYPESD 137

Query: 122 ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKT 181
              + V    E +    +   R +Q IR     +IE  +  +      +  +N+ I    
Sbjct: 138 AARQVVRTRTETLTDAIHHQFRGLQGIRDMVHGDIEATVKQVNDLTGRIAKLNEEIVKVK 197

Query: 182 ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET-VPRDINFEKM 240
           A   + +D +D+RD+L +K+S +I IS   R+ ++  V  + G  + +    R  +F   
Sbjct: 198 AMGDNPNDLMDKRDLLTEKLSSLIDISVDKRDEDETYVIHTAGLEIVQGRTHRTFDFR-- 255

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                 S  N  + D +   S   +    GK+ AL+++RD  +     +LD M
Sbjct: 256 -----ASTENDKYADVIWEDSGNLAHFESGKLAALIELRDKDIRDEIRKLDTM 303


>gi|322435945|ref|YP_004218157.1| flagellar hook-associated protein FlgK [Acidobacterium sp.
           MP5ACTX9]
 gi|321163672|gb|ADW69377.1| flagellar hook-associated protein FlgK [Acidobacterium sp.
           MP5ACTX9]
          Length = 469

 Score = 44.3 bits (103), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 57/118 (48%), Gaps = 1/118 (0%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           SL + + N S+    + V+  A  + Q FN  A+++  + A  +  +   ++ +    + 
Sbjct: 128 SLTALTSNPSDSSTRQAVLTAAGTLAQAFNAGAQQISSVAAGINSGVASSVTAVNSLTAT 187

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
           +  +N  I+ ++    DA    DQR   + ++S+ IG+  I   +N + + T+ G TL
Sbjct: 188 IAGLNAQIQSQS-PNTDAGALEDQRQTAIAQLSQYIGLDQISTESNGIALTTASGATL 244


>gi|161503729|ref|YP_001570841.1| flagellar hook-associated protein FlgK [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865076|gb|ABX21699.1| hypothetical protein SARI_01814 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 553

 Score = 44.3 bits (103), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 102/231 (44%), Gaps = 33/231 (14%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEI----SNLRR 165
           SL++   N  +    + +I  AE +V  F T+    Q +R D DK++ + I    + +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKAEGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVAQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIANLNDQISRLTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL +    R +         V S ++P       V    G+  +P+     G +  LL
Sbjct: 232 GYTLVQGATARQL-------AAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
             R   +   +N L ++A     +F        N+++  G + ADG K  D
Sbjct: 285 TFRSQDLDQTRNTLGQLALAFADAF--------NAQHTKG-YDADGNKGKD 326


>gi|238782798|ref|ZP_04626827.1| Flagellar hook-associated protein [Yersinia bercovieri ATCC 43970]
 gi|238716221|gb|EEQ08204.1| Flagellar hook-associated protein [Yersinia bercovieri ATCC 43970]
          Length = 544

 Score = 44.3 bits (103), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 89/187 (47%), Gaps = 14/187 (7%)

Query: 138 FNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHDFLDQRDV 196
           FN+++R +  +    + +I   ++++   + +L  +ND I K    +     D LDQRD+
Sbjct: 140 FNSNSRTLNGLEKSTNTQINQTVNDINANVKQLAKLNDEITKIHGQTGGLPADLLDQRDM 199

Query: 197 LLQKISEIIGISTIVRNNNDMV-----VYTSDGTTLFETVPRDINFEKMNSYTVTSESNP 251
           LL+++S  +GI    R N D       V  ++G  L     R    E  +S    S++  
Sbjct: 200 LLEQLSGAVGI----RVNEDTTTGRVNVTLTNGMQLVNG-NRAYELETSSSAEDPSKTVV 254

Query: 252 IFID--GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAG 309
            +ID  G  +  N+ S +  GK+  L + R+  +   +NQL+++A  +   F+E +    
Sbjct: 255 SYIDASGNKMQLNE-STMTSGKLGGLFKFRNEDLVDARNQLNQLALQMANKFNEVNAAGY 313

Query: 310 NSENVPG 316
           + +  PG
Sbjct: 314 DLDGNPG 320


>gi|330875990|gb|EGH10139.1| flagellar hook-associated protein FlgK [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 686

 Score = 43.9 bits (102), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 65/318 (20%), Positives = 129/318 (40%), Gaps = 38/318 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------NVTV 52
           MSL+++     +  N +S    +I  N  N D   Y R+  MTT S +         +  
Sbjct: 1   MSLISI---GLSGINASSAAINTIGNNTANVDTAGYSRQQVMTTASAQINIGLGVGYIGT 57

Query: 53  VTQRSENKNMFDKVLHAH---SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
            T  S+ + +++  L A    S+A+    +  S +A K     D   ++S T   ++L D
Sbjct: 58  GTTLSDVRRIYNGYLDAQLQTSTALSADAVAYSGQASK----IDTLLSDSATGVSTQLAD 113

Query: 110 ---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
               ++  + N ++       +  A  +   FN+ A ++     + + ++      +   
Sbjct: 114 FFTKMQGIATNATQSSDRSAFLTQASALSSRFNSVASQLSSQNDNVNAQLTTFTKQVNEL 173

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
            + L  +N  I    A     +  LD R+  +++++ ++G+  +V N  +  +YT  G +
Sbjct: 174 TTTLASLNKQITQAGAGNTTPNSLLDSRNEAVRQLNGLVGVK-VVENYGNYDIYTGTGQS 232

Query: 227 LFETVPRDINFEKMNSYTVTSESNP-------IFIDGVVVSSNQGSAVPKGKIKALLQIR 279
           L              SYT+++  +P       + I      ++  S +  G I  LL+ R
Sbjct: 233 L---------VSGGTSYTMSATPSPADPLQYNVQIAYGQTKTDVTSVITGGSIGGLLRYR 283

Query: 280 DSVVPIFQNQLDEMARVL 297
             V+    N+L   A VL
Sbjct: 284 SDVLVPATNELGRAAMVL 301


>gi|94265700|ref|ZP_01289439.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93453786|gb|EAT04158.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 875

 Score = 43.9 bits (102), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 36/55 (65%)

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           ++V N ++E      GV+L EE++ LIK + +Y  + ++I  +D+ML TLL+ V+
Sbjct: 821 ELVLNQMNEMRDAVSGVSLDEEMANLIKFQHAYTAAARMISMSDEMLVTLLDTVR 875


>gi|260597451|ref|YP_003210022.1| flagellar hook-associated protein FlgK [Cronobacter turicensis
           z3032]
 gi|260216628|emb|CBA29928.1| Flagellar hook-associated protein 1 [Cronobacter turicensis z3032]
          Length = 540

 Score = 43.9 bits (102), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 76/152 (50%), Gaps = 13/152 (8%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   DD  + +  +  + ++D   SL++ + N  +    +T++  A+ +V  F    +
Sbjct: 79  EQMSKIDDMVSGTTNNISTTMQDFFKSLQTLASNAEDPAARQTLLGKADGLVNQF----K 134

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
            V +   D DK++   ++     +  F +++  +N+ I   T     A  +D LDQRD L
Sbjct: 135 VVDQYLRDQDKQVNTAVTASVQQINNFATQIASLNEQITRLTGMGAGASPNDLLDQRDQL 194

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           + ++++I+G+   V++ N   V  ++G  L +
Sbjct: 195 VSELNKIVGVDVSVQDGNTFNVTMANGYNLVQ 226


>gi|292487945|ref|YP_003530820.1| flagellar hook-filament junction protein 1 [Erwinia amylovora
           CFBP1430]
 gi|292899164|ref|YP_003538533.1| flagellar hook-associated protein 1 [Erwinia amylovora ATCC 49946]
 gi|291199012|emb|CBJ46123.1| flagellar hook-associated protein 1 [Erwinia amylovora ATCC 49946]
 gi|291553367|emb|CBA20412.1| Flagellar hook-filament junction protein 1 [Erwinia amylovora
           CFBP1430]
 gi|312172066|emb|CBX80323.1| Flagellar hook-filament junction protein 1 [Erwinia amylovora ATCC
           BAA-2158]
          Length = 551

 Score = 43.9 bits (102), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 114/241 (47%), Gaps = 19/241 (7%)

Query: 88  EMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSARE 144
           +M + DD  + +  +  + ++D   SL++ + N S+    + V+  AE +V  F  S   
Sbjct: 91  QMSNIDDMMSGTTNNLSTNIQDFFKSLQTLASNASDSSSRQAVLGKAEGLVNQFKVSDTY 150

Query: 145 VQKIRADADKEIELEISNLRRFLSELTVVNDAI-KFKTA-SKHDAHDFLDQRDVLLQKIS 202
           +  + +  +  I+  +  +  +  ++  +N  I K K A +  + ++ LD+RD+L+ +++
Sbjct: 151 LANLDSGLNTSIKSTVGQVNNYAEQIANINQQIAKLKGAGAGSEPNNLLDKRDLLVSELN 210

Query: 203 EIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN 262
           +++G++   ++     +   +G +L   V  D  FE++ +  V S ++P       V S 
Sbjct: 211 KLVGVNVSQQDGGSYSISIGNGISL---VQGD-RFEQLAA--VPSSADPARTTIASVDSV 264

Query: 263 QG-------SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
            G       S    G +  LL  R+ +  + +NQ+ ++A  L  +F+ +     +SE   
Sbjct: 265 TGAKTEIAESQFTSGSLGGLLAFRNDLDGV-RNQIGQLALALGSNFNTQHQAGVDSEGDK 323

Query: 316 G 316
           G
Sbjct: 324 G 324


>gi|227355995|ref|ZP_03840387.1| flagellar hook-associated protein 1 [Proteus mirabilis ATCC 29906]
 gi|227163983|gb|EEI48885.1| flagellar hook-associated protein 1 [Proteus mirabilis ATCC 29906]
          Length = 547

 Score = 43.9 bits (102), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 96/204 (47%), Gaps = 17/204 (8%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           SL + + N  ++    T++  AE +V  FN + + ++ +  D + ++     N+  +  +
Sbjct: 117 SLPNVTNNAEDNPARTTILGKAEAMVNMFNKADQSLRDLEKDINSQVTNTTKNINEYSKQ 176

Query: 170 LTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL- 227
           +  +N  I + +  +  + +D LDQRD L+Q+++ ++ +    ++   + V  ++G  L 
Sbjct: 177 IAKLNQEISRSQGFNGAEPNDLLDQRDRLIQELNTLVDVQVTQQDGGFVNVSFANGLPLV 236

Query: 228 -------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                     +P + N E++    V   SN I      V       +  G++    + R+
Sbjct: 237 AGTRSYEVSAIPSNKNSERL----VVGYSNGI----DEVREVDAKRINGGELGGAYRSRN 288

Query: 281 SVVPIFQNQLDEMARVLIGSFSEK 304
            V+   +NQL+++A VL   F+++
Sbjct: 289 EVLDASRNQLNQLALVLGDQFNKQ 312


>gi|118474675|ref|YP_891310.1| flagellar hook-associated protein FlgK [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118413901|gb|ABK82321.1| flagellar hook-associated protein FlgK [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 617

 Score = 43.9 bits (102), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 145/336 (43%), Gaps = 69/336 (20%)

Query: 14  CNNASQQFASIVRNIENADNKNYVRR---DTMTT---ISPENVTVVTQ-----RSENKNM 62
            N A  Q     +NI N ++  Y R+    + TT    SP +V + T+     R  ++  
Sbjct: 14  LNAAQLQIQVTGQNITNINSDYYTRQRVVQSATTPLHTSPGDVGMGTRIDTIIRIHDEFT 73

Query: 63  FDKVLHA----HSSAIGQQRL---LQSFEALKE--MMSADDHYNNSPTHYISKLRDSLES 113
           FDK+  A     ++A  QQ L    Q F  LK+  ++   ++Y  +  ++ S   +S + 
Sbjct: 74  FDKLKTATTNKENTAYKQQVLQEIAQRFPDLKDTGLLKDIENYFGAWNNFASHPYESAQ- 132

Query: 114 YSKNLSEDILGKTVIDNAEEVVQN-FNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
                      KT + N    + N  N ++ +++ +  + +++++L +  + R   ++  
Sbjct: 133 -----------KTNLLNLTSTLTNRLNDTSSQLKTVHNNINEQVKLAVDEINRIGKQIAD 181

Query: 173 VNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-- 229
           +N  I K +T +  +A+D  D+RD L   ++ I+ IST     ND+   ++ G TL +  
Sbjct: 182 LNAQIQKVETGTTQNANDLRDKRDQLELTLANILNISTF---KNDISSNSTFGGTLTDQG 238

Query: 230 ----------TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQG------SAVPKGKIK 273
                     T+   +NF  +   T+ +  N      +    N G      S +  GK+ 
Sbjct: 239 RNYNLNIDGITLIDGVNFHPL---TLDTNGNKDGFTNIYYELNDGTRVDMASKINSGKLG 295

Query: 274 ALLQIR-----------DSVVPIFQNQLDEMARVLI 298
           A+L +R           D ++  F+N LD  A+ LI
Sbjct: 296 AMLDLRGRTMGDNGEVKDGMITEFRNNLDTFAKTLI 331



 Score = 39.7 bits (91), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 428 VFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           ++  ++  + +  GVN+ EEL  LIK + SY  + K++   +KML+TL+ G+K
Sbjct: 565 LYKSVNAEFQSISGVNMDEELGNLIKFQSSYGAAAKIVTTVEKMLETLI-GMK 616


>gi|218887610|ref|YP_002436931.1| flagellar hook-associated protein FlgK [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758564|gb|ACL09463.1| flagellar hook-associated protein FlgK [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 702

 Score = 43.9 bits (102), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 74/173 (42%), Gaps = 11/173 (6%)

Query: 309 GNSENVPGLFIADGIKDLDNKLCQGI-SETICVNPQYRSNPSFLRDGGSVSKKFLWNVKN 367
           G   +  GL    G+    N   QG  + TI V P  RS+ +F+  G    K    N  N
Sbjct: 539 GVGADSAGLLAGLGL----NTYFQGSDASTISVRPDVRSDTNFINAG----KVNGGNEAN 590

Query: 368 LAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQV 427
            AG  D          K           ++ TL EY    +  +  + + +      +  
Sbjct: 591 -AGDNDTATAIAGLATKEVTISTTFERASSQTLSEYYSAIVATVGADTASTKFNAAYTAT 649

Query: 428 VFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           +   + E  S + GVNL EE++ L+K + +Y  + KL+   D+M+QTLL G+K
Sbjct: 650 LAKDLDERQSASSGVNLDEEMASLVKFQHAYKAAAKLVTTADQMMQTLL-GLK 701


>gi|322421655|ref|YP_004200878.1| flagellar hook-associated protein FlgK [Geobacter sp. M18]
 gi|320128042|gb|ADW15602.1| flagellar hook-associated protein FlgK [Geobacter sp. M18]
          Length = 481

 Score = 43.9 bits (102), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 132/297 (44%), Gaps = 37/297 (12%)

Query: 26  RNIENADNKNYVRRDTMTTISPENVT-----------VVTQRSENKNMFDKVLHAHSS-- 72
            NI N + + Y R+  +    P +                QRS +  +  ++++A+S+  
Sbjct: 26  ENISNVNTEGYSRQRVVMENKPVSTANGFALGTGVEIAAVQRSYDNMLQLQLVNANSTYQ 85

Query: 73  -AIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNA 131
            ++ QQ  L+  E     +++ D    +  ++    +D     S N S     + V+  A
Sbjct: 86  ESLAQQSALEQIEPSFNSLTS-DGLGTAVANFFGAFQD----LSVNPSGSAERQAVLTRA 140

Query: 132 EEVVQNFNTSAREVQKIRADADKE---IELEISNLRRFLSELTVVNDAIKFKTASKHDAH 188
           + +V +F+     +  + + AD     I  E+++  R    L +VN  I    +   +A+
Sbjct: 141 QIMVDSFHQLDSSLTSVASTADNNLVGITAEVTDNAR---NLALVNTQILATNSVGGNAN 197

Query: 189 DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSE 248
           + LDQRD+LL+K+SE +G++  V N+    V  + G  L  +      +       VT++
Sbjct: 198 ELLDQRDLLLRKLSEQVGVTYSVANDGTASVTLAGGAQLVSSTRYATLYTNATGAPVTND 257

Query: 249 -----------SNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                      +N    D +V +   G+ V  GK+   +++RDS+VP ++  LDEMA
Sbjct: 258 IMISGLGSPPPANAPATDTLVGTVGDGATV-GGKLGGTMEVRDSIVPKYRAMLDEMA 313


>gi|33596145|ref|NP_883788.1| flagellar hook-associated protein FlgK [Bordetella parapertussis
           12822]
 gi|33601547|ref|NP_889107.1| flagellar hook-associated protein FlgK [Bordetella bronchiseptica
           RB50]
 gi|33573148|emb|CAE36796.1| flagellar hook-associated protein 1 [Bordetella parapertussis]
 gi|33575983|emb|CAE33062.1| flagellar hook-associated protein 1 [Bordetella bronchiseptica
           RB50]
          Length = 548

 Score = 43.9 bits (102), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 89/193 (46%), Gaps = 19/193 (9%)

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF- 179
           D++GK     A  +V   NT+ +E++  R   + +I   +  +  +L  +  +N  I   
Sbjct: 131 DMIGK-----ANSLVTQINTAYQELENQRNGLNTQISTTVEQVNSYLERINDLNKQIVIA 185

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD-----GTTLF--ETVP 232
           +    H  +D LDQRD  + +++++ GI    + +   +   S      GTT++  + VP
Sbjct: 186 RGKDGHAPNDLLDQRDQAVSELNQLTGIRFYEQGDTFNITLQSGQTLLSGTTVYPLQAVP 245

Query: 233 RDINFEKMN-SYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
              + +++  +YT+ S         + V  N  S V  G++  LL  R   +   Q+QL 
Sbjct: 246 SASDPKRLAVAYTLPSGPGTT----IQVEMND-SEVTGGQLGGLLSFRSQSLDAVQDQLG 300

Query: 292 EMARVLIGSFSEK 304
           ++A  L  +F+ +
Sbjct: 301 QLAIGLAMAFNAQ 313


>gi|291282102|ref|YP_003498920.1| Flagellar hook-associated protein FlgK [Escherichia coli O55:H7
           str. CB9615]
 gi|290761975|gb|ADD55936.1| Flagellar hook-associated protein FlgK [Escherichia coli O55:H7
           str. CB9615]
          Length = 547

 Score = 43.9 bits (102), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++S+I+G+   V++     +  ++G +L + +  R +    + S    S +   ++DG
Sbjct: 206 VSELSQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSCADPSRTTVAYVDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNSQ 312


>gi|94263281|ref|ZP_01287097.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456364|gb|EAT06488.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 879

 Score = 43.9 bits (102), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           K R+   +L   +++V N ++E      GV+L EE++ LIK + +Y  + ++I  +D+ML
Sbjct: 813 KGRTIGRNLEF-NELVLNQMNEMRDAVSGVSLDEEMANLIKFQHAYTAAARMISMSDEML 871

Query: 473 QTLLEGVK 480
            TLL+ V+
Sbjct: 872 VTLLDTVR 879


>gi|289577712|ref|YP_003476339.1| flagellar hook-associated protein FlgK [Thermoanaerobacter italicus
           Ab9]
 gi|289527425|gb|ADD01777.1| flagellar hook-associated protein FlgK [Thermoanaerobacter italicus
           Ab9]
          Length = 480

 Score = 43.9 bits (102), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 82/415 (19%), Positives = 174/415 (41%), Gaps = 42/415 (10%)

Query: 76  QQRLLQSFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGKTVIDN 130
           + + L  +E   ++++A ++  N P+       ++   +SL+  SKN     +   V + 
Sbjct: 86  ENKFLGKWETKAQVLAAIENIFNEPSDSGINTVLNNFFNSLQELSKNPESLTVRAEVRER 145

Query: 131 AEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDF 190
           A  +   FNT  + +     + +  I+  I+ +  +   ++ +N+ I     +   A+D 
Sbjct: 146 AIALADTFNTVYQHLYDKLNELNSTIQSRIAEINSYAERISKLNNEIYRFELTGQTANDL 205

Query: 191 LDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESN 250
            DQR++L+ ++S++I I+T   +N +  +              DI  + + + + T+ + 
Sbjct: 206 RDQRNLLVDQLSKLINITTYEDSNGNFRI--------------DIAGQALVAGS-TAFTM 250

Query: 251 PIFIDGVVVSSNQGSAV--PKGKIKALLQIRDS-------VVPIFQNQLDEMARVLIGSF 301
            +   G VV    G+ V    G +K LL +RD         VP + N+ +++A      +
Sbjct: 251 SLNNTGEVVWDLTGTPVNPSSGVLKGLLDMRDGDSTNGVKGVPYYINEWNKLA------Y 304

Query: 302 SEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKF 361
           S    I    ++  GL  + GI  L          T+      + +   L D G      
Sbjct: 305 SMAQAINEVHKSGYGLDGSTGIP-LFTDFTTPYDSTVQYAQLIKVSSHILADDG------ 357

Query: 362 LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDL 421
           L  +   +    L     ++     + D         T  ++AR+ I  L  +   ++ +
Sbjct: 358 LQKIAAASSDATLPGDNTNALKLIALRDQAISELDGATFDDFARSLISNLGVDAEQANLM 417

Query: 422 HMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
               + +   I  +  +  GV+L EE++ ++K ++SY  S ++I   D++L TL+
Sbjct: 418 QKNQKFMIKQIDLNRQSISGVSLDEEMTNMLKYQKSYAASARMITAIDELLDTLI 472


>gi|304438222|ref|ZP_07398164.1| flagellar hook-associated protein FlgK [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304368829|gb|EFM22512.1| flagellar hook-associated protein FlgK [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 574

 Score = 43.9 bits (102), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 127 VIDNAEEVVQNFNTSAREVQ-KIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
           V+     +V    T AR++Q +I+A  D E+ +++        ++ V+N  I     +  
Sbjct: 141 VLTKGNNLVDRIKTGARQLQDQIKAQYD-EMRIQVGKANSIAEKIAVLNQNIMLAENNGG 199

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
            A+D  DQRD+L+ K+SEI  ++     N    V  S+G TL +
Sbjct: 200 KANDLRDQRDLLVDKLSEITNVNVYEEANGQYTV-VSNGMTLVQ 242


>gi|16080594|ref|NP_391421.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221311492|ref|ZP_03593339.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315819|ref|ZP_03597624.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320734|ref|ZP_03602028.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325019|ref|ZP_03606313.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|2828498|sp|P39810|FLGK_BACSU RecName: Full=Flagellar hook-associated protein 1; Short=HAP1
 gi|1762338|gb|AAC44946.1| flagellar-hook associated protein 1 (HAP1) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|2636067|emb|CAB15558.1| flagellar hook-filament junction [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 507

 Score = 43.9 bits (102), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 79/404 (19%), Positives = 151/404 (37%), Gaps = 60/404 (14%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  S N +E+     V    + V + FN  +  +  ++++   E+   + ++   LS
Sbjct: 126 NSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVNSLLS 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++GT   
Sbjct: 186 QLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAEGTVSI 245

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           E + ++    K +  TV    N    +      N+   V        + I D+ V     
Sbjct: 246 EILDKN----KQSLGTVLDGKNYEVSELAANYDNETGLVSS------ISIGDTAVQAE-- 293

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADG---------IKDLDNKLCQGISETIC 339
                      SFS K  + G  E+  G   ADG         + DLDN     +     
Sbjct: 294 -----------SFSSKGSLLGFIESY-GYITADGQEKGVYPEMLSDLDN---MALEFAKA 338

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWN----VKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
            N  +R+  +   + G     F        K  AG   + +   DS   N  F      N
Sbjct: 339 FNEVHRNGVTKSGEQGGDFFDFTGGETEPAKGAAGKIKVADSIIDSKGANIAFSLTGAAN 398

Query: 396 TNV--------------------TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
            N                     ++L+Y    IG L     +++ L   ++   N    +
Sbjct: 399 DNANATKLANVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADIN 458

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                 V+L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 459 RQQMSAVSLDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGM 502


>gi|291486094|dbj|BAI87169.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           natto BEST195]
          Length = 507

 Score = 43.9 bits (102), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 79/404 (19%), Positives = 151/404 (37%), Gaps = 60/404 (14%)

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  S N +E+     V    + V + FN  +  +  ++++   E+   + ++   LS
Sbjct: 126 NSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVNSLLS 185

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++GT   
Sbjct: 186 QLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAEGTVSI 245

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           E + ++    K +  TV    N    +      N+   V        + I D+ V     
Sbjct: 246 EILDKN----KQSLGTVLDGKNYEVSELAANYDNETGLVSS------ISIGDTAVQAE-- 293

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADG---------IKDLDNKLCQGISETIC 339
                      SFS K  + G  E+  G   ADG         + DLDN     +     
Sbjct: 294 -----------SFSSKGSLLGFIESY-GYITADGQEKGVYPEMLSDLDN---MALEFAKA 338

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWN----VKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
            N  +R+  +   + G     F        K  AG   + +   DS   N  F      N
Sbjct: 339 FNEVHRNGVTKSGEQGGDFFDFTGGETEPAKGAAGKIKVADSILDSKGANIAFSLTGAAN 398

Query: 396 TNV--------------------TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
            N                     ++L+Y    IG L     +++ L   ++   N    +
Sbjct: 399 DNANATKLANVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADIN 458

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                 V+L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 459 RQQMSAVSLDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGM 502


>gi|330502740|ref|YP_004379609.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina
           NK-01]
 gi|328917026|gb|AEB57857.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina
           NK-01]
          Length = 681

 Score = 43.9 bits (102), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 65/131 (49%)

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           N   T  + KL  +L++ +++ +     + V+  AE + + FN     + +  A  +K++
Sbjct: 103 NTGVTPAMQKLFAALQTAAEDPANVPARQLVLSEAEGLAKRFNNIYDRLYEQNAFINKQL 162

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
                 + +  + +   NDAI   +++    +D LD R+  ++K+SE +G++ + +++N 
Sbjct: 163 SAVTDQVNQLATSIAGYNDAIAVASSNGQAPNDLLDAREEAVRKLSEFVGVTVVPQDDNS 222

Query: 217 MVVYTSDGTTL 227
             ++   G  L
Sbjct: 223 YNLFIGSGQPL 233


>gi|327398477|ref|YP_004339346.1| flagellar hook-associated protein FlgK [Hippea maritima DSM 10411]
 gi|327181106|gb|AEA33287.1| flagellar hook-associated protein FlgK [Hippea maritima DSM 10411]
          Length = 580

 Score = 43.5 bits (101), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 19/165 (11%)

Query: 145 VQKIRADADKEIELEISNLRRFLSELTVVNDAIK-FKTASKHDAHDFLDQRDVLLQKISE 203
           + +I+ + D ++   ++ +      +  +N  IK  +   K  A+   DQR VLL+K+S 
Sbjct: 155 LNQIKTNLDDQVSSTVTEINSLSKRIAQLNYEIKKAELGDKDHANTLRDQRSVLLEKLSS 214

Query: 204 IIGISTIVRNNNDMVVYTSDGTTLFETVP-------RDINFEKMNS---YTVTSESNPIF 253
           I  ++ +  + N+      + T L   +P        ++  EK+N    Y V       F
Sbjct: 215 IADVTILEGSYNNQT--KPEMTVLLGGMPLVSGKDYNELTAEKLNGSEYYRV------YF 266

Query: 254 IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           ++      +  S +  G + A+L +RD ++  ++N +DE+A+ LI
Sbjct: 267 VEPSNAKVDITSRIKNGSLGAILNLRDKIISEYKNNIDEIAKTLI 311



 Score = 41.6 bits (96), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%)

Query: 394 INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIK 453
           +N   T+ EY    +G +   +    +++   + V+  +  +  +  GV+L EE + LIK
Sbjct: 494 VNNTQTIDEYYNAFLGSIGSTKQRFDEIYKAKEAVYQQLKTTQQSLEGVSLDEEAANLIK 553

Query: 454 VEQSYNISNKLIMFTDKMLQTLLEGVK 480
            +++Y  + K I   D M QTL+  V+
Sbjct: 554 FQRAYQANAKFISVVDDMTQTLINMVR 580


>gi|167628881|ref|YP_001679380.1| flagellar hook-associated protein flgk, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591621|gb|ABZ83369.1| flagellar hook-associated protein flgk, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 736

 Score = 43.5 bits (101), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 80/168 (47%), Gaps = 16/168 (9%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK-------- 178
           VI+  + +V+     +R++ +I +  +  +   + ++  +  ++  +N  I+        
Sbjct: 145 VIERGKALVETLKHISRQLDQIESSLNDRLAQMVYDINSYGRQIASINSQIQRIESGNPD 204

Query: 179 --FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
                  + +A+D  DQRD+LL K+++++ I T+  + + MV  ++   TL + V    +
Sbjct: 205 KSILGGHRQNANDLRDQRDILLDKLAKLVDI-TVSEDASGMVSVSAGNGTLVDGV----S 259

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
           F  +  Y     +N    + +   + Q +    G+++ +L+ R S+VP
Sbjct: 260 FRTLTYYDAPDANNKALYE-IKWDTGQSAYFNAGELQGILESRGSLVP 306



 Score = 40.8 bits (94), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 45/79 (56%)

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
           +T  ++ RN +G L     ++  +H    V+ + I +   +   V+L EE++ +I+ +Q+
Sbjct: 650 MTYDDFYRNVVGDLGVAGQEAKRMHDNQTVLTDTIDKQRQSISSVSLDEEMTNMIRYQQA 709

Query: 458 YNISNKLIMFTDKMLQTLL 476
           YN S +++   D+ML T++
Sbjct: 710 YNASARMVNVMDEMLDTII 728


>gi|15606764|ref|NP_214144.1| flagellar hook associated protein FlgK [Aquifex aeolicus VF5]
 gi|2983977|gb|AAC07523.1| flagellar hook associated protein FlgK [Aquifex aeolicus VF5]
          Length = 426

 Score = 43.5 bits (101), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 73/339 (21%), Positives = 146/339 (43%), Gaps = 40/339 (11%)

Query: 6   VFNKAQNICNNASQQFASIV----RNIENADNKNYV------RRDTMTTISPENVTVVTQ 55
           +F  + NI + A + +  ++    RNI NA  +NYV      + D  + I+ + V    +
Sbjct: 1   MFGASFNIISQALEVYKKMIDVKNRNIANAQEENYVAEEPVVQSDLYSGITFQEV----R 56

Query: 56  RSENKNMFDKVLH--AHSSAIGQQR-LLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
           R +N N  +      ++ S + ++R  L   E++ + +S      N    Y+++   S +
Sbjct: 57  RIQNFNFINTRNEKLSYVSYLEERRDYLSKLESVFQELSQ----GNGLIDYVNRFFQSYQ 112

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
              K  + +      +++A+ +V+   +   E+ +   + D  I   +  +   + ++  
Sbjct: 113 ELMKEPTNEGAKSQFLESAKMLVKTIKSRYGELTRSYNEIDYTINDYVRKVNELVKKIYK 172

Query: 173 VNDAIKFKTASK----HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +N  I FK A       D    LDQRD  L+++S+ I +         + VYTS G  L 
Sbjct: 173 INKEIFFKYAQTKVRGEDYKTLLDQRDKYLKELSQYINVRAQEDELGRIKVYTSKGFVL- 231

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                 ++F + N +T+  E   +  +     S+  + V  G+IK L+  +  +  +  N
Sbjct: 232 ------VDFSE-NFFTLKYEGGKLIYEK--DESDITNVVESGQIKGLIDAKGDIENLI-N 281

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
           +LD +   L+ +   K P+ G  E    +F    I D +
Sbjct: 282 KLDNLRDYLVNNV--KIPVNGGGE--ASVFSGASINDFE 316


>gi|296102902|ref|YP_003613048.1| flagellar hook-associated protein FlgK [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057361|gb|ADF62099.1| flagellar hook-associated protein FlgK [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 545

 Score = 43.5 bits (101), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 72/148 (48%), Gaps = 5/148 (3%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   DD  ++S     + L+D   SL++   N  +    +TV+  A+ +V  F T+ +
Sbjct: 90  QQMSKIDDVLSDSTNSLSTTLQDFFKSLQTLVSNAEDPAARQTVLGKADGLVNQFKTNDQ 149

Query: 144 EVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA--SKHDAHDFLDQRDVLLQKI 201
            ++   +  +  I   +  +  +  ++  +ND I   T   +    +D LDQRD L+ ++
Sbjct: 150 YLRDQDSQVNTAIASSVEQINNYAKQIANLNDQISRLTGVGAGSSPNDLLDQRDQLVSEL 209

Query: 202 SEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           ++I+G+   V++     V   +G +L +
Sbjct: 210 NQIVGVEVAVQDGGTYNVSFGNGYSLVQ 237


>gi|89895774|ref|YP_519261.1| hypothetical protein DSY3028 [Desulfitobacterium hafniense Y51]
 gi|89335222|dbj|BAE84817.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 533

 Score = 43.5 bits (101), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 101/549 (18%), Positives = 207/549 (37%), Gaps = 123/549 (22%)

Query: 18  SQQFA--SIVRNIENADNKNYVRRDT-MTTISPENVTVVTQRSENKNMFDKVLHAHSSAI 74
           SQQ A  +   NI NA+   Y R+   +   SP+++  +                H  +I
Sbjct: 17  SQQIALDTTGHNIANANTIGYTRQVVNLQATSPDSIPGM---------------GHYLSI 61

Query: 75  GQQRLLQSFEALKEM-MSADDHYNNSPTHYISKLRDSL--------ESYSKNLSEDI--- 122
           G    +QS E  +++ +     + NS   Y +   ++L        E    +LS D+   
Sbjct: 62  GTGVTVQSIERARDIFIDRQFRWENSKQEYWATRENTLAQIEGLLNEPSDNSLSNDLTQF 121

Query: 123 -------------LG--KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
                        LG    +++ A  +    +   +++ + +   D  + ++I  +  + 
Sbjct: 122 WSAWSVLANNPENLGARSVILERAATLADTLHHIDQQITEAQKSLDSSVRVQIDQINSYA 181

Query: 168 SELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV--------RNNNDMVV 219
           +++  +N  IK    +  + +D LD+RD L+  +S+++ +  +         R  N   +
Sbjct: 182 NQIQELNFQIKKVQITGDNPNDLLDKRDALIDDLSKLVNVRVVESRDPNFTDREVNIFKL 241

Query: 220 YTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID---GVVVSSNQGSAVPKGKIKALL 276
           Y  +     + +  D    ++ +      S   F +   G       G+++  G+    L
Sbjct: 242 YIGNEKATNQILVDDTKAYQLETPAAAGASGEPFAEVKWGAGHPLGSGTSINLGEGSGAL 301

Query: 277 QIRDSVVPIFQNQLDEMARVLI-GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGIS 335
           Q                A +L+ GS  E D   G+++    L     ++D  N+L  G++
Sbjct: 302 Q----------------ASILLRGSGFEYDTANGDTKANAHLAY---LRDQYNQLANGLA 342

Query: 336 ETICVNPQYRSNPS---------FLRDGGSVSKKFL----------WNV------KNLAG 370
           E   VN  +R+            F   GG+V+   +          W +      K+  G
Sbjct: 343 E--AVNAIHRTGIDRDGNSDLDFFDTSGGTVTAANIKVNATLISDPWKIATGKVTKDADG 400

Query: 371 YP------DLINHYCDSFNKNF-----IFDPVAG---------INTNVTLLEYARNSIGW 410
            P        I     S    +     + DPV G           +  ++ +Y   ++  
Sbjct: 401 NPVGAYGNGEIAKAISSLATGWTGLDDLTDPVTGDPVTTPPLPPLSASSIGDYYGAALAE 460

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           L  +   +  +     V+  H+     + VGVN+ EE++ L+K ++SY  + +++   D 
Sbjct: 461 LGVDAQQATRMKESQAVLVTHMYNQRQSVVGVNMDEEITNLVKFQKSYTAAARIVTMLDS 520

Query: 471 MLQTLLEGV 479
           ML T++ G+
Sbjct: 521 MLDTIVNGM 529


>gi|253575863|ref|ZP_04853197.1| flagellar hook-associated protein FlgK [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251844657|gb|EES72671.1| flagellar hook-associated protein FlgK [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 523

 Score = 43.5 bits (101), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 106/512 (20%), Positives = 205/512 (40%), Gaps = 62/512 (12%)

Query: 14  CNNASQQFASIVRNIENADNKNYVR-RDTMTTISPENVTVVTQRSENKNMFDKVLHAHSS 72
            N  S Q  ++  NI NA+ + Y R R  +T  +P     +T+ ++   +   V +   +
Sbjct: 17  VNTVSMQ--TLGHNIANANTEGYTRQRVNLTEANPIWAMGMTKSAQPGQLGTGVEYTSIT 74

Query: 73  AIG----------QQRLLQSFEALKEMMSADDHYNNSPT-HYISKLRDSLESYSKNLSED 121
            +           + ++L S+E L   M+A  +  N P+ + +S + D   +  + L+ D
Sbjct: 75  RVRDTFLDTQFRRENQMLGSWEVLNSSMTAIQNIINEPSGNGLSAVMDDFWNSWETLNRD 134

Query: 122 --ILGK--TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
             +L     V   A  +V      +  +  +R D +  I+ ++      L  +  +N  I
Sbjct: 135 PSLLSARVAVAGAASNLVDTLKHISESLNNLRNDINTNIDKKVLEANNILDNIARLNVLI 194

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG---------TTLF 228
           +   +    A+D+ DQRD+LL ++S I+ +     + N MV  TS G         T L 
Sbjct: 195 RDNESFGDHANDYRDQRDLLLDQLSTIVDVQ-YTEDENGMVNITSAGVNVLTGDTVTPLT 253

Query: 229 ETVPRDINFEKMNSYTVTSESNPIF---IDGVVVSSNQGSAVPKGKIKALLQ----IRDS 281
                     ++N Y  + +   +    ++G+V      S +  G IK  L         
Sbjct: 254 AANANTATAGQLNGYVKSLQETDLIRNQLNGLV------STLVTGDIKVTLSNGYVTSSD 307

Query: 282 VVPIFQNQLDEMARVLIGSFSEKDPIAGNSEN--VPGLFIADGIKDLDNKLCQ----GI- 334
           +V +    +D M  V  G+         +S +  V G    +G+  L   L +    GI 
Sbjct: 308 IVALNDVTVDGMGTVAAGTVIPAGSKITSSMDVMVKGF---NGLHQLGYSLTKPSSTGIP 364

Query: 335 -----SETICVNPQYRSNPSFLRDGGSVSKKFLWNVKN-----LAGYPDLINHYCDSFNK 384
                S T  ++   + NP  L D   ++    + V N     + G  D+ N      + 
Sbjct: 365 FFVSDSGTFSID-DIKVNPDILADTNKIAASSQYEVINGVNTTIRGNSDIANAIAGLRDA 423

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
            F F       +  T  +Y R     L    S++   +   + + +++     +  GV++
Sbjct: 424 IFKFPDALTSLSEGTTDDYFRALTADLGIRASNTERNYENERTMTDNLQILRQSVSGVSM 483

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            EEL+ +I+ +Q+YN + + +   D+ML  ++
Sbjct: 484 DEELADMIRFQQAYNAAARNMTVVDEMLDRVI 515


>gi|212637791|ref|YP_002314316.1| flagellar hook-associated protein [Shewanella piezotolerans WP3]
 gi|212559275|gb|ACJ31729.1| Flagellar hook-associated protein, putative [Shewanella
           piezotolerans WP3]
          Length = 457

 Score = 43.5 bits (101), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 91/402 (22%), Positives = 161/402 (40%), Gaps = 68/402 (16%)

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQ--------KI 148
            NS +  +  L  SL S  +  +E    + V++ A  + Q FN+ +  V         +I
Sbjct: 99  GNSISAGLDLLFASLNSAMEQPNEIAYRQGVLNEARAISQRFNSISEGVSSQITQVEGQI 158

Query: 149 RADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIS 208
            A A KEI  ++ ++ +F +E+   N       A+ +     LD RD  +  +SEI+ + 
Sbjct: 159 GASA-KEINAQLDSIAKFNAEIQAAN-------ANGNVPLALLDARDAAIDDLSEIVDVK 210

Query: 209 TIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV 267
            +  +N  + +  + G  L   T    I             +NP F   + +   Q S  
Sbjct: 211 VVEESNGLVNISLAQGQPLLAGTTASKIQVSP-------DPANPQFSQ-ISIQFGQ-SNF 261

Query: 268 P-----KGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADG 322
           P      G + AL+  RD+ +      +DE+A  +   F+                +A G
Sbjct: 262 PLDEKAGGSLGALIDYRDNSLVDSMAFIDELAMTMADEFNA--------------VLAGG 307

Query: 323 IKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLA----GYPDL---I 375
                N   Q   +    +P   SNP+     GS+     +N   LA    G P     +
Sbjct: 308 TDLNGNPPTQ---DLFSYDP---SNPA-----GSMKITAGFNADMLAFGKDGTPGDNSNL 356

Query: 376 NHYCDSFNKNFIFDPVAGINTNVT-LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISE 434
               +  N +F F+ + G++T +          +G   +    + D  +K Q+       
Sbjct: 357 KDLVELANASFTFNSL-GVDTTMGDAFASKVGELGSASRQAQMAEDTAVKLQM---EAQS 412

Query: 435 SYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +++T GVN+ EE + LI  +QSY  + K+I   D++ QT+L
Sbjct: 413 QWASTSGVNMDEEGTNLIIYQQSYQANAKVISTADQLFQTIL 454


>gi|15639647|ref|NP_219097.1| flagellar hook-associated protein FlgK [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189025885|ref|YP_001933657.1| flagellar hook-associated protein FlgK [Treponema pallidum subsp.
           pallidum SS14]
 gi|3322960|gb|AAC65634.1| flagellar hook-associated protein 1 (flgK) [Treponema pallidum
           subsp. pallidum str. Nichols]
 gi|189018460|gb|ACD71078.1| flagellar hook-associated protein 1 [Treponema pallidum subsp.
           pallidum SS14]
 gi|291060027|gb|ADD72762.1| flagellar hook-associated protein FlgK [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 625

 Score = 43.5 bits (101), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 79/171 (46%), Gaps = 8/171 (4%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + V+  A+ +    +   R +  IR   + +IE  +  +   L+++  +N+ I    A  
Sbjct: 141 QVVLTRAQTLTDAIHHQYRGLVGIRDMLNADIEATVEQVNDLLAKIAQLNEQIVKSKAMG 200

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
            + +D LD+RD L++ ++  I +   VR+ ++  V  S G  +       +  +   +  
Sbjct: 201 DNPNDLLDRRDTLVESLAHRIEVRVDVRDEDESYVIHSAGLEV-------VQGKSYKTLG 253

Query: 245 VTSESNP-IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
           + S + P  ++  V   S   +    GK+ AL+++RD+ V     +LD MA
Sbjct: 254 LVSGTTPEGYVSVVWKDSGDRAHFSGGKLAALIELRDTDVRDELRKLDTMA 304



 Score = 38.5 bits (88), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 68/167 (40%), Gaps = 24/167 (14%)

Query: 320 ADGIKDLDNKLCQGISETICVNPQYRS-NPSFLRDGGSVSKKFLWNVKNLAGYP--DLIN 376
           AD I  LD    Q     I     +   NP+ L D  SV+          AGYP  + + 
Sbjct: 468 ADAIAALDQAGAQHAVSPIAHPAGWMELNPAVLSDVYSVA----------AGYPSAEGLP 517

Query: 377 HYCDSFNKNFIFD----PVAGINTNVTLLEY---ARNSIGWLEKNRSDSHDLHMKSQVVF 429
           H  D+     I      PV  I    T  E+      +IG   +    S  +H     + 
Sbjct: 518 HAGDNRAALAIASLRNSPVM-IGNRHTFDEFFAEVTTAIGLKGEQAERSMQMHA---AIL 573

Query: 430 NHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
             +++    T GVN+ EEL+ +IK +  YN S + I   ++ML T++
Sbjct: 574 KELTDMRDATSGVNIDEELADIIKFQHGYNASARFIAAVNEMLDTVI 620


>gi|114565761|ref|YP_752915.1| flagellar hook-associated protein-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114336696|gb|ABI67544.1| Flagellar hook-associated protein-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 838

 Score = 43.5 bits (101), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 27  NIENADNKNYVRR-DTMTTISP------ENVTVVTQR------SENKNMFDKVLHAHSSA 73
           NI NA+   + R+  ++ T SP       N   V Q       ++ K + D+ L   S  
Sbjct: 27  NIANANTPGFARQAPSIVTTSPFHAPMLNNANRVGQLGTGVDIAQVKRIRDEFLD--SQI 84

Query: 74  IGQQRLLQSFEALKEMMSADDHYNNSPTH-----YISKLRDSLESYSKNLSEDILGKTVI 128
             + R+   +++++E +   +   N P+       +    ++ +  S N   + +   V+
Sbjct: 85  RNETRVSGYWQSMQETLDRVEAILNEPSEDGLRGVMDMFWEAWQDLSLNPESESVRSVVV 144

Query: 129 DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAH 188
                + + FN +  ++Q +R D + +I+++  ++     ++  +N  I   + +    +
Sbjct: 145 QRGMALAEAFNHTYSQLQDLRVDVNDQIKIKAHDVNSIAQQIAALNRQIAAVSCAGKQPN 204

Query: 189 DFLDQRDVLLQKISEIIGISTIVRNNNDMVV 219
           D  D+RD+L++++SEI  +  I  + NDMV 
Sbjct: 205 DLKDKRDLLVEQLSEIAEVR-IYNDKNDMVA 234


>gi|261420582|ref|YP_003254264.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC61]
 gi|319768252|ref|YP_004133753.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC52]
 gi|261377039|gb|ACX79782.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC61]
 gi|317113118|gb|ADU95610.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC52]
          Length = 531

 Score = 43.5 bits (101), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 104/525 (19%), Positives = 203/525 (38%), Gaps = 78/525 (14%)

Query: 18  SQQFA--SIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHS---- 71
           +QQ A  +   NI NA+ + Y R+      +P   T    R          + A S    
Sbjct: 17  AQQAALYTTSHNIANANTEGYTRQRVQLQPTPPFPTPGLNRPNIPGQMGTGVEASSVERV 76

Query: 72  -------SAIGQQRLLQSFEALKEMMSADDHYNNSPT-HYISKLRDSLESYSKNLS---E 120
                     G+   L  +EA  + +S  +   N P+   ++K  D      ++LS   E
Sbjct: 77  REYFLDIQYRGENSKLGYWEARADAVSKMEDIMNEPSDSGLAKTMDQFWQALQDLSTHPE 136

Query: 121 DILGKTVI-DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +   ++V+      VV+ F+  +  + +IR D   +I   ++ +   L++++ +N+ I  
Sbjct: 137 NEGARSVVRQRGLAVVETFHYLSNSLAQIRTDIGTQIGTTVTEINSLLNQISALNERIAE 196

Query: 180 KTASKHDAHDFLDQRDVLLQKISEI--IGISTIVRNNNDMV-------VYTSDGTTLFET 230
              + +  +D  D+RD L+ ++S+   IG+       N +        VY  +G+     
Sbjct: 197 IEPNGYLPNDLYDERDRLVDQLSQYMEIGVEKHPTGGNALPMAEGTYDVYVMNGSAKVYL 256

Query: 231 V------------PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ- 277
           V              D++ + +      S  N + I    VS    S++P GK++ L++ 
Sbjct: 257 VQGRNAASVSFPDGSDVDGDGVKEMPPASGVNALNIGITAVSF---SSLPNGKLRGLIEG 313

Query: 278 -------------IRDSVVPIFQNQLDEMARVLIGSFS--EKDPIAGNSENVPGLFIADG 322
                        I   + P   + LD++A      F+   +     N       F  DG
Sbjct: 314 YGYQTGTDASGQPIVKGLYPDMLSNLDKLAYTFGTVFNAVHQQGYGLNGSTKRPFF--DG 371

Query: 323 IKDLDN-----KLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
           I  +       KL   I +   +    +S  +    G   +   L NV++L     L+++
Sbjct: 372 IGAVSGAAKTIKLAADIDDLANIAASTKSGET----GNGNNAINLANVRSL-----LLSN 422

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD---LHMKSQVVFNHISE 434
              S       + +A +N  ++      N  GW+ +   D      +   S+ +   + E
Sbjct: 423 ATVSLQDGISVN-LASLNLPLSSGTVETNYQGWIGQLGVDGEQANRMKTNSETLRQSVEE 481

Query: 435 SYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
              +   V+L EE+  ++K + +YN + + I   D+ML  L+ G+
Sbjct: 482 KRQSVSSVSLDEEMMNMVKFQHAYNAAARQITVIDEMLDKLINGM 526


>gi|197285504|ref|YP_002151376.1| flagellar hook-associated protein 1 [Proteus mirabilis HI4320]
 gi|194682991|emb|CAR43432.1| flagellar hook-associated protein 1 [Proteus mirabilis HI4320]
          Length = 547

 Score = 43.5 bits (101), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 95/204 (46%), Gaps = 17/204 (8%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           SL + + N  ++    T++  AE +V  FN + + ++ +  D + ++     N+  +  +
Sbjct: 117 SLPNVTNNAEDNPARTTILGKAEAMVNMFNKADQSLRDLEKDINSQVTNTTKNINEYSKQ 176

Query: 170 LTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL- 227
           +  +N  I + +  +  + +D LDQRD L+Q+++ ++ +    ++   + V  ++G  L 
Sbjct: 177 IAKLNQEISRSQGFNGAEPNDLLDQRDRLIQELNTLVDVQVTQQDGGFVNVSFANGLPLV 236

Query: 228 -------FETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
                     +P   N E++    V   SN I      V       +  G++    + R+
Sbjct: 237 AGTRSYEVSAIPSSKNSERL----VVGYSNGID----EVREVDAKRINGGELGGAYRSRN 288

Query: 281 SVVPIFQNQLDEMARVLIGSFSEK 304
            V+   +NQL+++A VL   F+++
Sbjct: 289 EVLDASRNQLNQLALVLGDQFNKQ 312


>gi|324113877|gb|EGC07851.1| flagellar hook protein FlgK [Escherichia fergusonii B253]
          Length = 548

 Score = 43.5 bits (101), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 106/234 (45%), Gaps = 28/234 (11%)

Query: 88  EMMSADDHYNNSPTHYIS----KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           E MS  D+  +S T+ +S        SL++   N  +    + +I  A+ +V  F T+  
Sbjct: 90  EQMSKIDNLLSSETNNVSTSLQGFFTSLQTLVSNAEDPAARQALIGKADGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  +D LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNDLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++++G+   V++     +  ++G +L + +  R +         V S ++P  +  
Sbjct: 206 VSELNKVVGVEVSVQDGGTYNITMANGYSLVQGSSARQL-------AAVPSHADPFRVTV 258

Query: 257 VVVSSNQGS-AVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             V +  G   +P+     G +  +L  R   +   +N L ++A     +F+++
Sbjct: 259 AYVDATAGEIEIPEKLLTSGTLGGMLTFRSQDLDQSRNTLGQLALAFADAFNKQ 312


>gi|188534164|ref|YP_001907961.1| flagellar hook-associated protein FlgK [Erwinia tasmaniensis
           Et1/99]
 gi|188029206|emb|CAO97078.1| Flagellar hook-filament junction protein 1 [Erwinia tasmaniensis
           Et1/99]
          Length = 551

 Score = 43.5 bits (101), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 38/320 (11%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRS--ENKNMF 63
           + N A    N AS    +   NI N     Y R+   TT+  +N + ++  +   N    
Sbjct: 4   LINTAMTGLNAASAALNTTSNNITNYAVTGYSRQ---TTVLAQNSSTLSGSNYYGNGASV 60

Query: 64  DKVLHAHSSAIGQQRLLQSFEA------LKEMMSADDHYNNSPTHYISKLRD---SLESY 114
             V   +   I +Q L  S ++        +M + DD  + +     + ++D   SL++ 
Sbjct: 61  SNVYREYDQFISKQLLAASTQSSAISTQAGQMSNIDDMLSGTTNTLSTNIQDFFKSLQTL 120

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           S N  +    + V+  AE +V     +   +  +    +  ++  +  +  +  ++  VN
Sbjct: 121 SSNAGDSSSRQAVLGKAEGLVNQLKVTDTYLTNLDNSLNVSVKSTVDQVNNYAKQIANVN 180

Query: 175 DAI-KFK-TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
             I K K   + ++ +D LDQRD L+ ++++++G++          V   DG +   +V 
Sbjct: 181 QQITKLKGVGAGNEPNDLLDQRDQLVSQLNKLVGVN----------VSQQDGGSFNISVG 230

Query: 233 RDINFEKMNSY----TVTSESNPIFIDGVVVSSNQG-------SAVPKGKIKALLQIRDS 281
             I+  + +SY     V S ++P       V S  G       S V  G +  LL  R  
Sbjct: 231 NGISLVQGDSYNQLAAVPSSADPGRTTIASVDSVTGAKTELPESLVTTGSLGGLLAFRKD 290

Query: 282 VVPIFQNQLDEMARVLIGSF 301
           +  + +NQ+ ++A  L  SF
Sbjct: 291 LDGV-RNQVGQLALALGSSF 309


>gi|152990394|ref|YP_001356116.1| flagellar hook-associated protein 1 FliK [Nitratiruptor sp.
           SB155-2]
 gi|151422255|dbj|BAF69759.1| flagellar hook-associated protein 1 FliK [Nitratiruptor sp.
           SB155-2]
          Length = 596

 Score = 43.5 bits (101), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 37/53 (69%)

Query: 425 SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           + ++FN ++E   +  GVNL EEL  L ++++SY  + +++M TD++ +TL+E
Sbjct: 541 TTLLFNTLNEKIEDISGVNLDEELVKLTQLQRSYQATARVMMVTDELFKTLIE 593



 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 154 KEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRN 213
           +E  ++I+NL R +++L   N  IK+    +   + +LDQRD  ++K+S +I I  +   
Sbjct: 165 RETVMQINNLARRITDL---NKNIKYFANDQTKLNSYLDQRDQAIKKLSSLIDIKVLYHQ 221

Query: 214 NNDMVVYTSDGTTL 227
           NN + + T+ G  L
Sbjct: 222 NNTVDISTAKGHML 235


>gi|253990121|ref|YP_003041477.1| flagellar hook-associated protein FlgK [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781571|emb|CAQ84734.1| flagellar hook-associated protein 1 flgK [Photorhabdus asymbiotica]
          Length = 547

 Score = 43.5 bits (101), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 103/212 (48%), Gaps = 11/212 (5%)

Query: 98  NSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIE 157
           N+ ++ I     SL++   N  +D    T I  A+ ++    ++   ++K+  + ++ I 
Sbjct: 105 NNLSNTIDDFFTSLQNVVSNAEDDAARTTTIGKAKGLMNQLKSADTFLRKMENNINRGIA 164

Query: 158 LEISNLRRFLSELTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND 216
               ++  +  ++  +N  I + +     + +  LDQRD L+ ++++++G+S   ++ + 
Sbjct: 165 NSADDINNYAQQIAKLNGEITRMRGGGSAEPNSLLDQRDQLVNELNKLVGVSVTQQDGDT 224

Query: 217 MVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFID-----GVVVSSNQGSAVPKGK 271
             V  + G TL +         ++ + +  ++S+ I +      G VV  ++   + KG+
Sbjct: 225 YNVTFAGGLTLVQGTTA----YRVEAISSNADSSRITLGYDRGFGDVVEIDE-RHIDKGE 279

Query: 272 IKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
           +   L+ R  V+   +NQL+++A VL   F++
Sbjct: 280 LSGTLRARSEVLDNSRNQLNQLALVLGDQFNQ 311


>gi|51246541|ref|YP_066425.1| flagellar hook-associated protein 1 (FlgK) [Desulfotalea
           psychrophila LSv54]
 gi|50877578|emb|CAG37418.1| related to Flagellar hook-associated protein 1 (FlgK) [Desulfotalea
           psychrophila LSv54]
          Length = 480

 Score = 43.5 bits (101), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 88/205 (42%), Gaps = 15/205 (7%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I    DS +  S   ++ +L    +     +   FN SA E+ +++ +   +++  +S +
Sbjct: 113 IDHFFDSWQELSTKPTDVVLRDITLQKGSVLAAKFNNSANELDQVQKNIGAQLKSGVSEV 172

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              L +L  +ND I     +   A+   D R+ LLQ++++ IG  +          Y   
Sbjct: 173 NNKLKQLGELNDRIYQIENNGQTANGARDSRESLLQELAQTIGAQS----------YELS 222

Query: 224 GTTLFETVPRDINFEKMNSYTV--TSESNP---IFIDGVVVSSNQGSAVPKGKIKALLQI 278
              +   +P  +     NS +   T ++ P   + +     +   G+    G+   LL +
Sbjct: 223 SGMVNVQLPSGLPLVNGNSASTIETVQNGPTVGLKLHTTGATRELGTKSMGGEFAGLLDL 282

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSE 303
           +D V+P  ++ L+++A  LI   +E
Sbjct: 283 QDEVIPALEDNLNQLAYSLITKVNE 307


>gi|302343763|ref|YP_003808292.1| flagellar hook-associated protein FlgK [Desulfarculus baarsii DSM
           2075]
 gi|301640376|gb|ADK85698.1| flagellar hook-associated protein FlgK [Desulfarculus baarsii DSM
           2075]
          Length = 574

 Score = 43.1 bits (100), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 52/87 (59%), Gaps = 4/87 (4%)

Query: 394 INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIK 453
           +  N +L+ +A  S+G    N +DS+    ++     ++ +S S   GV+L EE+  +I+
Sbjct: 492 VTYNESLISWAA-SLGTTISNATDSYSFATETTSSLENLRDSMS---GVSLDEEMVRMIQ 547

Query: 454 VEQSYNISNKLIMFTDKMLQTLLEGVK 480
            ++SY ++ ++I  +D++LQTL+  VK
Sbjct: 548 FQRSYQMAAQMIQVSDELLQTLIGIVK 574



 Score = 40.8 bits (94), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 93/205 (45%), Gaps = 17/205 (8%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I+ L ++ +  S N     +  ++ + A  + Q F + A ++  ++ D D  ++  +S  
Sbjct: 114 ITSLFNAWQDLSNNPESSAVRASLQETASNMAQRFQSVANDMLSVQRDIDGYLKDAVSQA 173

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
                 +  +N  I+    S H A+D+ D+R   L +++ ++ IS    +   + V TS 
Sbjct: 174 NLICRTIADLNLKIQQSEVSGHSANDYRDERQRQLNELAGLMNISWYEDSTGAVNVQTSS 233

Query: 224 GTTLFET------VPRDINFEKM--NSYTVTSESNPIFI--DGVVVSSNQGSAVPKGKIK 273
           G +L +        P  + FE+   + Y    E N +     G+V+   +   +  G I 
Sbjct: 234 GKSLVQVNYPGDNDPDPLAFEERLGDGY----EHNQLVWTSGGLVMDYTE---ITGGSIG 286

Query: 274 ALLQIRDSVVPIFQNQLDEMARVLI 298
           A L +RD+ +    + ++++A+ +I
Sbjct: 287 AWLDVRDNQIEDMLDYMNDLAKTII 311


>gi|157146220|ref|YP_001453539.1| flagellar hook-associated protein FlgK [Citrobacter koseri ATCC
           BAA-895]
 gi|157083425|gb|ABV13103.1| hypothetical protein CKO_01977 [Citrobacter koseri ATCC BAA-895]
          Length = 544

 Score = 43.1 bits (100), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 96/208 (46%), Gaps = 24/208 (11%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN----LRR 165
           SL++   N  +    + +I  A+ +V  F T+    Q +R D DK++ + I +    +  
Sbjct: 116 SLQTLVSNAEDPAARQALIGKADGLVNQFKTTD---QYLR-DQDKQVNIAIGSSVEQINN 171

Query: 166 FLSELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
           +  ++  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     +  ++
Sbjct: 172 YAKQIASLNDQISRLTGVGAGASPNDLLDQRDQLVSELNQIVGVEVSVQDGGTYNLTMAN 231

Query: 224 GTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPK-----GKIKALL 276
           G TL + +  R +         V S ++P       V +  G+  +P+     G +  LL
Sbjct: 232 GYTLVQGSSARQL-------AAVPSSADPSRTTVAYVDATAGNIEIPEKLLNSGSLGGLL 284

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             R   +   +N L+++A     +F+ +
Sbjct: 285 TFRSQDLDQTRNTLNQLALAFAEAFNAQ 312


>gi|114330367|ref|YP_746589.1| flagellar hook-associated protein FlgK [Nitrosomonas eutropha C91]
 gi|114307381|gb|ABI58624.1| flagellar hook-associated protein FlgK [Nitrosomonas eutropha C91]
          Length = 467

 Score = 43.1 bits (100), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 87/427 (20%), Positives = 178/427 (41%), Gaps = 67/427 (15%)

Query: 81  QSFEALKEMMSADDHYN------NSPTHYISKLRDSLESYSKNLSEDILG--------KT 126
           QS +A  +    D HYN      N      S L  +L ++  N  +D+          + 
Sbjct: 75  QSLQAQGQSSQLDSHYNEIKQIDNLLADTTSGLTPALHNF-FNAVQDVASNPTSIPSRQA 133

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF--KTASK 184
           ++ NAE +V  F +  + + ++R   + +I   ++ +     ++  +N  I+    +A+ 
Sbjct: 134 MLSNAEALVSRFQSMDQRLSEMREGVNSQIASSVNEINSLAQQVVRLNTNIQAVEGSANS 193

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
             A+D  DQRD L++ +S++  +  + ++N    V+  +G +L       +    M    
Sbjct: 194 QPANDLYDQRDALIRDLSKLANVDVVRQSNGHYNVFIGNGQSLV------VGTSAMALKA 247

Query: 245 VTSESNPIFIDGVVVSSNQGSA---VPK-----GKIKALLQIRDSVVPIFQNQLDEMARV 296
           V S S+P     +VV+ + G     +P+     G +  LL  R   +   Q   +++A+ 
Sbjct: 248 VPSSSDP---QRLVVAMDVGDKEILLPEHQLQGGSLGGLLAFRSETLDAIQTDFNQLAKG 304

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           L  +F+++  +        GL       DL   + +   E    N   RS    + D   
Sbjct: 305 LADTFNDRHTL--------GL-------DLQGTVGKNFFEVTDSNHVARSIEVAISDPAE 349

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL----LEYARNSIGWLE 412
           ++        N  G  D  +   D  N+N +   +A + T  TL      Y       + 
Sbjct: 350 IAAAL-----NDGGSFD--DRVAD--NRNAL--QLAKLQTTNTLQGGTASYQSAYASLVS 398

Query: 413 KNRSDSHDLHMKSQV---VFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
           +  + + +L + SQ    +     ++  +  GVNL+EE + L++ ++ +  S+K+I  ++
Sbjct: 399 QVGNKTRELEVTSQAQESLLAQTDQAIQSLSGVNLEEEAANLLRYQRMFQASSKVIEISN 458

Query: 470 KMLQTLL 476
            +  +LL
Sbjct: 459 SLFDSLL 465


>gi|312622116|ref|YP_004023729.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202583|gb|ADQ45910.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 525

 Score = 43.1 bits (100), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 76/423 (17%), Positives = 166/423 (39%), Gaps = 72/423 (17%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           I +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +
Sbjct: 117 IDQFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEI 176

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + 
Sbjct: 177 NSIASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAG 236

Query: 224 GTTL--------FET----VPRDINFEKMNSYTVTSESNPIF------IDGVVV----SS 261
           G TL         ET    + R   F+     T  +  +P+       + G+ V     +
Sbjct: 237 GETLVNHFTVYELETDKSKIMRKSGFDSSGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDT 296

Query: 262 NQGSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVL 297
            Q   +  G++K LL +RD V                        +P + N+L+E A+ L
Sbjct: 297 GQVLNIKSGELKGLLDMRDGVGGLDEDMVVNGQPVDVPNKNYFTGIPYYLNRLNEFAQKL 356

Query: 298 IGSFSEKD----PIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           I  F+E       + G + N+             N     + +T       + + + + D
Sbjct: 357 IEKFNELHTQGWSLNGQNTNI-------------NFFEPPVGQTFFYARYIKVSDAVMND 403

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
             +++    ++  +L G  DL+       N N +F             ++ ++ I  L  
Sbjct: 404 LNNIATT--YDASSLPGGNDLVVDMLKLRNDNSVF-------KEGKFEDFLKSLISNLGV 454

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           +   + +     +V+   +        GV++ EE++ LI+ +  +  S ++I   D+ML 
Sbjct: 455 DSQGAKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIRYQHGFQASARMINAFDEMLD 514

Query: 474 TLL 476
            ++
Sbjct: 515 VIV 517


>gi|167576668|ref|ZP_02369542.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           TXDOH]
          Length = 452

 Score = 43.1 bits (100), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 104/251 (41%), Gaps = 19/251 (7%)

Query: 17  ASQQFASIVRNIENADNKNYVRRDTM-TTISPENVTVVTQRSENKNMFDKVLHAHSSAIG 75
           ASQ   +  +N+ N+ N  Y RR  + +T     V        N++   + L       G
Sbjct: 14  ASQSLLATSQNMANSANNEYSRRGVLLSTGLTGGVDASGLLRLNESYKTQQLWQAGGQYG 73

Query: 76  QQRLLQS-FEALKEMMSAD--DHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAE 132
           +    QS F+ L+ +   +  D    +      K   +LE+ S N  + +L   VI+ A 
Sbjct: 74  RYNAAQSYFDQLEALFGGNPVDGKTKANDLGFGKFIGALEAASGNPGDSVLRNGVINAAN 133

Query: 133 EVVQNFNTSAREV--QKIRADADKEIEL--EISNLRRFLSELTVVNDAIKFKTASKHDAH 188
            + + FN + R V   ++R+   + +     ++ L + ++EL   N  I     S  D  
Sbjct: 134 TMTKQFN-NMRSVLTNQLRSIEQQRVTTVERVNGLAKTVAEL---NGKIAAGQGSGADVS 189

Query: 189 DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET-------VPRDINFEKMN 241
             +DQRD  +  +S + G+  + + N  + V  ++G  L          + RD   ++  
Sbjct: 190 ALMDQRDAAVDDLSRVAGVRVVQQANGTVDVSMTNGQPLVVGAQAGRIELGRDAAGQQTL 249

Query: 242 SYTVTSESNPI 252
           S    S++ P+
Sbjct: 250 SLAFGSQTMPL 260


>gi|33592485|ref|NP_880129.1| flagellar hook-associated protein FlgK [Bordetella pertussis Tohama
           I]
 gi|33572131|emb|CAE41673.1| flagellar hook-associated protein 1 [Bordetella pertussis Tohama I]
 gi|332381902|gb|AEE66749.1| flagellar hook-associated protein FlgK [Bordetella pertussis CS]
          Length = 548

 Score = 43.1 bits (100), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 88/193 (45%), Gaps = 19/193 (9%)

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF- 179
           D++GK     A  +V   NT+ +E++  R   + +I   +     +L  +  +N  I   
Sbjct: 131 DMIGK-----ANSLVTQINTAYQELENQRNGLNTQISTTVEQANSYLERINDLNKKIVIA 185

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD-----GTTLF--ETVP 232
           +    H  +D LDQRD  + +++++ GI    + +   +   S      GTT++  + VP
Sbjct: 186 RGKDGHAPNDLLDQRDQAVSELNQLTGIRFYEQGDAFNITLQSGQTLLSGTTVYPLQAVP 245

Query: 233 RDINFEKMN-SYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
              + +++  +YT+ S         + V  N  S V  G++  LL  R   +   Q+QL 
Sbjct: 246 SASDPKRLTVAYTLPSGPGTT----IQVEMND-SEVTGGQLGGLLSFRSQSLDAVQDQLG 300

Query: 292 EMARVLIGSFSEK 304
           ++A  L  +F+ +
Sbjct: 301 QLAIGLAMAFNAQ 313


>gi|283833624|ref|ZP_06353365.1| flagellar hook-associated protein FlgK [Citrobacter youngae ATCC
           29220]
 gi|291071307|gb|EFE09416.1| flagellar hook-associated protein FlgK [Citrobacter youngae ATCC
           29220]
          Length = 550

 Score = 43.1 bits (100), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 91/204 (44%), Gaps = 22/204 (10%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           SL++   N  +    + +I  A+ +V  F T+ + ++      +  I+  +  +  +  +
Sbjct: 116 SLQTLVSNAEDPAARQALIGKADGLVNQFRTTDQYLRDQDKQVNTAIKASVDQINNYSKQ 175

Query: 170 LTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
           +  +ND I   T     A  +D LDQRD L+ ++++I+G+   V++     V  ++G +L
Sbjct: 176 IASLNDQISRLTGVGAGASPNDLLDQRDQLVSELNQIVGVEVSVQDGGTYNVTMANGYSL 235

Query: 228 FETVPRDINFEKMNSYTVTSESNP-----IFIDGVVVSSNQGSAVPK-----GKIKALLQ 277
            +      N  ++ +  V S  +P      ++DGV  +      +P+     G +  LL 
Sbjct: 236 VQGS----NARQLAA--VPSSDDPSRTTVAYVDGVAGAVE----IPEKLLNTGSLGGLLT 285

Query: 278 IRDSVVPIFQNQLDEMARVLIGSF 301
            R   +   +N L ++A     +F
Sbjct: 286 FRSQELDQTRNTLGQLALAFADAF 309


>gi|295697521|ref|YP_003590759.1| flagellar hook-associated protein FlgK [Bacillus tusciae DSM 2912]
 gi|295413123|gb|ADG07615.1| flagellar hook-associated protein FlgK [Bacillus tusciae DSM 2912]
          Length = 540

 Score = 43.1 bits (100), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%)

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           TN TL +Y +  IG L     ++       +V+   +     +  GV++ EE++ +I+ +
Sbjct: 452 TNGTLDDYFQAVIGGLGVQSQEAERQVANQEVLVQQLDGKRQSVAGVSIDEEMANMIRFQ 511

Query: 456 QSYNISNKLIMFTDKMLQTLLEG 478
           Q+Y  S +++   D+ML  L+ G
Sbjct: 512 QAYGASARMVTAIDQMLDKLING 534


>gi|219670203|ref|YP_002460638.1| flagellar hook-associated protein FlgK [Desulfitobacterium
           hafniense DCB-2]
 gi|219540463|gb|ACL22202.1| flagellar hook-associated protein FlgK [Desulfitobacterium
           hafniense DCB-2]
          Length = 583

 Score = 43.1 bits (100), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           V+  H+     + VGVN+ EE++ LIK ++SY  + +++   D ML T++ G+
Sbjct: 527 VLVTHMYNQRQSVVGVNMDEEITNLIKFQKSYTAAARIVTMLDSMLDTIVNGM 579


>gi|317153838|ref|YP_004121886.1| flagellar hook-associated protein FlgK [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944089|gb|ADU63140.1| flagellar hook-associated protein FlgK [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 711

 Score = 43.1 bits (100), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 29/45 (64%)

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           ++E      GVNL EE+S LI+ + SY  + KLI   D+MLQT+L
Sbjct: 663 LNERQQQVAGVNLDEEMSNLIRYQASYTAAAKLITTADQMLQTIL 707


>gi|121997313|ref|YP_001002100.1| flagellar hook-associated protein FlgK [Halorhodospira halophila
           SL1]
 gi|121588718|gb|ABM61298.1| flagellar hook-associated protein FlgK [Halorhodospira halophila
           SL1]
          Length = 685

 Score = 43.1 bits (100), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 100/219 (45%), Gaps = 15/219 (6%)

Query: 92  ADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRAD 151
           AD     SP+  + +  D++E  + + S  +  + ++   + +   F+T    +  +  D
Sbjct: 100 ADQDAGLSPS--LRQFFDAVEEVANDPSNTVSRQQLLTQGQALADRFHTLDNRLLTLEED 157

Query: 152 ADKEIELEISNLRRFLSELTVVNDAIKFK-TASKHDAHDFLDQRDVLLQKISEIIGISTI 210
            +K +  E   +      +  +N  I+ + T  +   +D LDQRD  ++++SE + +   
Sbjct: 158 VNKRVRAEADKINGLAESIAELNGEIRSRWTNPQRPPNDLLDQRDEKIRQLSEHVTVRVT 217

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSES-NPIFIDGVVVSSNQ----GS 265
            +++  + V   +G  L       +  ++ N+  VT  + +P   +  V   ++     S
Sbjct: 218 EQDDRSLNVGIGNGQPL-------VTGDRANTLEVTRNAFDPERPELAVRRGDREVQITS 270

Query: 266 AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
           AV  G +  LL+ R+ V+   ++++  +A  L G+ +E+
Sbjct: 271 AVQGGSLGGLLEFRNGVLDETRDEIGRVATSLAGAMNEQ 309


>gi|254445805|ref|ZP_05059281.1| flagellar hook-associated protein FlgK [Verrucomicrobiae bacterium
           DG1235]
 gi|198260113|gb|EDY84421.1| flagellar hook-associated protein FlgK [Verrucomicrobiae bacterium
           DG1235]
          Length = 486

 Score = 43.1 bits (100), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 94/225 (41%), Gaps = 34/225 (15%)

Query: 91  SADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA 150
           +AD   +      ++   ++  S S N   D   ++++  AE + +  N ++     +R 
Sbjct: 121 TADGGGSGGIAETLNNFFNAFHSLSANPGSDAEKESLLQKAEILTEKLNVTSERFSDLRE 180

Query: 151 DADKEIELEISNLRRFLSELTVVNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGIST 209
               E+E ++ +  + + E+  +N  I + +++    A    DQR  +L+ +SEI+ I T
Sbjct: 181 ALTLEVETDLDSANQMIEEIATLNAEIARAESSHAGQALSLRDQRQAVLRDLSEIMQIKT 240

Query: 210 --IVRNNNDMVVY----TSDGTTL-------FETVPRDINFEKMNSYTVTSESNPIFI-- 254
             I  +   + VY      D   L       F+TV  D            S  NP+F   
Sbjct: 241 ENIDDSAGQIRVYIPTIGGDSPQLDLVSRGRFQTVDLD-----------DSGVNPVFTVG 289

Query: 255 -DGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
            D + +       V  G +   L+ RD  +  +Q  LD++A+ L+
Sbjct: 290 EDAIQID------VRGGSVHGALKSRDGAIAEYQRGLDDLAKELV 328


>gi|323498414|ref|ZP_08103410.1| flagellar hook-associated protein FlgK [Vibrio sinaloensis DSM
           21326]
 gi|323316487|gb|EGA69502.1| flagellar hook-associated protein FlgK [Vibrio sinaloensis DSM
           21326]
          Length = 624

 Score = 43.1 bits (100), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 78/171 (45%), Gaps = 6/171 (3%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           K V++ +  + QN N     +++     +K+++L +  + +   E+  ++  +  +T   
Sbjct: 133 KVVLEKSTLITQNLNDFHETIRRQSDVTNKKLDLGVERINQLALEIRDLH-RLMMRTPGP 191

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMV-VYTSDGTTLFETVPRDINFEKMNSY 243
           H+  D +DQ + L+ ++SE   ++   R N +   V+  +G TL            +  Y
Sbjct: 192 HN--DLMDQHEKLVNELSEYTKVTVTPRKNAEGFNVHIGNGHTLVSGTEAS-KLTMIGGY 248

Query: 244 TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
               E     I+G  + +     +  GK+ A+L +RD  +P   +QL +MA
Sbjct: 249 PDVHERRLAMIEGKGIKAITSKDI-DGKLGAMLTMRDEKIPQLMDQLGKMA 298


>gi|238916199|ref|YP_002929716.1| flagellar hook-associated protein 1 FlgK [Eubacterium eligens ATCC
           27750]
 gi|238871559|gb|ACR71269.1| flagellar hook-associated protein 1 FlgK [Eubacterium eligens ATCC
           27750]
          Length = 523

 Score = 43.1 bits (100), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 47/82 (57%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           +I+NA+ +   FNT +  ++ ++ DA+ EI+  +  +      ++ +N  I    A+  +
Sbjct: 139 LINNAKSLTDYFNTLSTNLRNVQVDANNEIKDAVQQINSLAQNISSLNKQINQIQANYGN 198

Query: 187 AHDFLDQRDVLLQKISEIIGIS 208
           A+D  DQR+ L+  +S+I+ I+
Sbjct: 199 ANDLKDQRNALIDDLSQIVNIT 220


>gi|78358192|ref|YP_389641.1| flagellar hook-associated protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220597|gb|ABB39946.1| Flagellar hook-associated protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 696

 Score = 43.1 bits (100), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           +S    +  GVNL EE+S L+K + SY  + KL+   D+MLQ LL G+K
Sbjct: 648 LSARQDSVAGVNLDEEMSSLVKFQHSYKAAAKLVTTADEMLQVLL-GLK 695


>gi|116626183|ref|YP_828339.1| flagellar hook-associated protein FlgK [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229345|gb|ABJ88054.1| flagellar hook-associated protein FlgK [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 475

 Score = 43.1 bits (100), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 99/504 (19%), Positives = 201/504 (39%), Gaps = 59/504 (11%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP--------ENVTVVT 54
           LLA    + N      +   +   N+ NA    Y ++       P          V   T
Sbjct: 4   LLASLVSSANTLQAYGRVLEATQNNVSNASTPGYAKQSIELYALPFDPQGGATGGVRAGT 63

Query: 55  QRSENKNMFDKVLHAHSSAIG-QQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
            +S      ++ +   ++ +G QQ+L  S   L+     D   N      ++ L  S  +
Sbjct: 64  LQSARNEYAEQAVRNQTTGLGYQQQLADSLTVLQTNF--DITGNQGIPQALNSLLQSFSA 121

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
           +  +  +    +TV+  A+ + Q FN +A  V  +  D ++++   +  + + + +L   
Sbjct: 122 WGASPDDPSARQTVLQRADALAQAFNQTANSVSSVSRDTERQVGDTVGQINQLVGQLKGY 181

Query: 174 ND-AIKFKTASKHDAHDFLDQR-DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           N  A++    +K+DA   L  R    L+++S +  +  +  ++  + +     T L    
Sbjct: 182 NQLALQ---GNKNDAG--LSARVHSALEQLSSLADVQAVFIDDGSVSLTIGGQTPLLIG- 235

Query: 232 PRDINFEKMNSYTVTSE---SNPIFIDGVVVSSNQGSAV--PKGKIKALLQIRDSVVPIF 286
             D  +    S  V +E   +NP+    + + ++ GS +    G++ AL+++R+ V+P  
Sbjct: 236 --DQQYAISASLYVPAEPPATNPLGAGQMRLQASDGSDISNAGGQLGALVKLRNDVMPSL 293

Query: 287 ------QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV 340
                    L+ MA+      ++       +   PG+ I     D    +   I     V
Sbjct: 294 IGDRYQTGDLNLMAKQFADRVNQLLTGGSTTAGQPGVAIFQYNPDDPTSIASAIKVDTSV 353

Query: 341 NPQYRS----NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
            P   +     P  + +G  ++   L      A   D IN +  SF++   +  VAG   
Sbjct: 354 TPDQLAAVSIGPPTVSNGVPLALSALAVPTQDA---DRINGF--SFSQ--FYGQVAGTVG 406

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N  LL  A+N+    +   + + DL  + Q              GV+L EE + L++ ++
Sbjct: 407 N--LLNDAQNNTEVQQSLLTQAKDLRQQYQ--------------GVSLDEEATTLMQFQR 450

Query: 457 SYNISNKLIMFTDKMLQTLLEGVK 480
           +Y  + K +   D++ QT ++ +K
Sbjct: 451 AYQANAKYLSVLDELTQTAIDILK 474


>gi|313896955|ref|ZP_07830502.1| flagellar hook-associated protein FlgK [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312974402|gb|EFR39870.1| flagellar hook-associated protein FlgK [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 582

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 117 NLSEDILGKT-VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
           N + D   +T V+     +V    T+A ++Q   A    E+ +++  +     +++ +N 
Sbjct: 130 NYASDAASRTAVLTKGNNLVDRLRTNANQLQDQIASQYDEMRIQVQKVNSITEQISRLNK 189

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            I +   +   A+D  DQRD+L+ ++SEI  I+ +    N M    S+G TL
Sbjct: 190 NIMYAETNGAKANDLRDQRDLLVDQLSEITNIN-VYEEANGMYTVVSNGMTL 240


>gi|293433372|ref|ZP_06661800.1| flagellar hook-associated protein FlgK [Escherichia coli B088]
 gi|291324191|gb|EFE63613.1| flagellar hook-associated protein FlgK [Escherichia coli B088]
          Length = 547

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +  + + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAVRQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   ++DG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYVDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNSQ 312


>gi|209545589|ref|YP_002277818.1| flagellar hook-associated protein FlgK [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533266|gb|ACI53203.1| flagellar hook-associated protein FlgK [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 503

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 100/523 (19%), Positives = 200/523 (38%), Gaps = 63/523 (12%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT------MTTISPENVTVVT 54
           M LL+  + A +  N    Q   +  N+ N+    YV             +        T
Sbjct: 1   MDLLSSLSTATSGLNGIEYQLGVLSNNVSNSSTTGYVSETAEVSSAVAGGVGVGIKIGTT 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRL----LQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           Q S NK +    L+  ++ +         L +   ++   SAD     +    +  ++ +
Sbjct: 61  QLSVNKALM-AALYGQNAQVASLTATNNSLAAVSDIQGSTSADAGSTTTLADELGNVQSA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L + +   +       V   A+ +     + +      R DA+  +   +S++   L++L
Sbjct: 120 LTTLTSTPTNSASQSAVYSAAQSLTTTIQSLSSTYTAQRQDAENSVVSTVSSVNYDLTQL 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             ++  I    AS     D  +QR  ++  +S  + ++    +  DM+V T+DGT L  T
Sbjct: 180 GQLSQQIMSLRASGGSTADVENQRLQVMSSLSSELSVTFSETSTGDMIVRTADGTEL-PT 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-----------------GSAVPK---- 269
            P  I  E  ++ T+ + + P+   G  ++ +                  G+ +      
Sbjct: 239 RPDQIG-ENDSTVTLPTSTWPLSTSGSTITPSSYYQAGDTNSTISGIMLNGTDITAHLTG 297

Query: 270 GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNS---ENVPGLFIADGIKDL 326
           G + A + +RDS  P  Q QLD  +  L   FS+    AG S   +    +   D   + 
Sbjct: 298 GTLGANITLRDSTYPTMQAQLDSFSSTLATRFSD----AGLSLFTDGTGAVPATDPTAET 353

Query: 327 DNKLCQGISETICVNPQYRSNPSFLRDGGS------VSKKFLWNVKNLAG---YPDLINH 377
            + +  G+S  I V+    S P    DG +      +S  F     +++G    P   + 
Sbjct: 354 PSGIV-GLSSVISVD---TSAP-LTTDGDTSTITAVLSTAFGTASTDVSGSLEAPS--SG 406

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
                N +  +    G+    T L  A+ ++        D+ D    +  V   +  S +
Sbjct: 407 LGPEGNLSTGYSGTQGLVALATSLTSAQGAV------IGDATDDLTSATSVQTTLQTSVA 460

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           N  GVN+ +++S ++ ++ +Y  + K++     M   LL+ ++
Sbjct: 461 NVSGVNVDDQMSTVVALQNAYAANAKVVTAVQTMFTALLDAIQ 503


>gi|167644972|ref|YP_001682635.1| flagellar hook-associated protein FlgK [Caulobacter sp. K31]
 gi|167347402|gb|ABZ70137.1| flagellar hook-associated protein FlgK [Caulobacter sp. K31]
          Length = 704

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 130/313 (41%), Gaps = 41/313 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-------- 52
           MSL  + N A +    A      +  NI N +   YVR+    TI+  N+          
Sbjct: 1   MSLNTILNVATSGMMAAQTGLRVVSDNIANINTAGYVRK----TIAQSNLVSNGMGVGVN 56

Query: 53  --VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
               +R+ +K M    L+  S A     +  + +  +++        ++ T+Y + L D 
Sbjct: 57  IDAIKRATDKYMAAASLNGASEAGRSGSIATAMDNAQKLFGDP----SAKTNYFATLDDV 112

Query: 111 LESYSKNLSEDILGKTVI-DNAEEVVQNFNTSAREVQ-----KIRADADKEIELEISNLR 164
             ++S  L+ D    T++   A   V++F + ++ +      +I+ D D  I  ++  + 
Sbjct: 113 YAAFS--LAVDDPSSTLLRSGAVTKVEDFLSESKRITASLSGQIK-DTDNRIAGDVDRVN 169

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L ++  +N  I     +  D     + +  L+ ++S  + I    R N  ++V +++G
Sbjct: 170 DLLKQIDSLNVDITRAKMAGADGTGSENVQSGLIDELSTYMNIQVSDRANGGVMVRSAEG 229

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-----AVPKGKIKALLQIR 279
            TL    P  + +          +S P      V ++N G      AV  G+I+ LLQ+R
Sbjct: 230 VTLAGNGPATVTYN---------QSGPANGYLTVTTANSGGQVMPLAVTNGEIQGLLQLR 280

Query: 280 DSVVPIFQNQLDE 292
           +  +P   +QL E
Sbjct: 281 NKDLPNLSDQLGE 293


>gi|84514827|ref|ZP_01002190.1| FlgK flagellar hook-associated protein 1 [Loktanella vestfoldensis
           SKA53]
 gi|84510986|gb|EAQ07440.1| FlgK flagellar hook-associated protein 1 [Loktanella vestfoldensis
           SKA53]
          Length = 1421

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           +  ++  E V   FNT+A  +  +     +EI +E+ ++ R L  L ++N  ++      
Sbjct: 135 EAALEMGETVANAFNTTAGMLTSLMNGTAEEIGVELVDVNRTLQSLGIINGQLRSSNIGS 194

Query: 185 HDAHDFLDQRDVLLQKISEII 205
              H+ LD+RD LL  ++E I
Sbjct: 195 APPHNLLDERDRLLDSLAEKI 215


>gi|83716869|ref|YP_438395.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           E264]
 gi|167614843|ref|ZP_02383478.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           Bt4]
 gi|257141428|ref|ZP_05589690.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           E264]
 gi|83650694|gb|ABC34758.1| flagellar hook-associated protein 1, putative [Burkholderia
           thailandensis E264]
          Length = 452

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 72/159 (45%), Gaps = 15/159 (9%)

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREV--QKIRADADKEIEL--EI 160
            K   +LE+ S N  + +L   VID A  + + FN + R V   ++R+   + +    ++
Sbjct: 106 GKFIGALEAASGNPGDSVLRNGVIDAANSMTKQFN-NMRSVLTNQLRSIEQQRVTTVEQV 164

Query: 161 SNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY 220
           + L + ++EL   N  I    AS  D    +DQRD  +  +S   G+  + + N  + V 
Sbjct: 165 NGLAKTVAEL---NGKIAAGQASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGTVDVS 221

Query: 221 TSDGTTLFET-------VPRDINFEKMNSYTVTSESNPI 252
            ++G  L          + RD   ++  S T  S++ P+
Sbjct: 222 MTNGQPLVVGAQAGRIELGRDAAGQQTLSLTFGSQTMPL 260


>gi|301644994|ref|ZP_07244960.1| flagellar hook-associated protein FlgK [Escherichia coli MS 146-1]
 gi|301076723|gb|EFK91529.1| flagellar hook-associated protein FlgK [Escherichia coli MS 146-1]
          Length = 293

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 76/152 (50%), Gaps = 13/152 (8%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           + ++++I+G+   V++     +  ++G +L +
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQ 237


>gi|300918686|ref|ZP_07135266.1| flagellar hook-associated protein FlgK [Escherichia coli MS 115-1]
 gi|300414160|gb|EFJ97470.1| flagellar hook-associated protein FlgK [Escherichia coli MS 115-1]
          Length = 547

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGEGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   ++DG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYVDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNSQ 312


>gi|146311252|ref|YP_001176326.1| flagellar hook-associated protein FlgK [Enterobacter sp. 638]
 gi|145318128|gb|ABP60275.1| flagellar hook-associated protein FlgK [Enterobacter sp. 638]
          Length = 546

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 115/267 (43%), Gaps = 53/267 (19%)

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHY--ISKLRDSLESYSKNLSEDILG-----KTV 127
           G QR   +F    ++ +A +  +   T Y  ++K+ D L   +K+LS  + G     +T+
Sbjct: 62  GVQREYDAF-ITNQLRAAQNQSSGLTTRYQQMAKIDDVLSDTTKSLSTTLQGFFTSLQTL 120

Query: 128 IDNAEEVVQNFNTSAREVQKIRADA---------------DKEIELEISN----LRRFLS 168
           + NAE+       +AR+    +AD                DK++   I+     +  + +
Sbjct: 121 VSNAED------PAARQTVLGKADGLVNQFKVTDQYLRDQDKQVNTAIATSVDQINSYAT 174

Query: 169 ELTVVNDAIKFKTASKHDA--HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
           ++  +ND I   T     A  ++ LDQRD L+ ++++I+G+   V++     V   +G T
Sbjct: 175 QIATLNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVDVSVQDGGTYNVSFGNGYT 234

Query: 227 LFE--------TVPRDINFEKMN-SYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ 277
           L +         +P + +  +M  +Y   +  N    D          A+  G +  L+ 
Sbjct: 235 LVQGSSVTKLAAMPSNADPARMTVAYVDPAAGNVEIPD---------KALNTGSLGGLIT 285

Query: 278 IRDSVVPIFQNQLDEMARVLIGSFSEK 304
            R+  +   +N L++MA     S +++
Sbjct: 286 FRNEDLDKTRNNLNQMALAFADSMNQQ 312


>gi|77920039|ref|YP_357854.1| flagellar hook-associated protein [Pelobacter carbinolicus DSM
           2380]
 gi|77546122|gb|ABA89684.1| flagellar hook-associated protein [Pelobacter carbinolicus DSM
           2380]
          Length = 413

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 77/175 (44%), Gaps = 19/175 (10%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHD 186
           V+   +++   F    RE+ +++A+ D++I   + +L + L ++  V+  I  + A  + 
Sbjct: 134 VLATGKQLTDTFRQMDRELAEVQAEIDQDIASAVDDLNKQLMQIGDVDTRIVTREAGGNP 193

Query: 187 AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVT 246
           A    D+R+ LLQ ++E +GI     +   + V    G  L            + S  V 
Sbjct: 194 ADTLRDERNRLLQTVAETVGIQYNEMDTGGVSVQLPSGAPL------------VMSGDVG 241

Query: 247 SESNPIFIDGVVVSSNQGSAVP-------KGKIKALLQIRDSVVPIFQNQLDEMA 294
             S+      V++S + G+           GKI  L+ +RD  +   +  LD++A
Sbjct: 242 CFSSECREGKVLLSLSHGATSTDLSTNDLGGKIGGLMTVRDETIEKTRTALDQLA 296


>gi|156934434|ref|YP_001438350.1| flagellar hook-associated protein FlgK [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156532688|gb|ABU77514.1| hypothetical protein ESA_02265 [Cronobacter sakazakii ATCC BAA-894]
          Length = 552

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 76/152 (50%), Gaps = 13/152 (8%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   DD  + +  +  + ++D   SL++ + N  +    +T++  A+ +V  F    +
Sbjct: 91  EQMSKIDDMVSGTTNNISTTMQDFFKSLQTLASNAEDPAARQTLLGKADGLVNQF----K 146

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
            V +   D DK++   ++     +  + +++  +N+ I   T     A  +D LDQRD L
Sbjct: 147 VVDQYLRDQDKQVNTAVTASVQQINNYATQIASLNEQITRLTGMGAGASPNDLLDQRDQL 206

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           + ++++I+G+   V++ N   V  ++G  L +
Sbjct: 207 VSELNKIVGVDVSVQDGNTFNVTMANGYNLVQ 238


>gi|325289235|ref|YP_004265416.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964636|gb|ADY55415.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 512

 Score = 42.7 bits (99), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 88/413 (21%), Positives = 167/413 (40%), Gaps = 69/413 (16%)

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +S    +LE  + + S+D    +V   AE      N  A  ++ +R++A+  ++ ++  +
Sbjct: 115 LSSFVSALEDLAGDPSDDSARSSVKAEAEAFCTYLNNMASTLEDLRSEANSAVKTKVDEI 174

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI-------STIVRNNND 216
                 ++ +N  I     +   A+D  DQR VL+ ++SEI  I        T+     D
Sbjct: 175 NSLAGRISALNQQIYKAELTGGTANDLRDQRTVLVDQLSEIASIEVSETAVGTLADGQED 234

Query: 217 MVVYTS-DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV--VVSSNQGSAV--PKGK 271
           +      +G +L       +N   +     ++ S+    DG+  V  +  G+ V    G+
Sbjct: 235 LRFSIKINGVSL-------VNHFSVKKLECSAISDGSASDGLYEVRWAETGNEVTFTGGE 287

Query: 272 IKALLQI-----RDSV---VPIFQNQLDEMARVLIGSFSE---KDPIAGNSENVPGLFIA 320
           IK  L +     +D     +P +  QL+  A+ L  +F+E    D     S +  G+ + 
Sbjct: 288 IKGDLDMAGGDGQDGAFKGIPYYLGQLNTFAQTLAKAFNEGVYADGETYGSGHAGGVGLD 347

Query: 321 DGIK-------------------DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKF 361
           DG                     DL +   +  +  I ++ +  ++P  +    SVS + 
Sbjct: 348 DGTGIRFFSYDGLSSEELMAGGTDLASIYGKITAANISLSAEVENDPGQIA-ASSVSGE- 405

Query: 362 LWNVKNLAGYPDLINHYCDS--FNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               +N A   +LI  + DS  F      + +  I T + +       I  L +N     
Sbjct: 406 ---TENSANLTELIAMFSDSGVFANGSPEEFINAIYTTIGVETSLAGRISTLHEN----- 457

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
              + +Q+  N  +       GV+L EE S LIK + +YN + K++   D++L
Sbjct: 458 ---IAAQIDTNRTA-----VAGVSLDEETSNLIKYQLAYNAAAKVMSVMDEVL 502


>gi|291334320|gb|ADD93981.1| flagellar hook associated protein 1 [uncultured marine bacterium
           MedDCM-OCT-S09-C247]
          Length = 354

 Score = 42.7 bits (99), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 137/321 (42%), Gaps = 24/321 (7%)

Query: 21  FASIVRNIENADNKNYVRRDTMTT--ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQR 78
            A+  +NI N  NK+Y RR+   +   S  +V  V+  +      D +  A    I  Q 
Sbjct: 19  LATTGQNIANVGNKDYARREAPVSEVKSSNDVLQVSNTAGFGVRVDGITRAFDQFIDTQL 78

Query: 79  LLQSFE---------ALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVID 129
              +            L ++ +       S +  I +L  SL + +++ S+        D
Sbjct: 79  QSAASSFSFSTSQAVVLNQLETVVRPSEGSVSQKIQELFSSLNTVAQDPSDLASRHVAAD 138

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
            ++ +V +  T A  +  +R    ++IE  I      L++L  V + +   ++S    ++
Sbjct: 139 ASKALVNSITTVANGISDLRTFVSQDIESNIGQANDILTQLANVQNQLLGISSSNRGPNE 198

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT-TLFETVPRDINFEKMNSYTVTSE 248
            LD+RD LL  +SE+I I+   ++N   ++  + GT    +++   +   K+    V   
Sbjct: 199 LLDKRDALLNDLSELIDITVDYKSNG--ILEVNAGTFGQGQSLISGVQISKLEVQKVDGT 256

Query: 249 SNPIFI---DGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKD 305
           S  IF+   +G  +S  Q   V  GKI   L    ++V   ++ LD+++R L+  F+E  
Sbjct: 257 S-KIFMRTANGDGLSKIQ---VQAGKIAGNLASDLTLVET-KSALDQLSRKLVNEFNEAH 311

Query: 306 PIAG--NSENVPGLFIADGIK 324
                 N E     F  DG+K
Sbjct: 312 TFGVDLNGELGRKFFSLDGVK 332


>gi|301051132|ref|ZP_07197963.1| flagellar hook-associated protein FlgK [Escherichia coli MS 185-1]
 gi|300297216|gb|EFJ53601.1| flagellar hook-associated protein FlgK [Escherichia coli MS 185-1]
          Length = 425

 Score = 42.7 bits (99), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSTADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNTQ 312


>gi|311070047|ref|YP_003974970.1| flagellar hook-associated protein FlgK [Bacillus atrophaeus 1942]
 gi|310870564|gb|ADP34039.1| flagellar hook-associated protein FlgK [Bacillus atrophaeus 1942]
          Length = 507

 Score = 42.7 bits (99), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 60/125 (48%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           S++  + N +ED     V    ++V   FN  +  +  ++++   E++  + ++   LS+
Sbjct: 127 SIQELTNNSNEDSARSVVSQKGQDVAGTFNHISESLTNVQSNLKTELDSSVLDVNSLLSQ 186

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           L  +N  I     S +  +   DQRDVLL K+S ++ I      +    + +S+GT   E
Sbjct: 187 LNSLNQQIAQVEPSGNLPNGLYDQRDVLLDKLSSLVDIKVSYNKSGGNALASSEGTVSIE 246

Query: 230 TVPRD 234
            + ++
Sbjct: 247 ILDKN 251



 Score = 37.0 bits (84), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 43/82 (52%)

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            T+L+Y  + IG L     +++ L   ++   N    +      V+L EE++ +I+ + +
Sbjct: 421 TTVLDYYASLIGELGIKTQEANRLAANTETQLNAADLNRQQMSAVSLDEEMTNMIQFQHA 480

Query: 458 YNISNKLIMFTDKMLQTLLEGV 479
           YN + +++   D+ML  ++ G+
Sbjct: 481 YNAAARMVTLQDEMLDKVINGM 502


>gi|149189842|ref|ZP_01868122.1| putative flagellar hook-associated protein [Vibrio shilonii AK1]
 gi|148836328|gb|EDL53285.1| putative flagellar hook-associated protein [Vibrio shilonii AK1]
          Length = 457

 Score = 42.4 bits (98), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 9/178 (5%)

Query: 123 LGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA 182
           L + VI+ +E + + FNT    +     D   +    IS+    +S +  VN  I     
Sbjct: 128 LRQQVINESEALARRFNTLTESLHNQHKDVHDQRNAAISHANSLMSNIAEVNKQIVEMQG 187

Query: 183 SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNS 242
           +  +    +D RD L+ ++S+++ + T  + +  + V  + G  L   +  D +  K   
Sbjct: 188 TGGNPAQLMDTRDALVGELSKVMEVKTTDQADGSIQVSLASGQPLV--MGSDASVIK--- 242

Query: 243 YTVTSESNPIFIDGVVVSSNQGSAVPK---GKIKALLQIRDSVVPIFQNQLDEMARVL 297
             +   S+P   D  +   NQ  A      GK+ +L   +  V+  +Q+ +D+MAR L
Sbjct: 243 -AIPDPSDPYLADIHIEFGNQTFAAKGDLGGKLGSLHDYQVDVLKPYQDAIDDMARSL 299


>gi|298529920|ref|ZP_07017322.1| flagellar hook-associated protein FlgK [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509294|gb|EFI33198.1| flagellar hook-associated protein FlgK [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 701

 Score = 42.4 bits (98), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 1/40 (2%)

Query: 441 GVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           GVNL EE+S LIK + SY  + ++I   D+M+QTLL G+K
Sbjct: 662 GVNLDEEMSNLIKYQHSYQAAARMISTADQMMQTLL-GLK 700



 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 54/104 (51%), Gaps = 1/104 (0%)

Query: 127 VIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK-TASKH 185
           ++ N   + Q F +  +++ K R   D+ I  ++  +   L E+  +N  I  +    K 
Sbjct: 137 LLGNTGNLTQAFRSMDQDLTKNREQMDEFISQDVDRVNDILEEIAEINKLINVREVPGKV 196

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           + ++  D+RD+L+++++E + I+ + +   D+ + T  G TL E
Sbjct: 197 NLNELRDKRDLLVRELAEKVDINYMDKGGGDVTIQTKAGHTLVE 240


>gi|26247222|ref|NP_753262.1| flagellar hook-associated protein FlgK [Escherichia coli CFT073]
 gi|227886560|ref|ZP_04004365.1| flagellar hook-associated protein FlgK [Escherichia coli 83972]
 gi|300974386|ref|ZP_07172598.1| flagellar hook-associated protein FlgK [Escherichia coli MS 45-1]
 gi|26107623|gb|AAN79822.1|AE016759_96 Flagellar hook-associated protein 1 [Escherichia coli CFT073]
 gi|227836764|gb|EEJ47230.1| flagellar hook-associated protein FlgK [Escherichia coli 83972]
 gi|300410629|gb|EFJ94167.1| flagellar hook-associated protein FlgK [Escherichia coli MS 45-1]
 gi|307553084|gb|ADN45859.1| flagellar hook-associated protein FlgK [Escherichia coli ABU 83972]
 gi|315291060|gb|EFU50423.1| flagellar hook-associated protein FlgK [Escherichia coli MS 153-1]
          Length = 547

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSTADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNTQ 312


>gi|300938647|ref|ZP_07153376.1| flagellar hook-associated protein FlgK [Escherichia coli MS 21-1]
 gi|300456432|gb|EFK19925.1| flagellar hook-associated protein FlgK [Escherichia coli MS 21-1]
          Length = 547

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNTQ 312


>gi|218549190|ref|YP_002382981.1| flagellar hook-associated protein FlgK [Escherichia fergusonii ATCC
           35469]
 gi|218356731|emb|CAQ89359.1| flagellar hook-filament junction protein 1 [Escherichia fergusonii
           ATCC 35469]
          Length = 548

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 106/234 (45%), Gaps = 28/234 (11%)

Query: 88  EMMSADDHYNNSPTHYIS----KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           E MS  D+  +S T+ +S        SL++   N  +    + +I  A+ +V  F T+  
Sbjct: 90  EQMSKIDNLLSSETNNVSTSLQGFFTSLQTLVSNAEDPAARQALIGKADGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  +D LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNDLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++++G+   V++     +  ++G +L + +  R +         V S ++P  +  
Sbjct: 206 VSELNKVVGVEVSVQDGGTYNITMANGYSLVQGSSARQL-------AAVPSHADPSRVTV 258

Query: 257 VVVSSNQGS-AVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             V +  G   +P+     G +  +L  R   +   +N L ++A     +F+++
Sbjct: 259 AYVDATAGEIEIPEKLLTSGTLGGMLTFRSQDLDQSRNTLGQLALAFADAFNKQ 312


>gi|325497610|gb|EGC95469.1| flagellar hook-associated protein FlgK [Escherichia fergusonii
           ECD227]
          Length = 548

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 106/234 (45%), Gaps = 28/234 (11%)

Query: 88  EMMSADDHYNNSPTHYIS----KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           E MS  D+  +S T+ +S        SL++   N  +    + +I  A+ +V  F T+  
Sbjct: 90  EQMSKIDNLLSSETNNVSTSLQGFFTSLQTLVSNAEDPAARQALIGKADGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  +D LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNDLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++++G+   V++     +  ++G +L + +  R +         V S ++P  +  
Sbjct: 206 VNELNKVVGVEVSVQDGGTYNITMANGYSLVQGSSARQL-------AAVPSHADPSRVTV 258

Query: 257 VVVSSNQGS-AVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
             V +  G   +P+     G +  +L  R   +   +N L ++A     +F+++
Sbjct: 259 AYVDATAGEIEIPEKLLTSGTLGGMLTFRSQDLDQSRNTLGQLALAFADAFNKQ 312


>gi|297516687|ref|ZP_06935073.1| flagellar hook-associated protein FlgK [Escherichia coli OP50]
          Length = 247

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 76/152 (50%), Gaps = 13/152 (8%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           + ++++I+G+   V++     +  ++G +L +
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQ 237


>gi|170683657|ref|YP_001744098.1| flagellar hook-associated protein FlgK [Escherichia coli SMS-3-5]
 gi|170521375|gb|ACB19553.1| flagellar hook-associated protein FlgK [Escherichia coli SMS-3-5]
          Length = 547

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNTQ 312


>gi|50120645|ref|YP_049812.1| flagellar hook-associated protein FlgK [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611171|emb|CAG74617.1| flagellar hook-associated protein 1 [Pectobacterium atrosepticum
           SCRI1043]
          Length = 568

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 67/124 (54%), Gaps = 8/124 (6%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N  +    +TV+  AE +V  F  + + ++ + +  + +I+  +  +  +  ++
Sbjct: 117 LQNLTSNAGDSSTRQTVLGKAEGLVNQFKVTDKYLRDMDSGLNTQIQSTVGQINTYTDQI 176

Query: 171 TVVNDAI-KFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT---SDGT 225
           + +N+ I K   A S    +D LDQRD+L+ ++++++G+   V+   D +VY     +GT
Sbjct: 177 SSLNNEIMKLMGANSGTMPNDLLDQRDLLVDQLNKLVGVDVTVQ---DGIVYNVALKNGT 233

Query: 226 TLFE 229
            L +
Sbjct: 234 NLVQ 237


>gi|323190594|gb|EFZ75866.1| flagellar hook-associated protein FlgK [Escherichia coli RN587/1]
          Length = 547

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256
           + ++++I+G+   V++     +  ++G +L + +  R +    + S    S +   +IDG
Sbjct: 206 VSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQL--AAVPSSADPSRTTVAYIDG 263

Query: 257 VVVSSNQGSAVPK-----GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
              +      +P+     G +  +L  R   +   +N L ++A     +F+ +
Sbjct: 264 TAGNIE----IPEKLLNTGSLGGILTFRSQDLDQTRNTLGQLALAFAEAFNTQ 312


>gi|312135425|ref|YP_004002763.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           owensensis OL]
 gi|311775476|gb|ADQ04963.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           owensensis OL]
          Length = 525

 Score = 42.4 bits (98), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 83/423 (19%), Positives = 166/423 (39%), Gaps = 72/423 (17%)

Query: 102 HYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEIS 161
           H+ S    SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I 
Sbjct: 119 HFFS----SLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKIM 174

Query: 162 NLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
            +    S++  +N  I         A+D  DQR++L+ K+S+II  +     +   VV  
Sbjct: 175 EINSIASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIIDTTAYEDKDGRFVVQI 234

Query: 222 SDGTTL--------FET----VPRDINFEKMNSYTVTSESNPIF------IDGVVV---- 259
           + G TL         ET    + R   F+     T     +P+       + G+ V    
Sbjct: 235 AGGETLVNHFTVYELETDKSKIMRKSGFDSSGQPTGFKPDDPLSQQNLYDVPGLFVVMWK 294

Query: 260 SSNQGSAVPKGKIKALLQIRDSV---------------VP---------IFQNQLDEMAR 295
            + Q   +  G++K LL +RD V               VP          + N+L+E A+
Sbjct: 295 DTGQVLNIKSGELKGLLDVRDGVGGLDEDLTVNGQPVDVPNKNSYPGISYYLNRLNEFAK 354

Query: 296 VLIGSFSE--KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
            LI  F+E      + N +N        GI    N     + +T       + + + + D
Sbjct: 355 KLIEKFNELHTQGWSLNGQNT-------GI----NFFEPPVGQTFFYARYIKVSDAIMND 403

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
             +++    ++  +L G  DL+       N   IF             ++ ++ I  L  
Sbjct: 404 LNNIATT--YDASSLPGGNDLVVDMLKLRNDTSIF-------KEGRFEDFLKSLISNLGV 454

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           +   + +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML 
Sbjct: 455 DSQGAKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLD 514

Query: 474 TLL 476
            ++
Sbjct: 515 VIV 517


>gi|74311643|ref|YP_310062.1| flagellar hook-associated protein FlgK [Shigella sonnei Ss046]
 gi|73855120|gb|AAZ87827.1| flagellar hook-filament junction protein 1 [Shigella sonnei Ss046]
 gi|323165592|gb|EFZ51379.1| flagellar hook-associated protein FlgK [Shigella sonnei 53G]
          Length = 547

 Score = 42.4 bits (98), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 87  KEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAR 143
           ++M   D+  + S +   ++++D   SL++   N  +    + +I  +E +V  F T+  
Sbjct: 90  EQMSKIDNMLSTSTSSLATQMQDFFTSLQTLVSNAEDPAARQALIGKSEGLVNQFKTTD- 148

Query: 144 EVQKIRADADKEIELEIS----NLRRFLSELTVVNDAIKFKTASKHDA--HDFLDQRDVL 197
             Q +R D DK++ + I      +  +  ++  +ND I   T     A  ++ LDQRD L
Sbjct: 149 --QYLR-DQDKQVNIAIGASVDQINNYAKQIASLNDQISRLTGVGAGASPNNLLDQRDQL 205

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINFEKMNSYTVTSESNPIFIDG 256