BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780524|ref|YP_003064937.1| flagellar hook-associated
protein FlgK [Candidatus Liberibacter asiaticus str. psy62]
         (480 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|20806999|ref|NP_622170.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           tengcongensis MB4]
 gi|20515482|gb|AAM23774.1| Flagellar hook-associated protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 482

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 75/495 (15%), Positives = 171/495 (34%), Gaps = 34/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALEVTGHNIANANTPGYTRQVVDMASIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +V  R       D      +  +G+        +  E +  ++  ++  T  +
Sbjct: 61  AIGEGVKIVDIRQIRDQFLDNQYRRENKFLGEWETKAEVLSAIENIF-NEPSSSGITAVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  SKN     +   V + A  +   FN   + +     + +  I+  I+ + 
Sbjct: 120 NDFFNSLQELSKNPESLTVRAEVRERAIALADTFNMVYQHLYDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N  I     S   A+D  DQR++L+ ++S+++ I+T    N +  +     
Sbjct: 180 SYAERISRLNGEIYRFELSGQVANDLRDQRNLLVDQLSKLVNITTYEDANGNFRIDIGGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  T    ++ +K  +       +P+     V+          G            VP
Sbjct: 240 ALVSGTTAFTMSMDKNGNVIWDLTGSPVNPSSGVLKGLLDMRNGDGADGV------KGVP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            +  Q +++A  +  + ++        +   G  +  G               +      
Sbjct: 294 YYMEQWNKLAYNIAEAINKVHSQGYGLDGSTGKPLFGGFDTSLAYDKTTPYAQLIRV--- 350

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             +   L   G +      +   L G         ++     + D         T  ++A
Sbjct: 351 --SSDILASDGLLKIAAAKDPTALPGDN------RNALELIVLRDRPLDGLDKATFDDFA 402

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    +V+   I  +  +  GV+L EE++ ++K ++SY    ++
Sbjct: 403 RSLISNLGVDAEQANVMKKNQEVMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYAACARV 462

Query: 465 IMFTDKMLQTLLEGV 479
           I   D+++ T++  +
Sbjct: 463 ITAMDELIDTVINRM 477


>gi|296134284|ref|YP_003641531.1| flagellar hook-associated protein FlgK [Thermincola sp. JR]
 gi|296032862|gb|ADG83630.1| flagellar hook-associated protein FlgK [Thermincola potens JR]
          Length = 479

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 75/493 (15%), Positives = 172/493 (34%), Gaps = 40/493 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S     N  +       +       NI NA+ + + R+  +   +               
Sbjct: 3   STFFGLNIGRQALQAQQRALDVTAHNIANANTEGFSRQRAVMATTTPFAYPSVNRPIGAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   +    +  D  +    +  G+     +     E++  ++  +      +
Sbjct: 63  QIGTGVMVEEVKRMRDSFIDLQVRQEVNKTGEWETKNNSLQKLEVIF-NEPSDAGLRTVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +  ++ +  SK    + +   V      V + FN    ++  +  D D  I++++  + 
Sbjct: 122 DQFWEAWQELSKKPELEAVRSLVRQRGIAVAETFNHLDGQLTDLAEDLDASIKIKVDEIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               ++  +ND I        +A+D  D+RD+LL ++S+I+ I+    N+  + V     
Sbjct: 182 NIAGQIDALNDQIVRIEVQGDNANDLRDKRDLLLDELSKIVQITVKEDNSGSVTVSIGGR 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +       I+     +       N  ++D          +V  G IK +L +RD+ +P
Sbjct: 242 ALVSVAGVSKISAVPNGA-------NNGYVDLQWAVDGTAVSVQSGSIKGMLDMRDTTIP 294

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            ++ QLD++A  L+ S +                                  TI ++   
Sbjct: 295 SYRQQLDDLANALVTSLNAVHVAGYGLNKTANGINFFDAAGTTAA-------TISIDAAI 347

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             +   +    + +          +G      +  +  ++  +           T+ +Y 
Sbjct: 348 LGDLDNIAAASTAADPLASPSVENSGDGSNALNIAELKHQALL--------GTATIDDYY 399

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R  +  L     +S  +     ++ + +        GV+L EE++ +IK + +YN + + 
Sbjct: 400 RGMVAQLGVEAQESSRMVENQNLLLSQLENRRQEVSGVSLDEEMTNMIKFQHAYNAAART 459

Query: 465 IMFTDKMLQTLLE 477
           I   D+ML T++ 
Sbjct: 460 ITAMDEMLDTIVN 472


>gi|254478858|ref|ZP_05092223.1| flagellar hook-associated protein FlgK [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035220|gb|EEB75929.1| flagellar hook-associated protein FlgK [Carboxydibrachium pacificum
           DSM 12653]
          Length = 484

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 81/495 (16%), Positives = 179/495 (36%), Gaps = 32/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALEVTGHNIANANTPGYTRQVVDMASIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +V  R       D      +  +G+        +  E +  ++  ++  T  +
Sbjct: 61  AIGEGVKIVDIRQIRDQFLDNQYRRENKFLGEWETKAEVLSAIENIF-NEPSSSGITAVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  SKN     +   V + A  +V  FNT  + +     + +  I+  I+ + 
Sbjct: 120 NDFFNSLQELSKNPESLTVRAEVRERAIALVDTFNTVYQHLYDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N  I     S   A+D  DQR++L+ ++S+++ I+T    N +  +     
Sbjct: 180 SYAERISRLNGEIYRFELSGQVANDLRDQRNLLVDQLSKLVNITTYEDANGNFRIDIGGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  T    ++ +K  +       +P+     V+          G            +P
Sbjct: 240 ALVSGTTAFTMSMDKNGNVIWDLTKSPVNPSSGVLKGLLDMRDGDGTNGV------KGIP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            +  Q +++A  +  S +E        +   G  + +     D         TI      
Sbjct: 294 YYMEQWNKLAYNIAKSINEVHSQGYGLDGSTGNLLFE---GFDTSSTSTYDRTIPYAQLV 350

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           + + + L   G +      +   L G         ++ N   + D         T  ++A
Sbjct: 351 KVSSAILASDGLLKIAAAKDPAALPGDN------RNALNLIALRDIPVQGLDKATFDDFA 404

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    +++   I  +  +T GV+L EE++ ++K ++SY    ++
Sbjct: 405 RSLIANLGVDAEQANVMKKNQEIMVKQIDLNRQSTSGVSLDEEMTNMLKYQKSYAACARV 464

Query: 465 IMFTDKMLQTLLEGV 479
           I   D+++ T++  +
Sbjct: 465 ITAMDELIDTIINRM 479


>gi|256750927|ref|ZP_05491811.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750262|gb|EEU63282.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 480

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 72/495 (14%), Positives = 173/495 (34%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMASIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +   R       D      +  +G+        A  E +  ++  ++     +
Sbjct: 61  AIGEGVKIQDIRQIRDQFLDNQFRRENKFLGEWETKAQVLAAVEDIF-NEPSDSGINTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  SKN     +   V + A  +   FNT  + +     + +  I+  I+ + 
Sbjct: 120 NDFFNSLQELSKNPESLTVRAEVRERAIALADTFNTVYQHLYDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     +   A+D  DQR++L+ ++S+++ I+T   +N +  +  +  
Sbjct: 180 SYAERISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLVNITTYEDSNRNFRIDIAGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++     +        P+     ++          G            VP
Sbjct: 240 ALVDGSTAFTMSLNNTGAVVWDLTGAPVNPSSGILKGLLDMRDGDGTNGI------KGVP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+ +++A  +  + +E        +   G+ +        +   Q        +   
Sbjct: 294 YYINEWNKLAYSIAQAINEVHKAGYGLDGSTGIPLFTDFTTPYDSTVQYAKLIKVSSDIL 353

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            ++              L  +   +    L     ++     + D    +    T  ++A
Sbjct: 354 AAD-------------GLEKIAAASSMATLPGDNTNALKLIALRDQGNAVLNGATFDDFA 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    + +   I  +  +  GV+L EE++ ++K ++SY  S ++
Sbjct: 401 RSLISNLGVDAQQANLMQKNQEFMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYAASARV 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITAIDELLDTLINRM 475


>gi|297544025|ref|YP_003676327.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296841800|gb|ADH60316.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 480

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 68/495 (13%), Positives = 166/495 (33%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMVSIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +   R       D      +  +G+        A  E +  ++  ++     +
Sbjct: 61  AIGEGVKIQDIRQIRDQFLDNQYRRENKFLGEWETKAEVLAAIENIF-NEPSDSGINTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  S+N     +   V + A  +   FNT  + +     + +  I+  I+ + 
Sbjct: 120 NDFFNSLQELSENPESLTVRAEVRERAIALADTFNTVYQHLYDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     +   A+D  DQR++L+ ++S+++ I+T   +N +  +  +  
Sbjct: 180 SYAERISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLVNITTYEDSNGNFRIDIAGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++              P+     V+          G            VP
Sbjct: 240 ALVAGSTAFTMSLNNTGEVVWDLTGTPVNPSSGVLKGLLDMRDGDGTNGV------KGVP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+ +++A  +  + +E        +    + +        +   Q        +   
Sbjct: 294 YYINEWNKLAYSMAQAINEVHKSGYGLDGSTDIPLFTDFTTPYDSTVQYAQLIKVSSHIL 353

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             +              L  +   +    L     ++     + D         T  ++ 
Sbjct: 354 ADD-------------GLQKIAAASSDATLPGDNTNALKLIALRDQAISELDGATFDDFV 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
              I  L  +   ++ +    + +   I  +  +  GV+L EE++ ++K +++Y  S ++
Sbjct: 401 GALISNLGVDAEQANLMLENQEFMIEQIDLNRQSISGVSLDEEMTNMLKYQKAYAASARI 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITAIDELLDTLINKM 475


>gi|167038179|ref|YP_001665757.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039112|ref|YP_001662097.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X514]
 gi|300913298|ref|ZP_07130615.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X561]
 gi|307723688|ref|YP_003903439.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X513]
 gi|320116588|ref|YP_004186747.1| flagellar hook-associated protein FlgK [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166853352|gb|ABY91761.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X514]
 gi|166857013|gb|ABY95421.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|300889983|gb|EFK85128.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X561]
 gi|307580749|gb|ADN54148.1| flagellar hook-associated protein FlgK [Thermoanaerobacter sp.
           X513]
 gi|319929679|gb|ADV80364.1| flagellar hook-associated protein FlgK [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 480

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 72/495 (14%), Positives = 173/495 (34%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMASIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +   R       D      +  +G+        A  E +  ++  ++     +
Sbjct: 61  AIGEGVKIQDIRQIRDQFLDNQFRRENKFLGEWETKAQVLAAVEDIF-NEPSDSGINTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  SKN     +   V + A  +   FNT  + +     + +  I+  I+ + 
Sbjct: 120 NDFFNSLQELSKNPESLTVRAEVRERAIALADTFNTVYQHLYDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     +   A+D  DQR++L+ ++S+++ I+T   +N +  +  +  
Sbjct: 180 SYAERISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLVNITTYEDSNRNFRIDIAGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++     +        P+     ++          G            VP
Sbjct: 240 ALVDGSTAFTMSLNNTGAVVWDLTGAPVNPSSGILKGLLDMRDGDGTNGI------KGVP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+ +++A  +  + +E        +   G+ +        +   Q        +   
Sbjct: 294 YYINEWNKLAYSIAQAINEVHKAGYGLDGSTGIPLFTDFTTPYDSTVQYAKLIKVSSDIL 353

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            ++              L  +   +    L     ++     + D    +    T  ++A
Sbjct: 354 AAD-------------GLEKIAAASSTATLPGDNTNALKLIALRDQGNAVLNGATFDDFA 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    + +   I  +  +  GV+L EE++ ++K ++SY  S ++
Sbjct: 401 RSLISNLGVDAQQANLMQKNQEFMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYAASARV 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITAIDELLDTLINRM 475


>gi|225181620|ref|ZP_03735061.1| flagellar hook-associated protein FlgK [Dethiobacter alkaliphilus
           AHT 1]
 gi|225167728|gb|EEG76538.1| flagellar hook-associated protein FlgK [Dethiobacter alkaliphilus
           AHT 1]
          Length = 494

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 79/496 (15%), Positives = 179/496 (36%), Gaps = 21/496 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PE 48
           MS     N ++       +       N+ NA+   Y R+    + +              
Sbjct: 1   MSTFFGLNISRLGMQAQQKALEVTAHNVANANTPGYSRQVAGMSTTTPLPYPNGQGMLGS 60

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V V       +   D  +      +G     + + +  EM+   +  +      +S   
Sbjct: 61  GVKVSQIARVRELFLDNQIRDEMHILGNWESRKEYLSQVEMIFM-EPSDTGFNSVLSTFF 119

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           DS +  S +         +++NA  +V +   +  +++ +RAD  K+IEL++++L     
Sbjct: 120 DSWQELSLSPESSPARAALVENANFLVNSIQHTYTQLESVRADITKDIELKVNDLNSLAE 179

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           ++  +N  I   TA     +D +D+RD+LL  +++++     + +N  + ++   G  L 
Sbjct: 180 QIKDLNQQITTLTAKGDSPNDLMDRRDLLLDNLAKMVNYDLHIADNGAVNIFI-GGRPLV 238

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           +    +       +    SE  P     V     + + +  G+I  L+  RD  +  +  
Sbjct: 239 QQNIVNTLKTVEGTPEQNSEWLPG-PQIVWSRDERPTQINSGEIAGLIATRDDDLRKYME 297

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETI-----CVNPQ 343
           + + MA  L+ S +E      +     G+    G       + + I   +        P 
Sbjct: 298 EFESMAWGLVDSINEYHNNGMDLTGEYGIDFFTGDHLKTIGVNKDIQNDLRKIAASTPPI 357

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
            R            +     N   ++   +                 +       T   +
Sbjct: 358 PRGEDGSEEAPFKPAPGDGSNAVQISQLRNSRITVNSDAKNLRGRLELDDEGGT-TFANF 416

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
            R++I  L  +  +S  +      +   +S+   +  GV++ EE++ +++ + SY  S +
Sbjct: 417 YRDTIARLGVDSQESIRMATNQTSLVEMMSDRRDSISGVSIDEEMANMVQFQLSYQASAR 476

Query: 464 LIMFTDKMLQTLLEGV 479
           +I   D++  TL+  +
Sbjct: 477 VITTLDEIYDTLINRM 492


>gi|289577712|ref|YP_003476339.1| flagellar hook-associated protein FlgK [Thermoanaerobacter italicus
           Ab9]
 gi|289527425|gb|ADD01777.1| flagellar hook-associated protein FlgK [Thermoanaerobacter italicus
           Ab9]
          Length = 480

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 73/495 (14%), Positives = 169/495 (34%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMVSIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +   R       D      +  +G+        A  E +  ++  ++     +
Sbjct: 61  AIGEGVKIQDIRQIRDQFLDNQYRRENKFLGKWETKAQVLAAIENIF-NEPSDSGINTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  SKN     +   V + A  +   FNT  + +     + +  I+  I+ + 
Sbjct: 120 NNFFNSLQELSKNPESLTVRAEVRERAIALADTFNTVYQHLYDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     +   A+D  DQR++L+ ++S++I I+T   +N +  +  +  
Sbjct: 180 SYAERISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLINITTYEDSNGNFRIDIAGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++              P+     V+                       VP
Sbjct: 240 ALVAGSTAFTMSLNNTGEVVWDLTGTPVNPSSGVLKGLLDMRDGDSTNGV------KGVP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+ +++A  +  + +E        +   G+ +        +   Q        +   
Sbjct: 294 YYINEWNKLAYSMAQAINEVHKSGYGLDGSTGIPLFTDFTTPYDSTVQYAQLIKVSSHIL 353

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             +              L  +   +    L     ++     + D         T  ++A
Sbjct: 354 ADD-------------GLQKIAAASSDATLPGDNTNALKLIALRDQAISELDGATFDDFA 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    + +   I  +  +  GV+L EE++ ++K ++SY  S ++
Sbjct: 401 RSLISNLGVDAEQANLMQKNQKFMIKQIDLNRQSISGVSLDEEMTNMLKYQKSYAASARM 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITAIDELLDTLINKM 475


>gi|307265481|ref|ZP_07547036.1| flagellar hook-associated protein FlgK [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919435|gb|EFN49654.1| flagellar hook-associated protein FlgK [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 480

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 74/495 (14%), Positives = 174/495 (35%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTTGYTRQVVDMASIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +   R       D      +  +G+        A  E +  ++  ++  +  +
Sbjct: 61  AIGEGVKIQDIRQIRDQFLDNQYRRENKFLGEWETKAQVLAAVENIF-NEPSDSGISTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  +KN     +   V + A  +   FNT  + +     + +  I+  I+ + 
Sbjct: 120 NDFFNSLQELAKNPESLTVRAEVRERAIALADTFNTVYQHLNDKLNELNSTIQSRIAEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     S   A+D  DQR++L+ ++S+++ I+T   +N +  +  +  
Sbjct: 180 SYADRISKLNNEIYRFELSGQTANDLRDQRNLLVDQLSKLVNITTYEDSNGNFRIDIAGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    +  +K          + +     ++          G            +P
Sbjct: 240 ALVDGSTAFTMGIDKDGKVVWDLTGSSVNPSSGILKGLLDMRDGDGSNGI------KGIP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+ +++A  +  + +E        ++   + +       D          +      
Sbjct: 294 YYINEWNKLAYSIAQAINEVHKAGYGLDSSTNIPLF--TDFADPYDPVVKYAQLIKVSSD 351

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             + + L+   + S               L     ++     + D         T  ++A
Sbjct: 352 ILDSNGLQKIAAASSS-----------ATLPGDNTNALLLINLRDQGIPELDGATFDDFA 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    QV+   I  +  +  GV+L EE++ +IK ++SY  S ++
Sbjct: 401 RSLISNLGVDAQQANMMQQNQQVMVKQIDLNRQSVSGVSLDEEMTNMIKYQKSYAASARV 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITAMDELLDTLINRM 475


>gi|220932550|ref|YP_002509458.1| flagellar hook-associated protein FlgK [Halothermothrix orenii H
           168]
 gi|219993860|gb|ACL70463.1| flagellar hook-associated protein FlgK [Halothermothrix orenii H
           168]
          Length = 471

 Score =  259 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 73/497 (14%), Positives = 185/497 (37%), Gaps = 45/497 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS        +       +       NI NA+ + Y R+  + T +              
Sbjct: 1   MSTFYGIELGKRALQVQKKSLDVTGHNIANANTEGYSRQRAVHTTTDPYTVPGFTSPAGA 60

Query: 47  ---PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                 V +        +     ++  +  +G     +      E++  ++   N   + 
Sbjct: 61  GQVGTGVKIEQIVRLKDDFITSRINNETQDLGAWEARKDNLHQIELIF-NEPSENGLRNL 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +     S    S N   + +  TV + A+ +++ F ++  ++ +++ D + +I++ +  +
Sbjct: 120 MDLFWSSWHELSLNPESEGVRSTVREQAKTLIEGFKSTYNQLIQLKDDINHDIDVNVQRV 179

Query: 164 RRFLSELTVVNDAIKFKTASKHD-AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
                ++ ++N  I    +     A+D  D+RD+L++K+++ I +        ++ +   
Sbjct: 180 NTLGEKIAMLNKRIVAVESDPQKRANDLRDKRDLLVKKLAKYINVQAHEDGQGNLNLSIG 239

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
             + +       I  E+    T+   ++   +  V    N    +  GKIK  + +RD  
Sbjct: 240 GVSFVTGDTFHKIELEE---ITLPGTTSYKVVKPVWSHINSDVTITSGKIKGAMDVRDKD 296

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP 342
           +  + ++L+E+   ++   +       +     G+   D  K   + +            
Sbjct: 297 IIQYIDKLNELVEGIVTEVNSIHSSGEDLNGNTGVDFFDSSKTTADTMSL---------- 346

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
                          + +   N    A     +    ++     + + +       T  E
Sbjct: 347 -------------DSAIESDLNAIAAAQTGGGVGDGRNAEAIAELQNALTMSGNKSTFNE 393

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           +  + I  L      ++ ++   +V+ N++    ++  GV+L EE++ +IK +Q+YN + 
Sbjct: 394 FYTSIISGLGVEAEKANMMYDNQEVMINNLENKQASISGVSLDEEMANMIKFQQAYNAAA 453

Query: 463 KLIMFTDKMLQTLLEGV 479
           K++   D+ML TL+ G+
Sbjct: 454 KMVSKVDEMLNTLINGM 470


>gi|326389602|ref|ZP_08211168.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994317|gb|EGD52743.1| flagellar hook-associated protein FlgK [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 482

 Score =  259 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 73/495 (14%), Positives = 167/495 (33%), Gaps = 34/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + +       NI NA+   Y R+                     
Sbjct: 1   MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMASIAPPTTFGMYDQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              E V +   R       D      +  +G+        A  E +  ++  ++     +
Sbjct: 61  AIGEGVKIQDIRQIRDQFLDNQFRRENKFLGEWETKAQVLAAVEDIF-NEPSDSGINTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  SKN     +   V + A  +   FNT  + +     + +  I+  IS + 
Sbjct: 120 NDFFNSLQELSKNPESLTVRAEVRERAIALADTFNTVYQHLYDKLNELNSTIQSRISEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     +   A+D  DQR++L+ ++S+++ I+T   +N +  +  +  
Sbjct: 180 SYADRISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLVNITTYEDSNGNFRIDIAGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++ +   +         +     ++          G            VP
Sbjct: 240 ALVDGSTAFTMSMDSTGNVVWDLTGTSVNPSSGILKGLLDMRDGDGTNGI------KGVP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+ +++A  +    +         +    + +  G         +     +      
Sbjct: 294 YYINEWNKLAYSIAKEINAVHESGYGLDGSHDIPLFGGFDTTGAYDSKVQYAQLIKV--- 350

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             +   L   G        +   L G            +               T  ++A
Sbjct: 351 --SSQILASDGLQKIAAASDPNALPGDNTNALQLIGLRDIPI------QGLNGATFDDFA 402

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R+ I  L  +   ++ +    QV+   I  +  +  GV+L EE++ ++K ++SY  S ++
Sbjct: 403 RSLISNLGVDAQQANMMQQNQQVMVKQIDLNRQSVSGVSLDEEMTNMLKYQKSYVASARV 462

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 463 ITVMDELLDTLINRM 477


>gi|332982896|ref|YP_004464337.1| flagellar hook-associated protein FlgK [Mahella australiensis 50-1
           BON]
 gi|332700574|gb|AEE97515.1| flagellar hook-associated protein FlgK [Mahella australiensis 50-1
           BON]
          Length = 495

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 76/509 (14%), Positives = 169/509 (33%), Gaps = 52/509 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S        ++  N   Q       NI NA    Y R+  ++                  
Sbjct: 3   STFYGLQIGKSAINLQQQALNVTAHNIANAGTPGYTRQQVISEAIVPPSTLGMGYIYGRW 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                  +   R       D    + S  +GQ  + +      E +  ++      T  +
Sbjct: 63  QVGGGADIQEIRQLRDGYLDAQFRSESQLLGQWEVRRDMLQHLEGIF-NEPSETGITTVV 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   SLE  SKN     +   V +    +         +++ +++ AD+ + + + ++ 
Sbjct: 122 EQFFSSLEELSKNPESMSVRALVRERGITLADTIRHVYNQLEGLQSQADQGVAITVQDIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             + ++  +N+ I         A+D  D+R++L+ ++S++I I+     +    V   D 
Sbjct: 182 SHIEQIRDLNEQIFKYELGGTKANDLRDRRNLLVDELSKMIDITVNEDIDGHFSVKMGDK 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNP-IFIDGVVVSSNQGSAVPKGKIKALLQIRDSV- 282
             +      ++  E        +E++    +  +   ++  + +  G+++  + IRD + 
Sbjct: 242 ELVNHFDMHELEIEPRAVGEKLNEADVDGLLKIMWDGADITADITGGQLRGYIDIRDGIG 301

Query: 283 ------------VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
                       VP +  + +E A+  +  F+E+        +       +         
Sbjct: 302 PAAVGDQNETVGVPYYMAKWNEWAKAFVTEFNEQHKAGYGLNDATDKLFFEPADAAGWT- 360

Query: 331 CQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP 390
                           +     D   ++           G            +K   F  
Sbjct: 361 --------------AKDMKVSSDIDDLNNIAASATSGEPGNNGNALALLQIRDKAIAFTG 406

Query: 391 VAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSF 450
            +G     +  +Y  + I  L  +   +  +    Q +   I     +  GV L EEL  
Sbjct: 407 QSG-----SFEDYINSLISTLGVDSQQAIRMVDNEQALIGQIEGKRQSISGVLLDEELMN 461

Query: 451 LIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           ++K +QSYN + ++I   D+ML  L+  V
Sbjct: 462 MVKFQQSYNAAARVITAMDEMLDVLVNRV 490


>gi|295401181|ref|ZP_06811154.1| flagellar hook-associated protein FlgK [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294976774|gb|EFG52379.1| flagellar hook-associated protein FlgK [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 530

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 71/524 (13%), Positives = 160/524 (30%), Gaps = 47/524 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+               NI NA+   Y R+                      
Sbjct: 3   STFHGLEVAKRGMFTQQAALYVTAHNIANANTPGYSRQRVNFVETEPFPPASMNRPQIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +    +  D      +S +G         A  E +  ++      +  +
Sbjct: 63  QMGTGVEAGSIQRIRDSFLDYQYRNEASKLGYWSARSEAIAKMEDIM-NEPSEFGLSKAM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++  +SL+  S N   +     V      V ++FN     ++++R D  +EI+  +  + 
Sbjct: 122 TQFWESLQDLSANPENEGARAVVRQRGIAVAESFNYLYNSLKQVRDDLGQEIKTGLLEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L +++ +ND IK    + +  +D  D+RD L+ ++S+   +      +    +  ++G
Sbjct: 182 SILKQISELNDQIKAIEPNGYLPNDLYDKRDALIDELSKYFQVKVETVPSGGNALDIAEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD---- 280
                 V +D +               +F D     +       +  +  +         
Sbjct: 242 IYEISLVNQDGSTIGKIVTKNGYSKLSVFPDPTNPDAYVSEIRIEDALGNITTTISYDKF 301

Query: 281 -------------------------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
                                       P     LD+MA      F+E+           
Sbjct: 302 NDLANGRIKSLIESYGYGSDPNNVKGYYPEMLADLDKMAYSFAKMFNEQHQKGYGLNGST 361

Query: 316 GLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLI 375
           G    D             +          +  +      S       N   L+   D+ 
Sbjct: 362 GKNFFDMTLSGPPTEKGAAATIKVHKDIMDNLSNIAASSNSGESGNGNNALYLSMIKDVQ 421

Query: 376 NHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
                +   +      +   T+ T+  + +  IG +  +   +  +   ++ +   +   
Sbjct: 422 ITNGSATLPSGQPVSGSLPITSGTVQTFYQGLIGKIGADGQQAERMKTNAETLATSVDNK 481

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +   V+L EE++ +IK + +YN + ++I   D+ML  ++  +
Sbjct: 482 RQSVSSVSLDEEMTNMIKFQHAYNAAARMITAIDEMLDKIINNM 525


>gi|304317611|ref|YP_003852756.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779113|gb|ADL69672.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 478

 Score =  256 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 77/495 (15%), Positives = 173/495 (34%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + Q       NI NA+   Y R+    +                
Sbjct: 1   MSTFQGLEIAKTGLFASQQALNLTGHNISNANTPGYTRQVIDLSAIAPPTTYGMADQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   R       D+     ++ +G+        +  E +  ++  +   T  I
Sbjct: 61  AIGGGVNVDGYRQIRDQYLDQQYRRENTTLGEWETKSDTLSAIEGIL-NEPSDTGITTVI 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               +SL+  SKN     +   V +N   +    N+  + +     + +  IE  +  + 
Sbjct: 120 DNFFNSLQELSKNPESLEVRAVVRENGVSLTDTINSVYQHLDDKENELNSTIESRVQEIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +   ++ +N+ I     +   A+D  DQR++L+ K+SEI+ I+T   +N +  +  S  
Sbjct: 180 SYADRISKLNNEIYRFELTGQTANDLRDQRNLLVDKLSEIVNITTYEDSNKNFRIDISGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++ +   +        P+   G ++          G            +P
Sbjct: 240 ALVDGSNAYTMSVDSTGTVKWDLAGTPVNPTGGILKGLLDMRDGDGTNGV------KGIP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            ++ QL+++A  +   F+ +       +   G+   +      +   +            
Sbjct: 294 YYKEQLNKLAYNIATVFNAQHAAGYGIDGSTGVNFFNITDSTYDPTAEYAKN-------I 346

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           + +   L D G        +  +L G    I +         + D         T  ++ 
Sbjct: 347 KVSSDILADDGLQKIAAASDPNSLPGDNTNILNLIS------LRDAKISGLNGGTFDDFV 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
            + I  L  +   ++ +      +   +  +  +  GV+L EE++ ++K ++SY  S ++
Sbjct: 401 SSLISNLGVDAQQANMMQTNQSAMVKQVDYNRQSVSGVSLDEEMTNMLKYQKSYEASARM 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITVMDELLDTLINKM 475


>gi|312793870|ref|YP_004026793.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181010|gb|ADQ41180.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 527

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 81/540 (15%), Positives = 171/540 (31%), Gaps = 83/540 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSSKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGMGADVQSLEQIRDMFLDMQYRNEYSRQGEYEIKADNLNFIEAIF-NEPSDTGLSAVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V   A  +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRASALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
              ++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + G 
Sbjct: 179 IALQIADLNKQIFILELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAGGE 238

Query: 226 TLFETVP------------------RDINFEKMNSYTVTSESNPIFIDG----VVVSSNQ 263
           TL                        +    + N     S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSRIERNSGFESNGLPTQFNPDDPRSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV--------------------------VPIFQNQLDEMARVL 297
              +  G++K LL +RD V                          +P + N+L+E AR L
Sbjct: 299 VLNIKSGELKGLLDMRDGVGGLDEDIKDEKGKIVVDVPNKNSFTGIPYYLNRLNEFARKL 358

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
           I  F+E      +              +         +  I V+    ++ + +     V
Sbjct: 359 IEKFNELHKKGWSLNGQNKGINFF---EPPVGQKFFYARDIKVSDAIMNDLNNIATTYDV 415

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +     N               D             I       ++ ++ I  L  +   
Sbjct: 416 NNLPGGN---------------DLVVDMLKLRNDTSIFKEGKFEDFLKSLISNLGVDSQG 460

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           + +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML T++ 
Sbjct: 461 AKNFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDTIVN 520


>gi|158321541|ref|YP_001514048.1| flagellar hook-associated protein FlgK [Alkaliphilus oremlandii
           OhILAs]
 gi|158141740|gb|ABW20052.1| flagellar hook-associated protein FlgK [Alkaliphilus oremlandii
           OhILAs]
          Length = 522

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 85/516 (16%), Positives = 175/516 (33%), Gaps = 39/516 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PEN 49
           S    F  A++    + +       N+ N + K Y R+      S               
Sbjct: 3   STFTGFTTAKSGLFASQRALDITGHNLANVNTKGYSRQRLEQVQSTPLKLAGGQGMLGTG 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V             D      ++A G         A  E +  ++  +   T  I ++ +
Sbjct: 63  VDTTAIHQLRNEFLDYKYRDEATAFGYWDAKADGLAFIESIM-NEPSDTGITKVIDQMFE 121

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           S    SKN +       V   A     + N +  +++K+  D + E++  + ++  +  +
Sbjct: 122 SFHELSKNPNNITTRALVRQRATTFTNSVNHTYNQLEKMVVDYNFEVQSMVKSINTYGEQ 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN-----NDMVVYTSDG 224
           +  +ND I        +A+D  DQR+VL+ ++S+I+ I  +   N     +  +V    G
Sbjct: 182 IARLNDQILRFEVDGSNANDLRDQRNVLIDELSKIVDIDVMEVTNPSTLGHKQMVIKVGG 241

Query: 225 TTLFETVPRDINFEKMNSYTV-----------TSESNPIFIDGVVVSSNQGSAVPKGKIK 273
             L           K N                 E           + +       G++ 
Sbjct: 242 KPLVYHNDFTGLEAKQNLKKPFDGMDKSIHIYDIEWADGTSFYKSENVDTDVDKIGGELG 301

Query: 274 ALLQIRDS------VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIA--DGIKD 325
           A+L +RD        VP + N+L++  +V     +E        +   G       GI  
Sbjct: 302 AILTMRDGKDGKNKGVPHYINELNKFVKVFANRINEIHLKGYGLDGEAGRAFFTAKGIST 361

Query: 326 LDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP--DLINHYCDSFN 383
                 +     +       +    +          + +  N+A     +L+ +      
Sbjct: 362 PTGAATKDADGRVTSVDATVAGLGNINASNIRISLDIEDPNNIAASKEKNLLPNDGSIML 421

Query: 384 KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
                    G+ T     ++ ++ IG L   + ++        V+ N I +   +  GV+
Sbjct: 422 DIVNLRHDQGMFTEGKPEDFIKSLIGTLGVEKEEAGRNADNQAVLLNEIDKKRMSISGVS 481

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             EEL+ ++K + +YN S +++   D+ML  L+  +
Sbjct: 482 EDEELANMVKFQHAYNASARMMTTIDEMLDVLINRI 517


>gi|302390139|ref|YP_003825960.1| flagellar hook-associated protein FlgK [Thermosediminibacter oceani
           DSM 16646]
 gi|302200767|gb|ADL08337.1| flagellar hook-associated protein FlgK [Thermosediminibacter oceani
           DSM 16646]
          Length = 465

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 85/495 (17%), Positives = 173/495 (34%), Gaps = 54/495 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+       +   ++  N+ NA+   Y R+  +   +               
Sbjct: 3   SSFFGIEIAKRALFAQQRAQENVSHNVANANTPGYSRQRPVMEATYTKPWAGMYTAAGAV 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V           D      +S++GQ  +        E +  ++  +   +  +
Sbjct: 63  QAGTGVRVADIVRIRDAFADMQYRDENSSLGQWSVQTDILRQVEAVF-NEPSDIGVSSVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++   +LE  SKN     + +TV + A  +    N  A ++ +I  D +  I +++  + 
Sbjct: 122 TQFWQALEELSKNPEAIEIRETVKERAVTLADTVNHVATKLTEILDDINFRISVKVDEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               ++  +N  I+    +   A D  D+RDVLL  +S+++ I+T    N    V     
Sbjct: 182 TLARQIADLNAQIQQMEITGITASDLRDKRDVLLDDLSKLVNINTYEDENGVFTVNVGGA 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +  +    ++F+                D      N    + KG++K LL++RD  V 
Sbjct: 242 ILVKGSDYEVMSFDGA--------------DIKWQVYNTPVNIAKGELKGLLELRDQKVK 287

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + + +   A+ L G F++      +    PG         L   +       + VN   
Sbjct: 288 TYLDSIKTFAQTLAGEFNKIHKSGYDLMGDPGEDFFIYNNSLSGSI-------LSVNQSI 340

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            ++   +            +   + G         D                  TL EY 
Sbjct: 341 LNDVKKIAAAQ--------DPDAVPGDNRNALKLADLKYMKLTTL-------GGTLDEYY 385

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
            + I  L  +   S  +    + + + + E       V+L EE+S +I  + +YN + ++
Sbjct: 386 GSLIARLGIDSQQSIRMTESQEFMVSQLDEQRKAVSSVSLDEEMSRMIMYQHAYNAAARM 445

Query: 465 IMFTDKMLQTLLEGV 479
           I   D+ML T++  +
Sbjct: 446 ITAIDEMLDTIVSRM 460


>gi|150388562|ref|YP_001318611.1| flagellar hook-associated protein FlgK [Alkaliphilus
           metalliredigens QYMF]
 gi|149948424|gb|ABR46952.1| flagellar hook-associated protein FlgK [Alkaliphilus
           metalliredigens QYMF]
          Length = 493

 Score =  253 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 75/499 (15%), Positives = 170/499 (34%), Gaps = 34/499 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PEN 49
           S  + FN A +    + +    +  NI NA+   Y R+      S               
Sbjct: 3   STFSGFNTATSGIFASQRSLDVVGHNIANANTPGYSRQRLEQAASTPMSLYGGKGMLGTG 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V  V  +       D       +A+G     +      E +  ++  + S      +L  
Sbjct: 63  VDTVAIKQMRSEFLDFKYRDEVNALGYWETKEYGLEFIESIF-NEPSDTSVATVTDELFA 121

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
             E  SKN         V +         N + ++++K+  D + +I   +S++  +  +
Sbjct: 122 GFEELSKNPESITARTVVRERGIAFTNTMNQTYKQLEKLAKDVNSDINATVSSINSYADQ 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND---MVVYTSDGTT 226
           +  +N  I    A    A+D  D+R++L+  +S+++ +     N+      +V   +G  
Sbjct: 182 IAELNKQIYRFEADGSSANDLRDRRNLLIDDLSKLVNVEVRDVNDGYGSSKMVVQINGQP 241

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV---- 282
           L                +   +   +        S       KG++ ALL +RD      
Sbjct: 242 LVNHDQAYKLDATATKSSTFDDEINMTEIKWANGSVVNQDSLKGELGALLTLRDGTTKDN 301

Query: 283 --VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV 340
             +P +  QL++       + +       + +   G+         D    + I  ++ +
Sbjct: 302 KGIPFYIEQLNDFVGSFAKAVNGIHEDGLDLDGDEGVAFFTDGNTGDQITAKNIQISLEI 361

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
           +                +       + + G         +  +    FD         T 
Sbjct: 362 DRD---------PRKIAAATMGELGEPVVGDGSNALRLTELRHAQMSFDNGEFKG---TP 409

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
            ++  + I  L  N  ++  +     ++ N I     +  GV+L EE++ +++ + +YN 
Sbjct: 410 EDFMISLIANLGVNTQEATRMASNQSILTNQIDRQRQSISGVSLDEEMANMVRFQHAYNA 469

Query: 461 SNKLIMFTDKMLQTLLEGV 479
           S +++   D+M+  ++  +
Sbjct: 470 SARMVTTMDEMIDVIINRM 488


>gi|83589598|ref|YP_429607.1| flagellar hook-associated protein FlgK [Moorella thermoacetica ATCC
           39073]
 gi|83572512|gb|ABC19064.1| Flagellar hook-associated protein [Moorella thermoacetica ATCC
           39073]
          Length = 486

 Score =  251 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 91/501 (18%), Positives = 189/501 (37%), Gaps = 44/501 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
                FN A        +   +   NI NA+ + Y R+  + T +               
Sbjct: 3   GTFFGFNTALRGMQAQQRGIYTTSHNIANANTEGYTRQQVVLTATPAYPVPAMNRPGGQG 62

Query: 47  ---PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                 V     R       D  +   + ++GQ + +Q      E++  ++  +   +  
Sbjct: 63  WQIGTGVDSQETRRLRDEFLDTQIRRETGSLGQWQQIQDVLQQVEVVF-NEPSDTGLSTL 121

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +S+   + +  SKN     +  TV++ A  + + F  SA ++ +I+ D D+ IEL++  +
Sbjct: 122 MSQFWAAWQELSKNAESSPVRTTVVETANALAEAFRHSAAQLNQIKDDIDQSIELKVKEV 181

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
                ++  +N  IK   A+    +D +DQRD+LL ++S+II  S             +D
Sbjct: 182 NSLAQQIADLNGQIKNIVAAGDQPNDLMDQRDLLLDRLSKIIDFSVEKNMVTVNDEEIAD 241

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV-----VVSSNQGSAVPKGKIKALLQI 278
           G    +   + +        ++ +       D          S        G+IK L + 
Sbjct: 242 GQIKIKLGDQYLVNVDGTDGSIVNMVAAGTDDANKGKIFWEDSGDEIVPANGEIKGLQKA 301

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETI 338
           R+ V   +   L+ +A  L  + +E+  +  +     G        D D          I
Sbjct: 302 REDV-QTYLTNLNTLAGELAAAINEQHILGKDLTGASGEDFFVIGDDSDTITA----ANI 356

Query: 339 CVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNV 398
            VNPQ  ++ S +    + +     +  N      L +   ++ +             N 
Sbjct: 357 QVNPQIMADVSKIA--AAANDGGPGDGSNALAIAQLQHKLIENLD-------------NT 401

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
           T  +Y +N    L  +  ++  +     V+ + ++    +  GV+L EE++ +++  ++Y
Sbjct: 402 TFDDYYKNFTAKLGVDAHEATRMTTNQGVLVDQLTNRKESISGVSLDEEMANMLQYLRAY 461

Query: 459 NISNKLIMFTDKMLQTLLEGV 479
             S ++I   D ML  ++ G+
Sbjct: 462 EASARMITTLDSMLDKIINGM 482


>gi|312109475|ref|YP_003987791.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y4.1MC1]
 gi|311214576|gb|ADP73180.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y4.1MC1]
          Length = 534

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 78/529 (14%), Positives = 184/529 (34%), Gaps = 53/529 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+               NI NA+   Y R+                      
Sbjct: 3   STFHGLEVAKRGMFTQQAALYVTAHNIANANTPGYSRQRVNFVETEPFPPASMNRPQIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +    +  D      +S +G         A  E +  ++      +  +
Sbjct: 63  QMGTGVEAGSIQRIRDSFLDYQYRNEASKLGYWSARSEAIAKMEDIM-NEPSEFGLSKAM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++  +SL+  S N   +     V      V ++FN     + +IR D  +EI+  +  + 
Sbjct: 122 TQFWESLQDLSANPENEGARAVVRQRGIAVAESFNYLYTSLSQIRDDLGQEIKTGLLEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L +++ +ND IK    + +  +D  D+RD L+ ++S+   +      +    +  ++G
Sbjct: 182 SILKQISELNDQIKAVEPNGYLPNDLYDKRDALVDELSKYFQVKVETVPSGGNALDIAEG 241

Query: 225 --------------TTLFETVPRDINFEKMNSYTVTSESNPIFI----------DGVVVS 260
                           + +     ++ +          +   ++          +   +S
Sbjct: 242 IYEISLVNQDGSTVKIVTKDGYSKLSVDPPVDPVNDPTNPDGYVSEIRIEDALGNITTIS 301

Query: 261 SNQGSAVPKGKIKALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNS 311
            ++ + +  G+IK+L++               P     LD+MA      F+ +     + 
Sbjct: 302 YDKFNDLASGRIKSLIESYGYGSDPNNVKGYYPEMLADLDKMAYSFATMFNAQHREGYDL 361

Query: 312 ENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVK-NLAG 370
            N  G+   +     DN   +G + +I V+    S+   +    +  +    N    L+ 
Sbjct: 362 NNSNGVDFFEMNV-SDNTTGKGAAASIKVSDVIMSDLGKIAASSNSEESGNGNNALYLSM 420

Query: 371 YPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFN 430
             D+      +   +     V+   T+ T+  + +  IG +  +   +  +   ++ +  
Sbjct: 421 IKDVQITNGSAALPSGSGTTVSVPITSGTVQTFYQGLIGKIGVDGQQAERMKTNAETLAT 480

Query: 431 HISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            +     +   V+L EE++ +IK + +YN + ++I   D+ML  ++  +
Sbjct: 481 SVDNKRQSVSSVSLDEEMTNMIKFQHAYNAAARMITAIDEMLDKIINDM 529


>gi|312877567|ref|ZP_07737526.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795642|gb|EFR12012.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 522

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 79/535 (14%), Positives = 170/535 (31%), Gaps = 78/535 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSSKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  + 
Sbjct: 60  VGMGADVQSLEQIRDMFLDMQYRNEYSRQGEYEIKADNLNFIEAIF-NEPSDTGLSAVVD 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V   A  +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRASALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAGGE 238

Query: 226 TLFETV------------------PRDINFEKMNSYTVTSESNPIFIDG----VVVSSNQ 263
           TL                        +            S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSKIMRKSGFDSNGLPTGFKPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV---------------------VPIFQNQLDEMARVLIGSFS 302
              +  G++K LL +RD V                     +P + N+L+E A+ LI  F+
Sbjct: 299 VLNIKSGELKGLLDMRDGVGGLDEDSQAGVDVPNKNSFTGIPYYLNRLNEFAQKLIEKFN 358

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFL 362
           E      +              +         +  I V+    ++ + +     V+    
Sbjct: 359 ELHTQGWSLNGQNTGINFF---EPPVGQTFFYARYIKVSDAIMNDLNNIATTYDVNNLPG 415

Query: 363 WNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLH 422
            N               D             I       ++ ++ I  L  +   + +  
Sbjct: 416 GN---------------DLVVDMLKLRNDTSIFKEGKFEDFLKSLISNLGVDSQGAKNFA 460

Query: 423 MKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
              +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML T++ 
Sbjct: 461 ENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDTIVN 515


>gi|312127297|ref|YP_003992171.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777316|gb|ADQ06802.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 525

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 80/538 (14%), Positives = 169/538 (31%), Gaps = 81/538 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSAKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGMGADVQSLEQIRDMFLDIQYRNEYSRQGEYEIKADNLNFIESIF-NEPSDTGLSSVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V    + +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRGQALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAGGE 238

Query: 226 TLFETV------------------PRDINFEKMNSYTVTSESNPIFIDG----VVVSSNQ 263
           TL                        +      N     S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSKIMRKSGFDSNGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVLIG 299
              +  G++K LL +RD V                        +P + N+L+E A+ LI 
Sbjct: 299 VLNIKSGELKGLLDMRDGVGGLSEDMTVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKLIE 358

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+E      +              +         +  I V+    ++ + +      S 
Sbjct: 359 KFNELHTQGWSLNGQNTSINFF---EPPVGQTFFYARYIKVSDAIMNDLNNIATTYDASS 415

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               N               D             I       ++ ++ I  L  +   + 
Sbjct: 416 LPGGN---------------DLVVDMLKLRNDTSIFKEGKFEDFLKSLISNLGVDSQGAK 460

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  L+ 
Sbjct: 461 NFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVLVN 518


>gi|222529660|ref|YP_002573542.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456507|gb|ACM60769.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 525

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 79/538 (14%), Positives = 169/538 (31%), Gaps = 81/538 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSAKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGLGADVQSLEQIRDMFLDVQYRNEYSRQGEYEIKADNLNFIEAIF-NEPSDTGLSSVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAGGE 238

Query: 226 TLFETV------------------PRDINFEKMNSYTVTSESNPIFIDG----VVVSSNQ 263
           TL                               N     S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYQLETDKSKIMRKSGFDSSGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVLIG 299
              +  G++K LL +RD V                        +P + N+L+E A+ LI 
Sbjct: 299 VLNIKSGELKGLLDVRDGVGGLDEDVSVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKLIE 358

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+E      +              +         +  I V+    ++ + +      S 
Sbjct: 359 KFNELHTQGWSLNGQNTGINFF---EPPVGQTFFYARYIKVSDAIMNDLNNIATTYDASS 415

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               N               D             +       ++ ++ I  L  +   + 
Sbjct: 416 LPGGN---------------DLVVDMLKLRNDNSVFKEGKFEDFLKSLISNLGVDSQGAK 460

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  ++ 
Sbjct: 461 NFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVIVN 518


>gi|312622116|ref|YP_004023729.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202583|gb|ADQ45910.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 525

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 78/538 (14%), Positives = 169/538 (31%), Gaps = 81/538 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSAKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGMGADVQSLEQIRDMFLDIQYRNEYSRQGEYEIKADNLNFIESIF-NEPSDTGLSSVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   +V  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFIVQIAGGE 238

Query: 226 TLFETV------------------PRDINFEKMNSYTVTSESNPIFIDG----VVVSSNQ 263
           TL                               N     S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSKIMRKSGFDSSGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVLIG 299
              +  G++K LL +RD V                        +P + N+L+E A+ LI 
Sbjct: 299 VLNIKSGELKGLLDMRDGVGGLDEDMVVNGQPVDVPNKNYFTGIPYYLNRLNEFAQKLIE 358

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+E      +              +         +  I V+    ++ + +      S 
Sbjct: 359 KFNELHTQGWSLNGQNTNINFF---EPPVGQTFFYARYIKVSDAVMNDLNNIATTYDASS 415

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               N               D             +       ++ ++ I  L  +   + 
Sbjct: 416 LPGGN---------------DLVVDMLKLRNDNSVFKEGKFEDFLKSLISNLGVDSQGAK 460

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +     +V+   +        GV++ EE++ LI+ +  +  S ++I   D+ML  ++ 
Sbjct: 461 NFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIRYQHGFQASARMINAFDEMLDVIVN 518


>gi|332798814|ref|YP_004460313.1| flagellar hook-associated protein FlgK [Tepidanaerobacter sp. Re1]
 gi|332696549|gb|AEE91006.1| flagellar hook-associated protein FlgK [Tepidanaerobacter sp. Re1]
          Length = 459

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 68/490 (13%), Positives = 169/490 (34%), Gaps = 47/490 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PEN 49
           S       A+       +   ++  N+ NA+   Y R+  +   +               
Sbjct: 3   SSFLGIEIAKTALFANQRAQQTVAHNVSNANTPGYSRQRVILEATHTAYGMGANWQIGTG 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V V           D+     +S++GQ  +        E +  ++  +      +++   
Sbjct: 63  VKVSDVDRIRDEFTDRQYRNENSSLGQWNIQSDILKQVEAVF-NEPSDIGIASVLNEFWA 121

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
            LE+ SK+ +     +TV +    +    N +  ++  I +D +  I ++++ +    ++
Sbjct: 122 GLETLSKDAASQEARETVKEKGITLANTINHAVTQLNDIVSDINYRISIQVNEVNSIANQ 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N  I+        A D  D RD+LL ++S ++   +    N    +       +  
Sbjct: 182 IAQLNLQIRQAETGGASAADLKDSRDLLLDQLSNLVQFESYEDENGIFSINVGGAILVKG 241

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
               ++ F+   +                   +    + KG++K L+++RD  +  + +Q
Sbjct: 242 PDSANMEFDTSVANGT----------IKWKEYSSDVRILKGELKGLIELRDDKLENYLDQ 291

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           LD+  +     F+       N +   G+   +    + +     +S    +      +  
Sbjct: 292 LDKFTQTFADEFNAIHETGYNLDGETGIKFFEYANGVLSVNPDIVSNPSKIAAAEEED-- 349

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                             +     +     +   K    D       N T+ +Y    I 
Sbjct: 350 -----------------GIPSDNRIALELANLRYKTISID-----GRNCTIDDYYGTIIA 387

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +  +  ++         + + + E    T  V+L EE++ +I+    YN +++++   D
Sbjct: 388 KIGVDSQEATRAADSQAFMVSQLDERRQMTSSVSLDEEMTKMIQYLHGYNAASRIVTTVD 447

Query: 470 KMLQTLLEGV 479
           +ML T++  +
Sbjct: 448 EMLDTIINRM 457


>gi|302871568|ref|YP_003840204.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574427|gb|ADL42218.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 525

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 80/538 (14%), Positives = 169/538 (31%), Gaps = 81/538 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSSKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGMGADVQSLEQIRDMFLDMQYRNEYSRQGEYEIKADNLNFIESIF-NEPSDTGLSAVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+I+  +     +   VV  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIVDTTAYEDKDGRFVVQIAGGE 238

Query: 226 TLFETVPRDINFEKMN------------------SYTVTSESNPIFIDG----VVVSSNQ 263
           TL             +                       S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSKIMRKSGFDSSGQPTGFKPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVLIG 299
              +  G++K LL +RD V                        +P + N+L+E A+ LI 
Sbjct: 299 VLNIKSGELKGLLDMRDGVGGLDEDVSVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKLIE 358

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+E      +              +         +  I V+    ++ + +      S 
Sbjct: 359 KFNELHTQGWSLNGQNTGINFF---EPPVGQTFFYARYIKVSDAIMNDLNNIATTYDASN 415

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               N               D             I       ++ ++ I  L  +   + 
Sbjct: 416 LPGGN---------------DLVVDMLKLRNDTSIFKEGKFEDFLKSLISNLGVDSQGAK 460

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  ++ 
Sbjct: 461 NFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVIVN 518


>gi|323706357|ref|ZP_08117922.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534319|gb|EGB24105.1| flagellar hook-associated protein FlgK [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 478

 Score =  247 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 75/495 (15%), Positives = 168/495 (33%), Gaps = 36/495 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+     + Q       NI NA+   Y R+    +                
Sbjct: 1   MSTFQGLEIAKTGLFASQQALNLTGHNISNANTPGYTRQVIDLSAIAPPTTYGMADQWGK 60

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   R       D+     ++ +G+        +  E +  ++  +   T  +
Sbjct: 61  AIGGGVNVDGYRQIRDQFLDQQYRRENTTLGEWETKSDTLSAIEDIL-NEPSDTGITTVL 119

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               +SL+  SKN     +   V +N   +    NT  + +       +  I+  +  + 
Sbjct: 120 DNFFNSLQDLSKNPESLEVRAEVRENGISLTDTINTIYQHLDDQENQINSTIQSRVQQIN 179

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +  +++ +N+ I     +   A+D  DQR++L+ ++SEI+ I+T   +N +  V  S  
Sbjct: 180 SYADQISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSEIVNINTYEDSNGNFRVDISGQ 239

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +       ++ +   +        P+   G ++          G            +P
Sbjct: 240 ALVDGNNAYTMSIDNTGTIKWDLAGTPVNPTGGILKGLLDMRDGDGTNGV------KGIP 293

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            ++ QL++ A  L   F+ +       +   G+   +      N   +        +   
Sbjct: 294 YYEQQLNQFAYNLATVFNAQHAAGYGLDGSTGINFFNITDTTYNPTAEYAKNIQVSSDIL 353

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
             +        S +     +  N+     L +                    N T  ++ 
Sbjct: 354 ADDGLQKIAAASSASSLPGDNTNVLNLIALRDTKISGL-------------NNGTFDDFI 400

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
            + I  L  +   ++ +      +   +  +  +  GV+L EE++ ++K ++SY  S ++
Sbjct: 401 SSLISNLGVDAQQANQMQTNQSTMVKQVDYNRQSVSGVSLDEEMANMLKYQKSYEASARM 460

Query: 465 IMFTDKMLQTLLEGV 479
           I   D++L TL+  +
Sbjct: 461 ITVMDELLDTLINKM 475


>gi|196249402|ref|ZP_03148100.1| flagellar hook-associated protein FlgK [Geobacillus sp. G11MC16]
 gi|196211159|gb|EDY05920.1| flagellar hook-associated protein FlgK [Geobacillus sp. G11MC16]
          Length = 528

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 77/524 (14%), Positives = 172/524 (32%), Gaps = 49/524 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+           +   NI NA+ + Y R+                      
Sbjct: 3   STFHGLEAARRAMMAQQAALYTTGHNIANANTEGYTRQRVQLEATTPFPTPGLNRPNIPG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      +S +G         A  E +  ++  ++     +
Sbjct: 63  QMGTGVEAASVERVREYFLDIQYRGENSKLGYWEARADAVAKMEDIM-NEPSDSGLAKTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   +L+  S +   +     V      VV+ F+  +  + +IR D   +I + ++ + 
Sbjct: 122 DQFWQALQDLSTHPENEGARSVVRQRGLAVVETFHYLSNSLTQIRTDIGTQIGVTVTKIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST--------------- 209
             L +++ +N  I     + +  +D  D+RD L+ ++S+ I I                 
Sbjct: 182 SILDQISKLNAQIAEIEPNGYLPNDLYDERDRLVDELSKFIDIQVEKHPVGGNALPAAEG 241

Query: 210 ---IVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
              +   N +  VY   G T       D +    +    T     +    +  ++   S 
Sbjct: 242 TYDVYILNGNEKVYLVQGRTASSISFPDGSDVDDDGVRETPPDTGVGALDIGGTAVSFST 301

Query: 267 VPKGKIKALLQIRD-----------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVP 315
           +P GK++ L++               + P     LD++A      F+             
Sbjct: 302 LPNGKLRGLIEGYGYYENGVNGNVEGLYPEMLANLDKLAYTFGTLFNAVHEQGYGLNGNT 361

Query: 316 GLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLI 375
           GL    G+  ++         +   +    +  +  ++ G+ +              +  
Sbjct: 362 GLAFFSGLDQVNGAAKTIALASDIDDLDNIAAATRDKESGNGNNAINLANVRSLLLSNTT 421

Query: 376 NHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
               D  + +     +    T+ T+    +  IG L      ++ +   S+ +   + E 
Sbjct: 422 VSLQDGISVDLA--SLGLPLTSGTIETNYQGWIGQLGVAGEQANRMKSNSETLRQSVEER 479

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +   V+L EE+  +IK + +YN + + I   D+ML  ++ G+
Sbjct: 480 RQSVSAVSLDEEMMNMIKFQHAYNAAARQITAIDEMLDKIINGM 523


>gi|261420582|ref|YP_003254264.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC61]
 gi|319768252|ref|YP_004133753.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC52]
 gi|261377039|gb|ACX79782.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC61]
 gi|317113118|gb|ADU95610.1| flagellar hook-associated protein FlgK [Geobacillus sp. Y412MC52]
          Length = 531

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 71/527 (13%), Positives = 172/527 (32%), Gaps = 52/527 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------------- 44
           S       A+           +   NI NA+ + Y R+                      
Sbjct: 3   STFHGLEAARRGMMAQQAALYTTSHNIANANTEGYTRQRVQLQPTPPFPTPGLNRPNIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      +S +G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVEASSVERVREYFLDIQYRGENSKLGYWEARADAVSKMEDIM-NEPSDSGLAKTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   +L+  S +   +     V      VV+ F+  +  + +IR D   +I   ++ + 
Sbjct: 122 DQFWQALQDLSTHPENEGARSVVRQRGLAVVETFHYLSNSLAQIRTDIGTQIGTTVTEIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRN---------NN 215
             L++++ +N+ I     + +  +D  D+RD L+ ++S+ + I                 
Sbjct: 182 SLLNQISALNERIAEIEPNGYLPNDLYDERDRLVDQLSQYMEIGVEKHPTGGNALPMAEG 241

Query: 216 DMVVYTSDG----TTLFETVPRDINFEKMNSYTVTS-----ESNPIFIDGVVVSSNQGSA 266
              VY  +G      +       ++F   +            ++ +    + +++   S+
Sbjct: 242 TYDVYVMNGSAKVYLVQGRNAASVSFPDGSDVDGDGVKEMPPASGVNALNIGITAVSFSS 301

Query: 267 VPKGKIKALLQIRD--------------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSE 312
           +P GK++ L++                  + P   + LD++A      F+          
Sbjct: 302 LPNGKLRGLIEGYGYQTGTDASGQPIVKGLYPDMLSNLDKLAYTFGTVFNAVHQQGYGLN 361

Query: 313 NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP 372
                   DGI  +              +    +  +   + G+ +              
Sbjct: 362 GSTKRPFFDGIGAVSGAAKTIKLAADIDDLANIAASTKSGETGNGNNAINLANVRSLLLS 421

Query: 373 DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
           +      D  +       +    ++ T+    +  IG L  +   ++ +   S+ +   +
Sbjct: 422 NATVSLQDGIS--VNLASLNLPLSSGTVETNYQGWIGQLGVDGEQANRMKTNSETLRQSV 479

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            E   +   V+L EE+  ++K + +YN + + I   D+ML  L+ G+
Sbjct: 480 EEKRQSVSSVSLDEEMMNMVKFQHAYNAAARQITVIDEMLDKLINGM 526


>gi|146296674|ref|YP_001180445.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410250|gb|ABP67254.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 525

 Score =  246 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 81/538 (15%), Positives = 170/538 (31%), Gaps = 81/538 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS       A+       +       N+ NA    Y R+                     
Sbjct: 1   MS-FYGLEIARTGIYVNRKGLEVTSHNVANASTPGYTRQVLNVKSIPPSNRVGIYDPKFQ 59

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGMGADVQSLVQIRDMFLDMQYRNEYSRQGEYEIKADNLNFIEAIF-NEPSDTGLSAVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           +   SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 QFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKILEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+II  +     +   +V  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIIDTTAYEDKDGRFIVQIAGGE 238

Query: 226 TLFETV------------------PRDINFEKMNSYTVTSESNPIFIDG----VVVSSNQ 263
           TL                        +      N     S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSKIMRKSGFDSNGLPTGFNPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVLIG 299
              V  G++K LL +RD +                        +P + N+L+E A+ LI 
Sbjct: 299 VLNVKSGELKGLLDMRDGIGGLNEDIVVNGQPVDVPNKNSFTGIPYYLNRLNEFAQKLIE 358

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+E      +              +         +  I V+    ++ + +     V+ 
Sbjct: 359 KFNELHTQGWSLNGQNTGINFF---EPPVSQTFFYARYIKVSDAIMNDLNNIATTYDVNN 415

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               N               D             I       ++ ++ I  L  +   + 
Sbjct: 416 LPGGN---------------DLVVDMLRLRNDTSIFKEGRFEDFLKSLISNLGVDSQGAK 460

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  ++ 
Sbjct: 461 NFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVIVN 518


>gi|56421672|ref|YP_148990.1| flagellar hook-associated protein FlgK [Geobacillus kaustophilus
           HTA426]
 gi|56381514|dbj|BAD77422.1| flagellar hook-associated protein 1 (HAP1) [Geobacillus
           kaustophilus HTA426]
          Length = 531

 Score =  246 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 73/527 (13%), Positives = 169/527 (32%), Gaps = 52/527 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+           +   NI NA+ + Y R+                      
Sbjct: 3   STFHGLEAARRAMMAQQAALYTTGHNIANANTEGYTRQRVQLKATPPFPTPGLNRPNIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      +S +G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVEASSVERVREYFLDIQYRGENSKLGYWEARADAVSKMEDIM-NEPSDSGLAKTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   +L+  S +   +     V      VV+ F+  +  + +IR D   +I   ++ + 
Sbjct: 122 DQFWQALQDLSTHPENEGARSVVRQRGLAVVETFHYLSNSLAQIRTDLGTQIGTTVTEIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L++++ +N+ I     + +  +D  D+RD L+ ++S+ + I           +  ++G
Sbjct: 182 SLLNQISALNERIAEIEPNGYLPNDLYDERDRLIDQLSQYMEIGVEKHPTGGNALPMAEG 241

Query: 225 T---------------------TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
           T                      +  +   D++ + +         N + + G  VS + 
Sbjct: 242 TYDVYVMNGSAKVYLVQGRTASVVSFSDGSDVDGDGVKEMPPDLGINTLDVSGTTVSFSS 301

Query: 264 -----------GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSE 312
                      G     G   +   I   + P     LD++A      F++         
Sbjct: 302 LPNGKLRGLIEGYGYQTGTDASGQPIVKGLYPDMLANLDKLAYTFGKVFNDVHQQGYGLN 361

Query: 313 NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP 372
                   DGI  +              +    +  +   + G+ +              
Sbjct: 362 GSTNHPFFDGIGAVSGAAKTIKLAADIDDLANIAASTKSGETGNGNNAINLANVRSLLLS 421

Query: 373 DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
           +      D  +       +    ++ T+    +  IG L  +   ++ +   S+++   +
Sbjct: 422 NATVSLQDGIS--VNLASLNLPLSSGTVETNYQGWIGQLGVDGEQANRMKSNSEILRQSV 479

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            E   +   V+L EE+  +IK + +YN + + I   D+ML  L+ G+
Sbjct: 480 EEKRQSVSSVSLDEEMMNMIKFQHAYNAAARQITVIDEMLDKLINGM 526


>gi|39998134|ref|NP_954085.1| flagellar hook-associated protein FlgK [Geobacter sulfurreducens
           PCA]
 gi|39985080|gb|AAR36435.1| flagellar hook-associated protein FlgK [Geobacter sulfurreducens
           PCA]
          Length = 477

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 79/495 (15%), Positives = 178/495 (35%), Gaps = 33/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           MS+L++ + A++              NI N +   Y ++ T+ T +             V
Sbjct: 1   MSILSLLDIAKSGITAQRLALEVTSENITNVNTPGYSKQTTVFTTATVSQERGFPLGNGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V   +    +     L + ++  G    + +     E +  ++   +     +     +
Sbjct: 61  RVAEIQRAYDDFLQMQLKSENTTKGWSDTVLASMTRAEQLF-NEFTTDGLGKSLQDFFSA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + N       + ++   +++   F      +  IR +A++ +E   +++   L ++
Sbjct: 120 WQDLTANPQGQPERQAILARGQQLADQFKRVNSYLNDIRTEANQSLEGVTADVNDKLRKI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ IK        A++  DQRD+ +++++E +GI+ + + +  + V  S G  L   
Sbjct: 180 ASLNEQIKQIEVQGARANELRDQRDLAVRQLAEKVGITYMEQTDGTLNVSLSLGQPLVLG 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-----AVPKGKIKALLQIRDSVVPI 285
               +   + ++             G   + +  S        +G++   LQ+RDS+V  
Sbjct: 240 KDAAVLSLQPDAANSGFYRIYSTAPGGKTAVDISSIVGGPGNGQGEMGGTLQVRDSLVNG 299

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
           F   LDE+A  L    +             GL                   T+       
Sbjct: 300 FLADLDELAYTLATEVNAVHSSGFGLTGSTGLDFFS------------TPATMAGYSGLG 347

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
                + +   ++           G           F+K            N+TL  +  
Sbjct: 348 GISVAISNSNDIAAANADPSVGGTGNNTNAKDIASLFDKILPLS-----GGNMTLGGFYN 402

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           + +G +  +  ++      S+ V   +     +  GV+L EEL+ LIK ++++  + KLI
Sbjct: 403 SLVGKVGVSVQNAERSATLSEGVLKQLDNLRESQSGVSLDEELANLIKYQKAFEGAAKLI 462

Query: 466 MFTDKMLQTLLEGVK 480
               +M+  +L  V+
Sbjct: 463 NTGTEMMDVILGLVR 477


>gi|312135425|ref|YP_004002763.1| flagellar hook-associated protein flgk [Caldicellulosiruptor
           owensensis OL]
 gi|311775476|gb|ADQ04963.1| flagellar hook-associated protein FlgK [Caldicellulosiruptor
           owensensis OL]
          Length = 525

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 80/538 (14%), Positives = 167/538 (31%), Gaps = 81/538 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+       +       N+ NA    Y R+      +              
Sbjct: 1   MS-FYGLEIARTGIFVNRKGLEVTSHNVANASTPGYTRQVLNVKSNPPSAKVGFYSPKFQ 59

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
                 V +         D       S  G+  +        E +  ++  +   +  I 
Sbjct: 60  VGMGADVQSLEQIRNMFLDMQYRNEYSRQGEYEIKADNLNFIESIF-NEPSDTGLSAVID 118

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
               SL+  SKN     +   V   A+ +    +   ++++ ++++ + ++  +I  +  
Sbjct: 119 HFFSSLQELSKNPESLTVRALVRQRAQALTDAIHKMYKQLEDLQSELNDQVYDKIMEINS 178

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             S++  +N  I         A+D  DQR++L+ K+S+II  +     +   VV  + G 
Sbjct: 179 IASQIADLNQQIFVLELRGEKANDLRDQRNLLVDKLSKIIDTTAYEDKDGRFVVQIAGGE 238

Query: 226 TLFETVPRDINFEKMN------------------SYTVTSESNPIFIDG----VVVSSNQ 263
           TL             +                       S+ N   + G    +   + Q
Sbjct: 239 TLVNHFTVYELETDKSKIMRKSGFDSSGQPTGFKPDDPLSQQNLYDVPGLFVVMWKDTGQ 298

Query: 264 GSAVPKGKIKALLQIRDSV------------------------VPIFQNQLDEMARVLIG 299
              +  G++K LL +RD V                        +  + N+L+E A+ LI 
Sbjct: 299 VLNIKSGELKGLLDVRDGVGGLDEDLTVNGQPVDVPNKNSYPGISYYLNRLNEFAKKLIE 358

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+E      +              +         +  I V+    ++ + +      S 
Sbjct: 359 KFNELHTQGWSLNGQNTGINFF---EPPVGQTFFYARYIKVSDAIMNDLNNIATTYDASS 415

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
               N               D             I       ++ ++ I  L  +   + 
Sbjct: 416 LPGGN---------------DLVVDMLKLRNDTSIFKEGRFEDFLKSLISNLGVDSQGAK 460

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +     +V+   +        GV++ EE++ LIK +  +  S ++I   D+ML  ++ 
Sbjct: 461 NFAENQKVMVTQLDNRRQAVSGVSIDEEMTNLIKYQHGFQASARMINAFDEMLDVIVN 518


>gi|269836594|ref|YP_003318822.1| flagellar hook-associated protein FlgK [Sphaerobacter thermophilus
           DSM 20745]
 gi|269785857|gb|ACZ38000.1| flagellar hook-associated protein FlgK [Sphaerobacter thermophilus
           DSM 20745]
          Length = 471

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 71/492 (14%), Positives = 157/492 (31%), Gaps = 46/492 (9%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS---------------- 46
                           +       NI NA+   + R+      +                
Sbjct: 4   TFGRLETLLRALQTQQRAVDVTNHNIANANTPGFSRQVAALGTTPPYTIPTLSAPRVGQI 63

Query: 47  PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              VTV++ +   +   D      +  +G      +     + +  ++         + K
Sbjct: 64  GTGVTVLSVQRIREGFLDVQYRTQAEQLGMSEAKTAIYRTLDTLL-NEPSETGLGAALDK 122

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
                E  +         + +I+ A+ +   FN    +V + R +A   + LE   + + 
Sbjct: 123 FWAGWEEVANRPEHVPTRQALIEVAQTLAHRFNAMRNQVLQQREEAAHRLALEADRINQI 182

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
             ++  +N  I+   A     +D +D RD LL +++  IG +T V  +  + VY + G  
Sbjct: 183 AQQIASLNAQIRGVLAMGQQPNDLMDTRDQLLDQLARSIGTTTTVTPDGAINVYIA-GHA 241

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF 286
           L +    D      +  T  +E          VS  +   V  G    L+++ +  +P  
Sbjct: 242 LVDRDQTDALRVTFDPVTGNAELT-------WVSDGRSVDVTLGAAAGLIEMHNVALPGI 294

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
              L+ +   L+   + +        +           ++           + V P   +
Sbjct: 295 LGDLEALRDTLVAEVNARHQAGFGLTDTGPTPPGRDFFEILPN------GDLRVLPALTA 348

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           +PS L    +       ++               +     + + +   +   T+  +   
Sbjct: 349 DPSLLAVASAPGVPGNADI---------------ALAIAGLAEELTMGSGTATINTFYET 393

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
            I  + +    +    +  + +   I        GV+L EE   LIK + +Y  + + + 
Sbjct: 394 FIARVGREAERAEADRVNQESLTRAIDRRRQEVAGVSLDEEAVNLIKYQHAYQAAARAMT 453

Query: 467 FTDKMLQTLLEG 478
             D+ML  L+ G
Sbjct: 454 VVDEMLDKLING 465


>gi|298507071|gb|ADI85794.1| flagellar hook-associated protein FlgK [Geobacter sulfurreducens
           KN400]
          Length = 477

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 79/495 (15%), Positives = 178/495 (35%), Gaps = 33/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           MS+L++ + A++              NI N +   Y ++ T+ T +             V
Sbjct: 1   MSILSLLDIAKSGITAQRLALEVTSENITNVNTPGYSKQTTVFTTATVSQERGFPLGNGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V   +    +     L + ++  G    + +     E +  ++   +     +     +
Sbjct: 61  RVAEIQRAYDDFLQMQLKSENTTKGWSDTVLASMTRAEQLF-NEFTTDGLGKSLQDFFSA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + N       + ++   +++   F      +  IR +A++ +E   +++   L ++
Sbjct: 120 WQDLTANPQGQPERQAILARGQQLADQFKRVNSYLNDIRTEANQSLEGVTADVNDKLRKI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ IK        A++  DQRD+ +++++E +GI+ + + +  + V  S G  L   
Sbjct: 180 ASLNEQIKQIEVQGARANELRDQRDLAVRQLAEKVGITYMEQTDGTLNVSLSLGQPLVLG 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-----AVPKGKIKALLQIRDSVVPI 285
               +   + ++             G   + +  S        +G++   LQ+RDS+V  
Sbjct: 240 KDAAVLSLQPDAANSGFYRIYSTAPGGKTAVHISSIVGGPGNGQGEMGGTLQVRDSLVNG 299

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
           F   LDE+A  L    +             GL                   T+       
Sbjct: 300 FLADLDELAYTLATEVNAVHSSGFGLTGSTGLDFFS------------TPATMAGYSGLG 347

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
                + +   ++           G           F+K            N+TL  +  
Sbjct: 348 GISVAISNSNDIAAANADPSVVGTGNNTNAKDIASLFDKILPLS-----GGNMTLGGFYN 402

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           + +G +  +  ++      S+ V   +     +  GV+L EEL+ LIK ++++  + KLI
Sbjct: 403 SLVGKVGVSVQNAERSATLSEGVLKQLDNLRESQSGVSLDEELANLIKYQKAFEGAAKLI 462

Query: 466 MFTDKMLQTLLEGVK 480
               +M+  +L  V+
Sbjct: 463 NTGTEMMDVILGLVR 477


>gi|138896699|ref|YP_001127152.1| flagellar hook-associated protein FlgK [Geobacillus
           thermodenitrificans NG80-2]
 gi|134268212|gb|ABO68407.1| Flagellar hook-associated protein 1 [Geobacillus
           thermodenitrificans NG80-2]
          Length = 540

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 80/536 (14%), Positives = 177/536 (33%), Gaps = 61/536 (11%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+           +   NI NA+ + Y R+                      
Sbjct: 3   STFHGLEAARRAMMAQQAALYTTGHNIANANTEGYTRQRVQLKATPPFPTPGLNRPNIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      +S +G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVEAASVERVREYFLDIQYRGENSKLGYWEARADAVSKMEDIM-NEPSDSGLAKTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   +L+  S +   +     V      VV+ F+  +  + +I+ D   +I + ++ + 
Sbjct: 122 DQFWQALQDLSTHPENEGARSVVRQRGLAVVETFHYLSNSLSQIQTDIGTQIGVTVTQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               +++ +N  I     + +  +D  D+RD L+ ++S++I +             T++G
Sbjct: 182 SLAKQISELNKQIASVEPNGYLPNDLYDERDRLIDELSKLINVQVEKHPTGGNAPATAEG 241

Query: 225 T-----------------------TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS 261
           T                       +  +    D + E +      +    + + G  VS 
Sbjct: 242 TYDIYFLNGNEKVYLVQGGEFQSISFPDGQDVDGDKEHIKEMPPATGVTELQVGGTSVSF 301

Query: 262 NQGS--AVPKGKIKALLQIR--------------DSVVPIFQNQLDEMARVLIGSFSEKD 305
              +    P GK++ L++                  + P   N LD++A      F+   
Sbjct: 302 TSNNQVTFPMGKLRGLIEAYGYVSGQDSSGQPIVTGIYPDMLNNLDKLAYTFGKLFNAVH 361

Query: 306 PIAGNSENVPGLFIADG--IKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLW 363
                     G+   DG   +         +S  I       ++    + G   +   L 
Sbjct: 362 EKGYGLNGETGVSFFDGLGQEAKGAAKTIRLSADIDDLANIAASTEEGKPGNGNNAINLA 421

Query: 364 NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHM 423
           NV ++    + I+    S         +   +   T+    +  IG L  +   ++ +  
Sbjct: 422 NVGSMLLSSNTISLIGTSATIQMSDLQLPLTSG--TIQTNYQGWIGKLGVDGQQANRMKN 479

Query: 424 KSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            S V+   + E   +   V+L EE+  +IK + +YN + + I   D+ML  ++ G+
Sbjct: 480 NSDVLRQSVEERRQSVSSVSLDEEMMNMIKFQHAYNAAARQITVVDEMLDKIINGM 535


>gi|297531376|ref|YP_003672651.1| flagellar hook-associated protein FlgK [Geobacillus sp. C56-T3]
 gi|297254628|gb|ADI28074.1| flagellar hook-associated protein FlgK [Geobacillus sp. C56-T3]
          Length = 531

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/527 (14%), Positives = 170/527 (32%), Gaps = 52/527 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+           +   NI NA+ + Y R+                      
Sbjct: 3   STFHGLEAARRGMMAQQAALYTTSHNIANANTEGYTRQRVQLRPTSPFPTPGLNRPNIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      +S +G         +  E +  ++  ++      
Sbjct: 63  QMGTGVEASSVERVREYFLDIQYRGENSKLGYWEARADAVSKMEDIM-NEPSDSGLAKTT 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   +L+  S +   +     V      VV+ F+  +  + +IR D   +I   ++ + 
Sbjct: 122 DQFWQALQDLSTHPENEGARSVVRQRGLAVVETFHYLSNSLTQIRTDIGTQIGTTVTEIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST--------------- 209
             L++++ +N+ I     + +  +D  D+RD L+ ++S+ + I                 
Sbjct: 182 SLLNQISALNERIAEIEPNGYLPNDLYDERDRLVDQLSQYMEIGVEKHPTGGNALPMAEG 241

Query: 210 ---IVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA 266
              +   N    VY   G T       D +    +       ++ +    V  ++   S+
Sbjct: 242 TYDVYVMNGSAKVYLVQGRTASVVSFSDGSDVDGDGVKEMPPASGVNTLDVSGTTVSFSS 301

Query: 267 VPKGKIKALLQIRD--------------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSE 312
           +P GK++ L++                  + P     LD++A      F++         
Sbjct: 302 LPNGKLRGLIEGYGYQTGTDASGQPIVKGLYPDMLANLDKLAYTFGTVFNDVHQQGYGLN 361

Query: 313 NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP 372
                   DGI  +              +    +  +   + G+ +              
Sbjct: 362 GSTNHPFFDGISAVSGAAKTIKLAADIDDLANIAASTKSGETGNGNNAINLANVRSLLLS 421

Query: 373 DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
           +      D  +       +    ++ T+    +  IG L  +   ++ +   S+ +   +
Sbjct: 422 NATVSLQDGIS--VNLASLNLPLSSGTVETNYQGWIGQLGVDGEQANRMKTNSETLRQSV 479

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            E   +   V+L EE+  +IK + +YN + + I   D+ML  L+ G+
Sbjct: 480 EEKRQSVSSVSLDEEMMNMIKYQHAYNAAARQITVIDEMLDKLINGM 526


>gi|78044505|ref|YP_359818.1| flagellar hook-associated protein FlgK [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996620|gb|ABB15519.1| flagellar hook-associated protein 1 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 473

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 72/491 (14%), Positives = 171/491 (34%), Gaps = 44/491 (8%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------------ISPE 48
               A +              NI NA+   Y R+                          
Sbjct: 5   SLETALSSLRAQQLALDITSHNIANANTPGYTRQRVNFAPNTPFPVPSLFAPMQPGQVGT 64

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V V +         D         +G            +++  ++  +      + +  
Sbjct: 65  GVVVASIERVRDTFMDIEYRKELMNLGYWETRFDVLDKIQLI-INEPSDTGLNQLMDRFW 123

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           ++ +  SKN         V   A+ +V+ FN    ++  ++ D D  ++  +  +     
Sbjct: 124 NAWQELSKNPENLATRAVVQQTAKALVETFNHLRGQLDSLQNDFDFAVQANVEEINSIAR 183

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           ++  +ND I      K +A+D +DQRD LL K++++I  + I   +  + +       + 
Sbjct: 184 QIRDINDQIFKTNIVKFNANDLMDQRDELLNKLAKLIDFTLIDNQDGTISIDIGGKKLVD 243

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                      ++S  V   ++  F       +       KG++ A L  RD  V   ++
Sbjct: 244 GL--------TVDSLKVEKNASGFFEVFWSDDTPVTITSQKGELAANLAARDVDVQAMKD 295

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
            LD +A+ LI   +              +  +       N      ++TI ++P+  +N 
Sbjct: 296 YLDSLAQTLIIETNNLHTQGY-------VLGSPMTNPGYNFFDGTDAKTIALSPEVSANL 348

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + +                  G  ++        +K  +  P +      T  ++ R  I
Sbjct: 349 NNIA----------AAKTPSPGDGEIALAIAQLKDKLTMTLPGSTTP-TATFNDFYRTII 397

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             L  +  ++  ++   Q++  +++     + GV++ EE++ +I  + +Y+ + +++   
Sbjct: 398 SRLGVDAQEAERMYQNEQLLTKNLNNKRMESGGVSIDEEMANMILYQNAYSAAARIVTAI 457

Query: 469 DKMLQTLLEGV 479
           D+M+  ++  +
Sbjct: 458 DEMMDIVINRM 468


>gi|148266109|ref|YP_001232815.1| flagellar hook-associated protein FlgK [Geobacter uraniireducens
           Rf4]
 gi|146399609|gb|ABQ28242.1| flagellar hook-associated protein FlgK [Geobacter uraniireducens
           Rf4]
          Length = 478

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 86/495 (17%), Positives = 181/495 (36%), Gaps = 32/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           MS+ ++    +   N           NI N +   Y R+ T+   +             V
Sbjct: 1   MSINSLLETGRTALNAQKLALEVTGENITNVNTTGYSRQTTILETAPTTLERGFPLGSGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V   +          +   ++  GQ +   S     + +  ++   +     +     S
Sbjct: 61  KVAAVQRSYDGFLQTQIMGQNATYGQGKTSNSALQRVQQLF-NEFTTDGLGVSLQNFFKS 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + N       + V+   +++V NF+     +  +++D +K +E ++S++   L+++
Sbjct: 120 WQDLTVNPQGAPERQAVLSQGQQLVDNFHRINSNLNDVKSDMNKSLEGQVSDINDTLNQI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N  IK        A++  D+RD+LL+++S+ +GIS + + +  + V  + G +L   
Sbjct: 180 ATLNLQIKQIEVQSGPANEMRDKRDLLLRQLSQKVGISFVEQPDGMVDVSLTSGQSLVVG 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSA-----VPKGKIKALLQIRDSVVPI 285
                     N+         +   G   + N  +        +G+I   L +RD++V  
Sbjct: 240 KDAAALSLLPNAANSGFYDILLTPPGGGPAVNATAFIGGPGNTQGEIGGALLVRDTMVNN 299

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
           + ++LDE+A  L    +                                           
Sbjct: 300 YLSELDELASTLASEVNGLHSAGYGLTAASTGLDFFAPPAAVAGYSGQG--------GIG 351

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
            N + + D  +       N          I    D F        +A    NVTL  +  
Sbjct: 352 VNIAAISDVAAADADPTVNGTGNNKNAQSIASVYDKF--------LAMSAGNVTLEGFYD 403

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           + +G +  +  ++     +S  +   ++    +  GV+L EEL+ LIK +++Y  + KLI
Sbjct: 404 SLVGKVGVDVQNAGRAESQSDGILKQLNNMRESASGVSLDEELANLIKYQKAYEGAAKLI 463

Query: 466 MFTDKMLQTLLEGVK 480
               +ML T++  VK
Sbjct: 464 NVGSEMLDTVINLVK 478


>gi|212640402|ref|YP_002316922.1| flagellar hook-associated protein FlgK [Anoxybacillus flavithermus
           WK1]
 gi|212561882|gb|ACJ34937.1| Flagellar hook-associated protein [Anoxybacillus flavithermus WK1]
          Length = 513

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 64/507 (12%), Positives = 142/507 (28%), Gaps = 30/507 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S        +       Q       NI NA+   Y R+                      
Sbjct: 3   STFHGLETVRRGMTAQQQALYVTGHNIANANTPGYSRQRVNFEQTPPYPFASKNRPVMPG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   T +   +   D      +   G            E +  ++  +      +
Sbjct: 63  QMGTGVEGGTVQRMREQFLDVQYRGENMKYGYWHTRAEALYKMEEIM-NEPSDEGLAKTL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   SL+  + N S       V      V + F+  +  ++ IR D   E+++ +  + 
Sbjct: 122 DRFWQSLQDLAVNPSNSGARSVVRQRGMAVAETFHYLSSSLKSIRDDLKNELDVTVKAVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               +L  +N  I       +  +D  D+R+ LL ++S+ + +     ++    +  ++G
Sbjct: 182 SLARQLNDINKQISEVEVHGYLPNDLYDERNRLLDELSQYVNVKVTAVSSGGSSLKIAEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
               E V R  +                       +  +   +    +          + 
Sbjct: 242 RFTVELVDRTGSTVIGTLVDGRLGQVNELQLSYQDNVTKTGPIVGFSLGNTPFSTFEHLK 301

Query: 285 IFQNQLDEMARVLIGSFSEKDPIA----GNSENVPGLFIADGIKDLDNKLCQGISETICV 340
                   +                     S             +  +     ++E    
Sbjct: 302 ENGKVGSLLYSYGYSEDGGTTTKGLYPEMLSNLNAMAKAFADTFNTVHSNGWSVAEIKNN 361

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGI------ 394
                + P F  D    +  F           ++                +A +      
Sbjct: 362 ATAPSAKPFFTYDPNDPAGTFDIAQMIKDSLDNIAASATGQIGDGSNAQALAEVKNGTMN 421

Query: 395 --NTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
                 T+  +  + IG +  N  ++  L   S+V+   + E       V+L EE+  ++
Sbjct: 422 IAGNTTTIQNFYESLIGQMAVNAQEAKRLSENSEVLRQSVDERRMAVSSVSLDEEMMNMM 481

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
           K + +YN S ++I   D+ML  ++  +
Sbjct: 482 KFQHAYNASARMITMIDQMLDKIINNM 508


>gi|239828340|ref|YP_002950964.1| flagellar hook-associated protein FlgK [Geobacillus sp. WCH70]
 gi|239808633|gb|ACS25698.1| flagellar hook-associated protein FlgK [Geobacillus sp. WCH70]
          Length = 541

 Score =  243 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 76/535 (14%), Positives = 167/535 (31%), Gaps = 58/535 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+               N+ NA+   Y R+                      
Sbjct: 3   STFHGLEAAKRAMMTQQAALYVTGHNVANANTPGYTRQRVNFVQTEPFPSPGLNRPQIPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      ++ +G         A  E +  ++  +N     +
Sbjct: 63  QMGTGVKAGSVERVREYFLDIQYRGENNKLGYWEARADAIAKMEDIM-NEPSDNGLAKTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   +L+  S N   +     V      VV+ F+  +  + +I+ D   +I + I+ + 
Sbjct: 122 DQFWQALQDLSVNPENEGARSVVRQRGLAVVETFHYLSNSLSQIQTDIGTQIGVTITQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               +++ +N  I     + +  +D  D+RD L+ ++S++I +             T++G
Sbjct: 182 SLAKQISEINQQIASVEPNGYLPNDLYDERDRLIDELSKLINVQVEKHPTGGNAPATAEG 241

Query: 225 T-----------------------TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS 261
           T                       +  +    D + E +      +    + + G  +S 
Sbjct: 242 TYDIYFLNGNEKVYLVQGGDFQSISFPDGQDVDGDKEYIKEMPPVTGVTELQVGGTSISF 301

Query: 262 NQGS---AVPKGKIKALLQIRD--------------SVVPIFQNQLDEMARVLIGSFSEK 304
              +     P GK++ L++                  + P   N LD++A      F+  
Sbjct: 302 TDNNNQVTFPMGKLRGLIEAYGYVSGQDSNGQPIVAGIYPDMLNNLDKLAYTFGKLFNAV 361

Query: 305 DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWN 364
                      G+   DG+        + I  +  ++       S            +  
Sbjct: 362 HEKGYGLNGETGVSFFDGLGQEAKGAAKTIRLSADIDDLANIAASTEEGKPGNGNNAINL 421

Query: 365 VKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMK 424
               +                     +    T+ T+    +  IG L  +   ++ +   
Sbjct: 422 ANVGSMLLSADTVSLIGTTNTIQISTLNLPLTSGTIQTNYQGWIGKLGVDGQQANRMKNN 481

Query: 425 SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           S V+   + E   +   V+L EE+  +IK + +YN + + I   D+ML  ++ G+
Sbjct: 482 SDVLRQSVEERRQSVSSVSLDEEMMNMIKFQHAYNAAARQITVVDEMLDKIINGM 536


>gi|121535557|ref|ZP_01667365.1| flagellar hook-associated protein FlgK [Thermosinus carboxydivorans
           Nor1]
 gi|121305885|gb|EAX46819.1| flagellar hook-associated protein FlgK [Thermosinus carboxydivorans
           Nor1]
          Length = 494

 Score =  242 bits (617), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 81/502 (16%), Positives = 176/502 (35%), Gaps = 41/502 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------P 47
           S  +  N              ++  NI NA+ + Y R+      +               
Sbjct: 3   STFSGLNALTRGIYANQIALDTVGHNISNANTEGYSRQLASIVSTRPETLYGEYGPMQLG 62

Query: 48  ENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL 107
               V        +  D+     +S++G         +  E +   +         ++  
Sbjct: 63  TGAAVEAVTRARDSFIDRQFWQENSSLGYGETATEILSKIEGVFR-EPSEYGLQTVLNNF 121

Query: 108 RDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
             + ++ S N S+D     +     E+V     +A++++ + AD +  +E++++ + +  
Sbjct: 122 WQAWQTLSTNASDDGARAALQQRGVELVNAIGHAAQQLKDMVADINSVVEIKVNKVNQIT 181

Query: 168 SELTVVNDAIKFKTASKHD-AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
           SE+  +N  I        D A+D  D+RD+L+ ++S ++G++       + +V T +   
Sbjct: 182 SEILSLNKQIALIETGGRDHANDLRDRRDLLVDQLSTLVGVTVTEDKYGNYIVRTGNVLL 241

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK---------GKIKALLQ 277
           +      ++            E   +   G V S ++               G+IK LL 
Sbjct: 242 VDGNTRNELGVVSQKDSDYGYEVYNVVYGGTVPSGSRFMQGGTAVVFPEGNKGEIKGLLA 301

Query: 278 IRDSV-VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE 336
           +RD+  V  + ++L  M++  +  F+          +                      +
Sbjct: 302 MRDATGVKGYLDKLATMSQFFLTDFNSLHRDGYGLADTATGNDFFVTGGASPATKAEYLQ 361

Query: 337 TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
                       S + D   ++ +    +   +G   +          +   D       
Sbjct: 362 AFT--------SSTIVDTALIAARSDVAMGVASGDHAVALSNLLKTVTSPTLD------- 406

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N TL  Y    IG L     D+  L    + + + I     +  GVN+ EE++ +I+ +Q
Sbjct: 407 NATLDSYYNAFIGKLGVQSQDAKRLAENQKTLVSQIRNWRESVAGVNMDEEMTNMIRYQQ 466

Query: 457 SYNISNKLIMFTDKMLQTLLEG 478
            YN + +++   D+ML  L+ G
Sbjct: 467 GYNAAARVVTAIDEMLDKLING 488


>gi|317121043|ref|YP_004101046.1| flagellar hook-associated protein FlgK [Thermaerobacter marianensis
           DSM 12885]
 gi|315591023|gb|ADU50319.1| flagellar hook-associated protein FlgK [Thermaerobacter marianensis
           DSM 12885]
          Length = 520

 Score =  242 bits (617), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 69/526 (13%), Positives = 163/526 (30%), Gaps = 65/526 (12%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------------- 44
           S       A+       +       NI NA+ + Y R+    +                 
Sbjct: 3   STFFGLELARLGLWAQQRALDVTGHNIANANTEGYSRQVARLSPTPAYAPPSLAMAAEAG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   +       D+      + +G+ ++     A  E +   +  +      +
Sbjct: 63  QVGTGVQVAEIQRVRDLFLDRQARDLKAHLGRWQVRSQTLAELETILG-EPSDAGLARAL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   D+L + +            I  A  +++ F T+ R++  +  + D  +   +  + 
Sbjct: 122 ADFWDALATVANRPDSLPARTAAIQQAHTLLERFQTADRQLADLADNLDASLVARVDRVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD- 223
           + L ++  ++  I+  TA+    +D LD+RD LL+++  ++ +    R +  + V  +  
Sbjct: 182 QILVQMADLHRRIRVATAAGQTPNDLLDERDRLLEELGTLLPVRVTERPDGTVRVEVAGL 241

Query: 224 ----GTTLFE----------------------------TVPRDINFEKMNSYTVTSESNP 251
               G  +                                          +    S    
Sbjct: 242 PLVDGQVVHRLAVQEEPAGGAGGGGTGSGTSGGLVVRIYWDGTATVPASATPQAVSGPGA 301

Query: 252 IFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNS 311
                        + +  G+I  LL+ RD +V   +  L  +   L  + +         
Sbjct: 302 SGGAAAAFIPLDDTVLDGGEIDGLLEARDRLVAGLRQDLKALFFALADAVNAVHRQGYGL 361

Query: 312 ENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGY 371
            + P           D  +                + S L+      +         A  
Sbjct: 362 NDGPPAGSGQQGAGRDLFVV--------------GSGSDLQQVVVNPELDDPANLAAAQM 407

Query: 372 PDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNH 431
           P       ++     +      +  + +  +Y  + +  L      + +    +Q++ + 
Sbjct: 408 PGAPGDGRNALAMVQLRHAPLNLPGSPSAQDYLESVVAGLGIAGRQAEEGQRTAQLLLDQ 467

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           ++    +  GV+L EE++ LI+ + +Y  + +L+   D ML  L+E
Sbjct: 468 VAAQRESVRGVSLDEEMTQLIRYQHAYAAAARLVTAVDTMLGILIE 513


>gi|288554150|ref|YP_003426085.1| flagellar hook-associated protein FlgK [Bacillus pseudofirmus OF4]
 gi|288545310|gb|ADC49193.1| flagellar hook-associated protein FlgK [Bacillus pseudofirmus OF4]
          Length = 523

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 78/518 (15%), Positives = 173/518 (33%), Gaps = 42/518 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+           +   NI NA+   Y R+    T +               
Sbjct: 3   STFHGLETARRAMMTQQYALHTTGHNIANANTPGYSRQRVNFTQAEPYPSIGMNRPMLPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                    + +   ++  D       S  G      +     E +  ++   +     +
Sbjct: 63  HLGTGTKAGSIQRVREHFLDIQFRNEQSKTGYWSTRHTGLQKMEDIL-NEPSTDGIASTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +  ++L+  S +  +      V +    V + FN  +  +  I+ D   EI ++     
Sbjct: 122 DRFWNALQDLSTDPQDSGARSVVRERGVAVAEVFNYVSNSLTIIQKDLKGEIGVQEKAFN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L ++  +N+ I       +  +D  D+RD L+ ++S+ + +      +       ++G
Sbjct: 182 SILDQIKNINEEISKVEPHGYVPNDLYDRRDNLIDELSQYVNVKIDRIESGGNASSVAEG 241

Query: 225 ---------------TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK 269
                           TL +     +N+  ++      E     +     S +      +
Sbjct: 242 AYNVRLVDSDGKDLGITLIDGANHSVNYLSIDFAGTNGEGLVENLSFGGNSMSVAEFESR 301

Query: 270 GKIKALLQIRD--------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIAD 321
           G IKA+++            V P   + LD+M    +  F++      N E         
Sbjct: 302 GSIKAIIESFGYMDGGAEKGVYPEMLHDLDQMVATFVEEFNKVHRAGWNLE-DIEAGEKG 360

Query: 322 GIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDS 381
              +       G S T        S      D  + S K       + G   + +     
Sbjct: 361 PSLNFFTYSGTGASPTSDQPAGAASRLQLSADIMTSSNKIAAAKPGVDGVAFVGSGANAL 420

Query: 382 FNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVG 441
              N     +    TN ++  + ++ IG +  + ++++ +   + ++ N + E   +   
Sbjct: 421 ELANVKDKTLNYGGTNTSVQSFYQSVIGDMAVHTNEANRMMRNADMLRNTVEERRQSVSS 480

Query: 442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           V+L EE++ +IK + +YN + + I   D+ML  ++ G+
Sbjct: 481 VSLDEEMTDMIKFQHAYNAAARNITMVDEMLDRIINGL 518


>gi|319650643|ref|ZP_08004783.1| flagellar hook-associated protein K [Bacillus sp. 2_A_57_CT2]
 gi|317397824|gb|EFV78522.1| flagellar hook-associated protein K [Bacillus sp. 2_A_57_CT2]
          Length = 518

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 74/522 (14%), Positives = 166/522 (31%), Gaps = 55/522 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+           +   NI NA+   Y R+    +                 
Sbjct: 3   STFMGLETARRGMFTQQSALYTTGHNISNANTPGYTRQRINFSQTEPYPGAGLNRPQIPG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +   +   D      S+ +G    +       E +  ++   N     +
Sbjct: 63  QMGTGVEAGSVQRIREGFLDMQYRTESTKMGYYGAMSESLTKMEEIM-NEPSENGLHSTL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            K  ++++  S +         V    + V    N     + +++ D   +I ++   + 
Sbjct: 122 EKFWNAIQDLSSHTENTGARDVVAATGQMVADTLNYYYNSLTRVQEDIGSQINVKADEIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV------------- 211
             ++++  +N  I       +  +D  DQRDVL+  +S+++ +                 
Sbjct: 182 AIVAQIDNLNKQISSVEPHGYLPNDLYDQRDVLVDNLSKLVNVKVSKVIPDNYGNAQKIA 241

Query: 212 RNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDG------VVVSSNQGS 265
               ++ +   DG +    +      ++     V         DG      +   +    
Sbjct: 242 DGLYNIEIVQQDGKSFEPPIQLVPVTKEAGIMDVNKLEVEKSSDGFISGLKIGSETINDF 301

Query: 266 AVPKGKIKALLQIRD--------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
           +   G++  L++            V P   ++L++M       F++              
Sbjct: 302 SKLSGELAGLVKSFGYESGGEAKGVYPEMLDKLNKMTEAFAKEFNKIHREGFPLGADEPS 361

Query: 318 FIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
            +        N       ++I V  +   + S +  G +          +      L + 
Sbjct: 362 GLDFFEFTAGNAA-----QSIKVKQEILDDSSKIAAGAASGAS-----GDNGNAQLLADL 411

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
              SF+      P    N N +L  Y    IG L  +   +      S ++   + ++  
Sbjct: 412 RKKSFSSYESLSPEEKANLNGSLDSYYSGLIGRLGVDSQSAQKDLRNSAILAASVEQNRQ 471

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +   V+L EE++ +IK + +YN S + I   D+ML  ++ G+
Sbjct: 472 SVSAVSLDEEMTNMIKFQHAYNASARNITVVDEMLDKIINGM 513


>gi|85859203|ref|YP_461405.1| flagellar hook-associated protein 1 [Syntrophus aciditrophicus SB]
 gi|85722294|gb|ABC77237.1| flagellar hook-associated protein 1 [Syntrophus aciditrophicus SB]
          Length = 463

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 83/490 (16%), Positives = 183/490 (37%), Gaps = 38/490 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS++ + +  +   ++          NI N +   Y R+  + +               V
Sbjct: 2   MSIIGILDTTKLALSSFQAAIDITGSNISNVNTPGYSRQRPVFSSVGSIDVRAAKIKVGV 61

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V        N     ++  SS  G    L +     E++  D+   +     +++  ++
Sbjct: 62  EVSDVERIYNNFLRDQINERSSVTGYYEALSTSLESVEIIF-DETSGSGINGLLNQFWNA 120

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
               S N    +    +I +AE +  + N     ++ +R DA+  I+  +  +   +S +
Sbjct: 121 WSDVSNNPEGQVERDALISSAESLCASINDYGNALESVREDAENNIQETVVEINNLISSI 180

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             VN  I+   + + +++   D+RD  L+++   I  +  + ++  + V+  +G  L E 
Sbjct: 181 ADVNRKIREAGSEQGNSNILQDKRDEYLKELCSTINANYFIDSSGALNVFLPNGEPLVEK 240

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                      +       + I   G   S +    +  GKI ALL +RD +V  +Q+ L
Sbjct: 241 EFSWQLRLSSETSETNPPYHHITKVGS--SDSLDEVITGGKIGALLDVRDMIVKNYQDNL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           D  A  L+   +++     +     G    D        +                    
Sbjct: 299 DSFAAGLVTQINDQHHQGYDQYKNIGSDFFDPTATDSKSM-------------------- 338

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                 V+ +   ++K +A    ++    ++   + + D  A +N   T   Y  + IG 
Sbjct: 339 -----RVNSELAADLKKIAASSSILGDGANAVQISALKDNEAAMNGIFTFNNYVASLIGK 393

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           + ++ +D+        +V + +        GV++ EE+  LI+ +  YN + +L    ++
Sbjct: 394 IGQDVADAKTNVEHQNIVMSQLDRQREGISGVSIDEEMMKLIQYQMGYNAAGRLCSIINE 453

Query: 471 MLQTLLEGVK 480
           ML TL+   +
Sbjct: 454 MLDTLINLGR 463


>gi|226225705|ref|YP_002759811.1| flagellar hook-associated protein 1 [Gemmatimonas aurantiaca T-27]
 gi|226088896|dbj|BAH37341.1| flagellar hook-associated protein 1 [Gemmatimonas aurantiaca T-27]
          Length = 482

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 72/487 (14%), Positives = 179/487 (36%), Gaps = 18/487 (3%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV 53
             +F+ A++   +      +I  N+ NA+   + R++ +   +             V V 
Sbjct: 3   SGLFSIARSALLSHQTALQTISHNVANAETPGFSRQEAVLAANTPVRLYNGNVGTGVHVA 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
           T + +   + D    + +   G   + +      E +   +      ++ + +  +S   
Sbjct: 63  TIQRKRDLLLDDNYRSANVLAGNSTMRRDLMQKVEDVFG-EPSETGMSNALDQFWNSWSD 121

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            S   +       V     ++ Q FN    ++ + R    + ++  +  +    S++  +
Sbjct: 122 LSAQPNSLAARAVVQQRGRQLGQLFNDYDTQLTQQRTSNLELLDNTVGRINALASQVAEL 181

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I     + H A+D  D RD+ L +++ + G   + + N  + V   + T +      
Sbjct: 182 NTRILASEGNGHVANDLRDMRDLRLDELANVAGTRVVNQPNGTVTVVIGNSTLVEGDTWN 241

Query: 234 DINFE-KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
            ++ + +    T       + +   +  S    A   G++ A++++ +  +P  + +LD 
Sbjct: 242 KVSAQLEPPVPTPAVPLTDVPVKIRLGDSPDRLAPLDGQLSAIVKVLNEDIPATRGRLDA 301

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           MA  ++ + +                 A G       +   +  +         + +   
Sbjct: 302 MASQIVTAVNTAHTAGYVFSGNTVPGTAAGNFFEAGTVTNPVRASNIKL-----DNAISA 356

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           D G ++     N     G    +     + +    +    G   + + + + R  +  L 
Sbjct: 357 DPGKIAASNDANGPTSNGTAQALAALRIA-DGTVTWTAPNGTTESGSFVGFFRGLVTRLG 415

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            + + ++D    ++ +         +  GVN  EEL  +++V+QSY  + K+I   D+ML
Sbjct: 416 VDTASANDSAAVAENLVQQAEIRRQSVSGVNTDEELVNMLRVQQSYQAAAKMITAADEML 475

Query: 473 QTLLEGV 479
           +TL+  V
Sbjct: 476 KTLINLV 482


>gi|239834426|ref|ZP_04682754.1| flagellar hook-associated protein FlgK [Ochrobactrum intermedium
           LMG 3301]
 gi|239822489|gb|EEQ94058.1| flagellar hook-associated protein FlgK [Ochrobactrum intermedium
           LMG 3301]
          Length = 484

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 134/484 (27%), Positives = 240/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + +  NI  A++ +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSSNIARANDPDYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +S      +L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EALFNRFIQSNSTASSSSILAGGLDRLSSLYSADNYSGSPSALIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   +++Q +R DAD+EI   ++N+   L++   VN  I   
Sbjct: 121 SALGDSVVSTAQSLANALNAGTKQIQSLRNDADREIADSVANINDLLAKFEKVNQEIVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +  D  D++DQRD +L+++S  IGI+T++R +NDMV++  +G TLFET  R ++FE+ 
Sbjct: 181 TRANRDVSDYMDQRDAILKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVSFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
                      + +DGV ++          G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 TVLAPGISGKAVLVDGVPLNHETFDQPYGTGRLSGLLQLRDQIAPQYQMQLDEIARNLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY----RSNPSFLRDGG 355
            F+E D     ++       A         +  GI+ +I V+  +      +   LRDGG
Sbjct: 301 MFAESDQTGVGADKTGLFSWAGSPDVPGAGMSAGIAGSIKVSSAFVASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +N++  AG+ + +    ++F++   FDP  G++ + +L++Y+ +SI WLE  R
Sbjct: 361 ANGPDYKYNIEGAAGFSERLRALNEAFSEPMAFDPATGLSASSSLIDYSASSISWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V      + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFSYNATVATQADAALSNANGVDMDTEMALLLDLEHSYQASSRVLTTISAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040201|gb|ACT56997.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 480

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 480/480 (100%), Positives = 480/480 (100%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK
Sbjct: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE
Sbjct: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK
Sbjct: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM
Sbjct: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS
Sbjct: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
           FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK
Sbjct: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
           FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD
Sbjct: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
Sbjct: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480


>gi|42522141|ref|NP_967521.1| FlgK, flagellar hook-associated protein [Bdellovibrio bacteriovorus
           HD100]
 gi|39574672|emb|CAE78514.1| FlgK, flagellar hook-associated protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 469

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 77/491 (15%), Positives = 163/491 (33%), Gaps = 34/491 (6%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PEN 49
           MS + A+ +  +    N+     ++  NI N   + + R+      +             
Sbjct: 1   MSKISAMMDTGKRSLMNSQTALQTVGHNIANKSTEGFSRQRVELQTNTPITEGNLQIGMG 60

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
                    N    +K +     ++G Q       +  E +  ++  N     Y++   +
Sbjct: 61  ARAGVVTRVNNPWLEKQIQREGMSMGFQDSRADALSRVEQIY-NEQNNKGLNQYMTDFFN 119

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           S    S N         V +++  + ++F     +++ ++ D D +I+  +  + +   E
Sbjct: 120 SFRELSNNPESLASRTMVRESSVALTKDFGRVVGQLKAVQEDLDGQIKTTVEEVNQLSKE 179

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N+ ++        A+D  D+RD+LL+K+ E I IS     +  + V       L  
Sbjct: 180 IASLNEKVQMVEVQGTPANDERDRRDLLLKKLGEKIDISWAEGRDGMVTVTAGRTAILVS 239

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            +       +             F      S+N    +  G+I   L +RD V+      
Sbjct: 240 GIGSSELKARQT--DARDRVEVFFEGSGSTSANITEQITGGRIGGALDVRDKVIEDLLGH 297

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           +D MA  L    +       +     G+   D    +                       
Sbjct: 298 VDNMAYTLAKEVNTAHIEGFDKSGRNGVLFFDMPDQVKGAASVIGLNK------------ 345

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                  V +         AG   + N       +              TL +Y    +G
Sbjct: 346 --TVFNDVGRIATGAQPGAAGDNTVANVISALQYRQV------MDGGTSTLDDYYSTQVG 397

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +      +       + V + ++    +  GV+L EE + +I+ +++Y+ S +LI   D
Sbjct: 398 QIGAVTQRAVKAQESQKNVISQLTNIRESISGVSLDEETTKMIEFQKTYDASARLIKTAD 457

Query: 470 KMLQTLLEGVK 480
           +M  T+L   +
Sbjct: 458 EMFDTVLNLKR 468


>gi|301168512|emb|CBW28102.1| putative flagellar hook-associated protein 1 [Bacteriovorax marinus
           SJ]
          Length = 487

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 83/491 (16%), Positives = 171/491 (34%), Gaps = 17/491 (3%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           +  + N  +   N + +   +   NI N + + Y R+    T +             V V
Sbjct: 1   MSDLLNIGRTGLNASKKSLETTGHNISNVNTEGYSRQRVNQTTNTPITKGGTVHGTGVRV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
            +    N +  +K L    S               E +  +D   +     I+K  +S  
Sbjct: 61  KSVTRINDDFINKRLEKAISNDRFFEQRAERMTQIEDIF-NDLDTDGLNQVINKFFNSFR 119

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             +     + +   V D A  VVQ+F      +  I A  D+ ++ E+ ++ + L  +  
Sbjct: 120 ELANQPENETIRSVVRDQANLVVQDFRRIQENLNSISAGIDENMKAEVIDINQTLEHIAN 179

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I+   A   +  D  DQRD+ ++ +S+   + T        VV      TL     
Sbjct: 180 LNKKIQSLEAINEEVGDLRDQRDLAVRNLSKSFKVHTYQDEKGQYVVAAKGVGTLVTATQ 239

Query: 233 RDINFEKMNSYTVTSESNPIFIDG---VVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                   ++   ++   P   D       +         G + +L ++R+  +   +N+
Sbjct: 240 VQRLQIGTSNKENSTNGLPGSADIFFEGKPAHILTQKFQGGSLSSLAKVRNEEIVDIRNK 299

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           +D++A  L  S +          N P      G     +             P    + +
Sbjct: 300 VDQIAYNLTKSVNAIHRRGY--VNRPLNVDEAGNVSSVDSKGLTTGINFFKEPTDPKDAA 357

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                 S  K+ L N+    G P+       S   + I       +   TL E+   ++G
Sbjct: 358 LNMSLSSAVKEDLTNIVTALG-PNSPGDNRVSLAISKIQHERIVGDGESTLEEFYLQTVG 416

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +      +     +++ +           VGV++ EE + ++K + +Y  S K++   D
Sbjct: 417 KIGLEAGKAKLDSEQAEGLKAQAVSIRERLVGVSIDEEAANMVKFQHAYEASAKIMQTAD 476

Query: 470 KMLQTLLEGVK 480
           +M +T++   +
Sbjct: 477 EMFKTVIGIKR 487


>gi|226314925|ref|YP_002774821.1| flagellar hook-associated protein 1 [Brevibacillus brevis NBRC
           100599]
 gi|226097875|dbj|BAH46317.1| flagellar hook-associated protein 1 [Brevibacillus brevis NBRC
           100599]
          Length = 495

 Score =  237 bits (603), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 67/499 (13%), Positives = 163/499 (32%), Gaps = 32/499 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       ++           +   NI NA+ + Y R+      +               
Sbjct: 3   STFHGIEVSKRGLFAQQSALNTTGHNISNANTEGYSRQRVNMQATTGLPYVGMQASIEPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +   +   D          G            E +  ++  +      +
Sbjct: 63  LLGTGVQATSIQRLREEFLDIQYRNEYKRQGYWDGRLETLEKLEGIM-NEPSDTGLQKVM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            ++  + +  +K+ ++      V + ++ V   FNT    +++++ D +  + ++   + 
Sbjct: 122 DQMWQAWQDLAKDPTDTSARAVVRERSKAVADTFNTLTNHIKEVQTDLNNVVNVKSMEIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               ++  +N+ I       +  +D  DQRDVLL K+S+++ +         + V     
Sbjct: 182 SLGQQIANLNNQIANVVPHGYQPNDLYDQRDVLLDKLSKLVEVRATQSTAGMVNVTIEGR 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +            + S  V +  NP      +           G +   LQ RD +VP
Sbjct: 242 EFV----------TGITSQPVATVQNPATGMSDMTLGGAAFVPTTGYMAGTLQSRDQIVP 291

Query: 285 IFQNQLDEMARVLIGSFSEKDPIA---GNSENVPGLFIADGIKDLDNKLCQGISETICVN 341
               +LD +A  L    ++         +  N     +   +                  
Sbjct: 292 GMLKRLDVLAVNLTKEINDLHRAGRSLSDINNGTVQDLPFFVDANSLAANPASKNYPTSA 351

Query: 342 PQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG-INTNVTL 400
                NP  ++   +++           G             K          +  + TL
Sbjct: 352 SGIVINPEIMKSLDAIAAAQEEAGSTPVGNNKSALAIASIKFKVLAAGTGPNDLAESSTL 411

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
             Y R +I  L  +  ++    + S+++   +     +  GV++ +E++ ++K + +Y+ 
Sbjct: 412 DNYYRYTISQLGVDAQEAERNQLNSEMLVGTVDSQRQSVSGVSIDDEMAEMVKYQHAYSA 471

Query: 461 SNKLIMFTDKMLQTLLEGV 479
           S +++   D++L  ++ G+
Sbjct: 472 SARVMTSMDEILDKVINGM 490


>gi|221635454|ref|YP_002523330.1| flagellar hook-associated protein FlgK [Thermomicrobium roseum DSM
           5159]
 gi|221158038|gb|ACM07156.1| flagellar hook-associated protein FlgK [Thermomicrobium roseum DSM
           5159]
          Length = 468

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 74/493 (15%), Positives = 170/493 (34%), Gaps = 49/493 (9%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------TIS 46
                 A        +   +   NI NA+   + R+                        
Sbjct: 3   FRALETAFRGLMAQQRVVDTANHNIANANTPGFARQRVSLVPSMPYTVPAFNRSGLAGQV 62

Query: 47  PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V V +     +++FD      S A+G+   L    A  E +  ++         + +
Sbjct: 63  GTGVLVASITRVRESVFDLQYRVQSQALGEASTLVDAYAQIEAVF-NEPTEAGLGTLLDR 121

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
              + ++      +      ++ +A  +  N N   R++ +++AD   ++ L++S +   
Sbjct: 122 FWRAWQAVGNQPEDLAARAALVQDATTLATNLNRMRRQLTELQADTVTKLTLQVSEVNSI 181

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
              L  +N  I    A+    +D +DQRD+LL K++   G +     N  + +Y   G  
Sbjct: 182 AERLASLNQQIVAALATGQTPNDLMDQRDLLLDKLARFTGATIRPLPNGAVNIYL-GGYP 240

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF 286
           L +         +++  T +              +    A+ +G ++ALL + ++V+P  
Sbjct: 241 LVDQDQWFPLSVQVSGGTASVLWQG---------TTSPVALERGSLQALLHLHNAVLPGL 291

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
             +L+++   L    +          ++PG         +           + V P   +
Sbjct: 292 VQKLEDIRDALANEVNTLHMTGYGLSDLPGPPPGRPFFRITAG------GELEVEPSLVA 345

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           +P  +            +     G   +     +  +K      +   +   T+ ++   
Sbjct: 346 DPQLIA---------AADAPGEPGNNAIARQIAELRSK------LVLNSGTATINDFYNT 390

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
            +  +      +       + +   I       + V+L EE++ LIK +Q+Y  + + I 
Sbjct: 391 LVAEVGGASQTAQVTRDNQRALVEAIDRQRQEIMAVSLDEEMANLIKYQQAYGAAARAIT 450

Query: 467 FTDKMLQTLLEGV 479
             D+ML  ++ G+
Sbjct: 451 AVDEMLDRIINGM 463


>gi|78221659|ref|YP_383406.1| flagellar hook-associated protein [Geobacter metallireducens GS-15]
 gi|78192914|gb|ABB30681.1| Flagellar hook-associated protein [Geobacter metallireducens GS-15]
          Length = 477

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 77/495 (15%), Positives = 177/495 (35%), Gaps = 33/495 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           M++ ++ +  ++              NI N +   Y R+ T+                 V
Sbjct: 1   MAIQSILDIGKSSLIAQRLALEVTSENITNVNTPGYSRQTTVLATGITTMERGFPMGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V   +          L   ++  G    + S     E +  +D   +     +    ++
Sbjct: 61  KVADIQRAYDAFLQSQLSKENTDNGFGTAVLSSMKRTEQLF-NDLTTDGLGKAMQNFFNA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + N       + V+   +++V  F      +  ++ +A+K +E   S++   + ++
Sbjct: 120 WQDLTANPQGQPERQAVLSMGQQLVDQFQRINGYLNDVKNEANKSLEGLTSDVNDKIGQI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +ND IK        A++  DQRD+L++++S  +GI+ +   +  + V  + G  L   
Sbjct: 180 ASLNDQIKQIEIQGGHANELRDQRDLLVRQLSSKVGITYVENGDGTLSVSLTLGQPLVIG 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-----AVPKGKIKALLQIRDSVVPI 285
                   + +    +         G   + +  +        +G++   LQ+RD+++  
Sbjct: 240 DKAAKLSLEPDPGNSSYYKIMATSPGGNTAVDISTIAGGPGNAQGEMGGALQVRDTLING 299

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
           F + LDE+A  L    +     +       GL   +    +                   
Sbjct: 300 FLSDLDELAYNLANEVNSVHSASYGLTGTTGLNFFNPPAAMAG------------YSGKG 347

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
                +     V+      +    G     +     ++K      +A    N+TL  +  
Sbjct: 348 GISLAISKTSDVAAADSDPLTGGTGNNKSASSIASIYDKV-----LATSGGNLTLEGFFN 402

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           + +G +  +  D+     +S  +   +     +  GV+L EEL+ L+K +++Y  + KLI
Sbjct: 403 SLVGKVGVSVQDATRRADQSGGILKQLDNLRESNSGVSLDEELANLVKYQKAYEGAAKLI 462

Query: 466 MFTDKMLQTLLEGVK 480
                M+ T+L  ++
Sbjct: 463 NVGSDMMDTILGLIR 477


>gi|17988504|ref|NP_541137.1| flagellar hook-associated protein FlgK [Brucella melitensis bv. 1
           str. 16M]
 gi|225686884|ref|YP_002734856.1| flagellar hook-associated protein FlgK [Brucella melitensis ATCC
           23457]
 gi|256042865|ref|ZP_05445811.1| flagellar hook-associated protein FlgK [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256261979|ref|ZP_05464511.1| flagellar hook-associated protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260564102|ref|ZP_05834587.1| flagellar hook-associated protein [Brucella melitensis bv. 1 str.
           16M]
 gi|265989300|ref|ZP_06101857.1| FlgK [Brucella melitensis bv. 1 str. Rev.1]
 gi|17984296|gb|AAL53401.1| flagellar hook-associated protein 1 [Brucella melitensis bv. 1 str.
           16M]
 gi|225642989|gb|ACO02902.1| flagellar hook-associated protein FlgK [Brucella melitensis ATCC
           23457]
 gi|260151745|gb|EEW86838.1| flagellar hook-associated protein [Brucella melitensis bv. 1 str.
           16M]
 gi|262999969|gb|EEZ12659.1| FlgK [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091463|gb|EEZ15999.1| flagellar hook-associated protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326411302|gb|ADZ68366.1| flagellar hook-associated protein FlgK [Brucella melitensis M28]
 gi|326554591|gb|ADZ89230.1| flagellar hook-associated protein FlgK [Brucella melitensis M5-90]
          Length = 484

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 143/484 (29%), Positives = 238/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y  + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYVASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDCTRQVQSLRNDADREIADSVANINDLLAKFEKANQNVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|52082076|ref|YP_080867.1| flagellar hook-associated protein FlgK [Bacillus licheniformis ATCC
           14580]
 gi|52787465|ref|YP_093294.1| flagellar hook-associated protein FlgK [Bacillus licheniformis ATCC
           14580]
 gi|319647943|ref|ZP_08002161.1| FlgK protein [Bacillus sp. BT1B_CT2]
 gi|52005287|gb|AAU25229.1| flagellar hook-associated protein 1 [Bacillus licheniformis ATCC
           14580]
 gi|52349967|gb|AAU42601.1| FlgK [Bacillus licheniformis ATCC 14580]
 gi|317390284|gb|EFV71093.1| FlgK protein [Bacillus sp. BT1B_CT2]
          Length = 507

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 75/514 (14%), Positives = 159/514 (30%), Gaps = 53/514 (10%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------TI 45
                  A+   +      +    NI NA+ + Y R+                       
Sbjct: 5   TFLGLEIAKRGLSAQQSALSVTANNISNANTEGYSRQRVTFKASTPYPSVSRDSVGLAGQ 64

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
               V + +      +  D      ++  G            E +  ++  +      ++
Sbjct: 65  MGTGVEIGSVERVRDSFLDYQYRTQNTKAGYYNAKVDAFNQMEGIM-NELNDTGLNKVLN 123

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
              +S++  + N  E      V    + V   FNT    +  ++++   +I+  +  +  
Sbjct: 124 SFWNSIQELTNNAHEPSAASVVAQKGQAVADTFNTLYESLTTVQSNLGDQIDQNVMTINS 183

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
            LS+L  +N+ I     + +  +D  D+RD LL ++S ++ I           + T++G 
Sbjct: 184 LLSQLNSLNEQIAKVEPNGYLPNDLYDKRDQLLDELSSMVNIKVSYAKTGGNPLATAEGI 243

Query: 226 TLFETVPRD------------INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIK 273
              E +  +               E +             +          S   KG + 
Sbjct: 244 VSIEVLDVNGQSLGKVLDGPNFTTETVKVNYDNDTGLVTGVSLGGTDIGIDSFTSKGSLL 303

Query: 274 ALLQIRD--------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKD 325
            L++            + P     LD MA      F+        S   PG    +    
Sbjct: 304 GLIESYGYMSNGEEKGLYPEMLADLDTMALAFAKEFNAVHQSGFTSSGEPGGIFFEFTGG 363

Query: 326 LDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKN 385
                     +    +    S    +    +       N  NLA          D     
Sbjct: 364 EAEPAKGAAGKIKVADEIMNSKGDKVAASLNGEASDNANATNLANVFTKKIQIGD----- 418

Query: 386 FIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQ 445
                        T+L+Y    IG +     +++ L   ++ + N    +  +   V+L 
Sbjct: 419 ----------KTTTVLDYYAGIIGEMGVKAQETNRLAKNTETLVNTAELNRQSVSAVSLD 468

Query: 446 EELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           EE+S +I+ + +YN + ++I   D++L  ++ G+
Sbjct: 469 EEMSNMIQFQHAYNAAARMITLQDEVLDKIINGM 502


>gi|23500853|ref|NP_700293.1| flagellar hook-associated protein FlgK [Brucella suis 1330]
 gi|161621181|ref|YP_001595067.1| flagellar hook-associated protein FlgK [Brucella canis ATCC 23365]
 gi|254699261|ref|ZP_05161089.1| flagellar hook-associated protein FlgK [Brucella suis bv. 5 str.
           513]
 gi|254702382|ref|ZP_05164210.1| flagellar hook-associated protein FlgK [Brucella suis bv. 3 str.
           686]
 gi|254711817|ref|ZP_05173628.1| flagellar hook-associated protein FlgK [Brucella ceti M644/93/1]
 gi|254714886|ref|ZP_05176697.1| flagellar hook-associated protein FlgK [Brucella ceti M13/05/1]
 gi|256015897|ref|YP_003105906.1| flagellar hook-associated protein [Brucella microti CCM 4915]
 gi|256059805|ref|ZP_05450000.1| flagellar hook-associated protein FlgK [Brucella neotomae 5K33]
 gi|260568715|ref|ZP_05839184.1| flagellar hook-associated protein [Brucella suis bv. 4 str. 40]
 gi|261216576|ref|ZP_05930857.1| flagellar hook-associated protein FlgK [Brucella ceti M13/05/1]
 gi|261319446|ref|ZP_05958643.1| flagellar hook-associated protein FlgK [Brucella ceti M644/93/1]
 gi|261323785|ref|ZP_05962982.1| FlgK [Brucella neotomae 5K33]
 gi|261749701|ref|ZP_05993410.1| flagellar hook-associated protein [Brucella suis bv. 5 str. 513]
 gi|261752945|ref|ZP_05996654.1| flagellar hook-associated protein [Brucella suis bv. 3 str. 686]
 gi|294852967|ref|ZP_06793639.1| flagellar hook-associated protein FlgK [Brucella sp. NVSL 07-0026]
 gi|23464517|gb|AAN34298.1| flagellar hook-associated protein FlgK, putative [Brucella suis
           1330]
 gi|161337992|gb|ABX64296.1| flagellar hook-associated protein FlgK [Brucella canis ATCC 23365]
 gi|255998557|gb|ACU50244.1| flagellar hook-associated protein [Brucella microti CCM 4915]
 gi|260155380|gb|EEW90461.1| flagellar hook-associated protein [Brucella suis bv. 4 str. 40]
 gi|260921665|gb|EEX88233.1| flagellar hook-associated protein FlgK [Brucella ceti M13/05/1]
 gi|261292136|gb|EEX95632.1| flagellar hook-associated protein FlgK [Brucella ceti M644/93/1]
 gi|261299765|gb|EEY03262.1| FlgK [Brucella neotomae 5K33]
 gi|261739454|gb|EEY27380.1| flagellar hook-associated protein [Brucella suis bv. 5 str. 513]
 gi|261742698|gb|EEY30624.1| flagellar hook-associated protein [Brucella suis bv. 3 str. 686]
 gi|294818622|gb|EFG35622.1| flagellar hook-associated protein FlgK [Brucella sp. NVSL 07-0026]
          Length = 484

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 143/484 (29%), Positives = 239/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|313903612|ref|ZP_07837002.1| flagellar hook-associated protein FlgK [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466165|gb|EFR61689.1| flagellar hook-associated protein FlgK [Thermaerobacter
           subterraneus DSM 13965]
          Length = 533

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 66/539 (12%), Positives = 163/539 (30%), Gaps = 78/539 (14%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------------- 44
           S       A+       +       NI NA+   Y R+                      
Sbjct: 3   STFFGLELARLGLWAQQRALDVTGHNIANANTPGYSRQVARLAPTPAYAPPSRAMAVEAG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   +       D+ +      +G+ ++     A  E +   +  +      +
Sbjct: 63  QVGTGVQVAGIQRVRDLFLDRQVRDLQGQLGRWQVRTQTLAELETILG-EPSDAGLARAL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   ++L   +            I  A  +++ F  + R++  ++ + D  I   +    
Sbjct: 122 ADFWEALGVVANRPDSLPARTAAIQQAHTLLERFQEADRQLADLQRNLDASILARVDRAN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD- 223
           +  ++L  ++  I+  TA+    +D LD+RD L++++  ++ +    R    + V  +  
Sbjct: 182 QIATQLADLHRRIQVATAAGQSPNDLLDERDRLVEELGGLLPVRVTEREGGALRVEVAGL 241

Query: 224 ---------------------------------------------GTTLFETVPRDINFE 238
                                                           ++ +    +  E
Sbjct: 242 PLVDGRVVHLLVVREEPVAATGAGTGGAGSPGGGPAPGDPGAGDLVVRIYWSGTAQVLAE 301

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              +  +  E       G  +     + +  G+I   L+ RD +V   +  L  +   L 
Sbjct: 302 GTGTGALAGEPGAGTGAGPALLPLDDTVLEGGEIDGFLESRDRLVAGLRQDLKALFFALA 361

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
            + ++         + P    A G +         +  T         NP+        +
Sbjct: 362 TAVNQVHRQGYGLNDAP----APGSQGGGAGRDMFLLGTGTDLQAVVVNPALDDPANLAA 417

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                   +            ++     +      +       +Y  + +  L      +
Sbjct: 418 ALEAGAPGDG----------RNALALAQLRHAALALPGGAPAQDYLESVVAGLGIAGRQA 467

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
            +    +Q++ + ++    +  GV+L EE++ L++ + +Y  + +L+   D ML  L+E
Sbjct: 468 QEGQRTTQLLMDQVAAQRESVRGVSLDEEMTQLVRYQHAYAAAARLVTAVDSMLAVLIE 526


>gi|254695092|ref|ZP_05156920.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215443|ref|ZP_05929724.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917050|gb|EEX83911.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 3 str.
           Tulya]
          Length = 484

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 143/484 (29%), Positives = 238/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y  + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYVASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|306841277|ref|ZP_07473988.1| flagellar hook-associated protein FlgK [Brucella sp. BO2]
 gi|306288679|gb|EFM60010.1| flagellar hook-associated protein FlgK [Brucella sp. BO2]
          Length = 484

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 143/484 (29%), Positives = 238/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLAGGLDRLSALYSADNYSGSPSGLIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 TVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIGVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L  Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLTGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|306845418|ref|ZP_07477992.1| flagellar hook-associated protein FlgK [Brucella sp. BO1]
 gi|306274161|gb|EFM55977.1| flagellar hook-associated protein FlgK [Brucella sp. BO1]
          Length = 484

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 141/484 (29%), Positives = 238/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA     +L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EAMFNRYIQSNSAASASSILAGGLDRLSALYSADNYSGSPSGLIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFERANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  ++LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSEYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 TVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIGVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +N +  AG+ D +    ++F++  +FD  AGI+++ +L  Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNAQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLTGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|149182549|ref|ZP_01861021.1| flagellar hook-associated protein [Bacillus sp. SG-1]
 gi|148849741|gb|EDL63919.1| flagellar hook-associated protein [Bacillus sp. SG-1]
          Length = 529

 Score =  232 bits (592), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 74/524 (14%), Positives = 158/524 (30%), Gaps = 48/524 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+               N+ NA+   + R+      +               
Sbjct: 3   STFQGLETARRGMYTQQSALQVTGHNVANANTLGFTRQRINFEQTETYPPPAMNKPQIPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +    +  D      ++ +G            E +  ++  ++     +
Sbjct: 63  QIGTGVEAESVQRIRDSFLDVQYRGENNKLGYWETKAESLMKMEEIM-NEPSDSGLAKTM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                SL+  + N         V      + + F   +  +  IR D   EI +    + 
Sbjct: 122 DMFWQSLQDLAVNPKNSGARSVVRQRGIALAETFQYLSNSLSTIRQDIKNEIGVTEKEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L ++  VN  I          +D  D+RD L+  +S+++ I    + +       ++G
Sbjct: 182 SLLKQIHNVNKQIGDVEPHGMSPNDLYDERDRLIDDLSKLVNIKVTNQPSGGNSSPLAEG 241

Query: 225 TTLFETVPRD------------INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
             +   V  +             N  K+N  +  ++ N   I     +         GK+
Sbjct: 242 KAVISLVDGNNRPIANLVHAKGYNEIKVNIPSTGTDVNVNSISIGSQNYEMEKFDADGKL 301

Query: 273 KALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAG--------NSENVP 315
           K L++               P   ++LD +A      F++              +     
Sbjct: 302 KGLIESFGYMDKNGDTAGTYPDMLSELDNLAFTFAKEFNKIHSAGMSPNEINNVDKNGDR 361

Query: 316 GLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLI 375
                D +  ++               Q     S ++           +    A   D  
Sbjct: 362 NPVNKDILFFVNGDTNSLSESDRKGFSQRIGLSSEIKSSLDNIANADGSKPEEATTGDSS 421

Query: 376 NHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
                +   N  FD     +       Y    IG +  +  ++  L   S  +   + E 
Sbjct: 422 VLLQLTEVINKNFD-YGQNSQMANFRNYYEVLIGGMAVDAQNAVRLTDNSATLRQAVEER 480

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +T  V+L EE++ +I+ + +YN S ++I   D++L  ++ G+
Sbjct: 481 RMSTSAVSLDEEMTNMIQYQHAYNASARMISLQDELLDKIINGM 524


>gi|254720774|ref|ZP_05182585.1| flagellar hook-associated protein FlgK [Brucella sp. 83/13]
 gi|265985832|ref|ZP_06098567.1| flagellar hook-associated protein FlgK [Brucella sp. 83/13]
 gi|306840135|ref|ZP_07472920.1| flagellar hook-associated protein FlgK [Brucella sp. NF 2653]
 gi|264664424|gb|EEZ34685.1| flagellar hook-associated protein FlgK [Brucella sp. 83/13]
 gi|306404780|gb|EFM61074.1| flagellar hook-associated protein FlgK [Brucella sp. NF 2653]
          Length = 484

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 142/484 (29%), Positives = 237/484 (48%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLAGGLDRLSALYSADNYSGSPSGLIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T+      + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 TVLTLGVAGKAVMVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIGVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +N +  AG+ D +    ++F++  +FD  AGI++  +L  Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNAQGAAGFSDRLRALNEAFSEPMVFDAAAGISSGSSLTGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|163845456|ref|YP_001623111.1| flagellar hook-associated protein FlgK [Brucella suis ATCC 23445]
 gi|163676179|gb|ABY40289.1| flagellar hook-associated protein FlgK [Brucella suis ATCC 23445]
          Length = 484

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 142/484 (29%), Positives = 238/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + +  NI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSPNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|254691612|ref|ZP_05154866.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 6 str.
           870]
 gi|256256799|ref|ZP_05462335.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 9 str.
           C68]
 gi|260757243|ref|ZP_05869591.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 6 str.
           870]
 gi|260883047|ref|ZP_05894661.1| FlgK [Brucella abortus bv. 9 str. C68]
 gi|297250152|ref|ZP_06933853.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 5 str.
           B3196]
 gi|260677351|gb|EEX64172.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 6 str.
           870]
 gi|260872575|gb|EEX79644.1| FlgK [Brucella abortus bv. 9 str. C68]
 gi|297174021|gb|EFH33385.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 5 str.
           B3196]
          Length = 484

 Score =  232 bits (591), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 142/484 (29%), Positives = 237/484 (48%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y  + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYVASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++   IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLLGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|153011507|ref|YP_001372721.1| flagellar hook-associated protein FlgK [Ochrobactrum anthropi ATCC
           49188]
 gi|151563395|gb|ABS16892.1| flagellar hook-associated protein FlgK [Ochrobactrum anthropi ATCC
           49188]
          Length = 484

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 136/484 (28%), Positives = 238/484 (49%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A++ +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNIAGANDPDYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +S      +L         + + D+Y+ SP+  I  LRD+L++++ + S 
Sbjct: 61  EALFNKFIQSNSTASSSSILAGGLDRLSSLYSADNYSGSPSALIGDLRDALQTFAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   ++VQ +R DAD+EI   ++N+   L++   +N  I   
Sbjct: 121 SALGDSVVSTAQSLANALNAGTKQVQSLRNDADREIADSVANINDLLAKFEKINQEIVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +  D  D++DQRD +L+++S  IGI+T++R +NDMV++  +G TLFET  R ++FE+ 
Sbjct: 181 TRANRDVSDYMDQRDSILKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVSFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
                      + +DGV ++          G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 TVLAPGIAGKAVLVDGVPLNHETFDQPYGTGRLSGLLQLRDQIAPQYQMQLDEIARNLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETI----CVNPQYRSNPSFLRDGG 355
            F+E D     ++       A         +  GI+ TI            +   LRDGG
Sbjct: 301 MFAESDQTGVGADKTGLFSWAGSPDVPGAGVSAGIAGTIKVSSAFVTSEGGSSLLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +N +  AG+ D +    ++F++   F+ VAG+ TN +L +Y+ +SI WLE  R
Sbjct: 361 ANGADYKYNSEGGAGFSDRLRALNEAFSEPMTFNSVAGLATNSSLTDYSSSSISWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  + +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 421 QKANSEFSYNATIASQADAALSNANGVDMDTEMALLLDLEHSYQASSRVLTTISAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|89895774|ref|YP_519261.1| hypothetical protein DSY3028 [Desulfitobacterium hafniense Y51]
 gi|89335222|dbj|BAE84817.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 533

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 65/528 (12%), Positives = 178/528 (33%), Gaps = 51/528 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------P 47
           S  +    A+    +      +   NI NA+   Y R+      +               
Sbjct: 3   STFSGLELARRALESQQIALDTTGHNIANANTIGYTRQVVNLQATSPDSIPGMGHYLSIG 62

Query: 48  ENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL 107
             VTV +         D+     +S        ++  A  E +  ++  +NS ++ +++ 
Sbjct: 63  TGVTVQSIERARDIFIDRQFRWENSKQEYWATRENTLAQIEGLL-NEPSDNSLSNDLTQF 121

Query: 108 RDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
             +    + N         +++ A  +    +   +++ + +   D  + ++I  +  + 
Sbjct: 122 WSAWSVLANNPENLGARSVILERAATLADTLHHIDQQITEAQKSLDSSVRVQIDQINSYA 181

Query: 168 SELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD---- 223
           +++  +N  IK    +  + +D LD+RD L+  +S+++ +  +   + +      +    
Sbjct: 182 NQIQELNFQIKKVQITGDNPNDLLDKRDALIDDLSKLVNVRVVESRDPNFTDREVNIFKL 241

Query: 224 --------GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV---VVSSNQGSAVPKGKI 272
                      L +            +         +           ++       G +
Sbjct: 242 YIGNEKATNQILVDDTKAYQLETPAAAGASGEPFAEVKWGAGHPLGSGTSINLGEGSGAL 301

Query: 273 KALLQIR---------------DSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
           +A + +R               ++ +   ++Q +++A  L  + +       + +    L
Sbjct: 302 QASILLRGSGFEYDTANGDTKANAHLAYLRDQYNQLANGLAEAVNAIHRTGIDRDGNSDL 361

Query: 318 FIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP----- 372
              D            ++ T+  +P   +     +D          N +           
Sbjct: 362 DFFDTSGGTVTAANIKVNATLISDPWKIATGKVTKDADGNPVGAYGNGEIAKAISSLATG 421

Query: 373 -DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNH 431
              ++   D    + +  P     +  ++ +Y   ++  L  +   +  +     V+  H
Sbjct: 422 WTGLDDLTDPVTGDPVTTPPLPPLSASSIGDYYGAALAELGVDAQQATRMKESQAVLVTH 481

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +     + VGVN+ EE++ L+K ++SY  + +++   D ML T++ G+
Sbjct: 482 MYNQRQSVVGVNMDEEITNLVKFQKSYTAAARIVTMLDSMLDTIVNGM 529


>gi|237817501|ref|ZP_04596492.1| flagellar hook-associated protein FlgK [Brucella abortus str. 2308
           A]
 gi|237787336|gb|EEP61553.1| flagellar hook-associated protein FlgK [Brucella abortus str. 2308
           A]
          Length = 492

 Score =  231 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 142/484 (29%), Positives = 236/484 (48%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 9   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 68

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y  + S 
Sbjct: 69  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYVASPSN 128

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 129 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 188

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++   IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 189 TRMGRDVSDYLDQRDALLKQLLGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 248

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 249 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 308

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 309 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 368

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 369 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 428

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S+ ++     ML  L
Sbjct: 429 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSWVLTTVSAMLDDL 488

Query: 476 LEGV 479
           L  V
Sbjct: 489 LNAV 492


>gi|254475034|ref|ZP_05088420.1| flagellar hook-associated protein FlgK [Ruegeria sp. R11]
 gi|214029277|gb|EEB70112.1| flagellar hook-associated protein FlgK [Ruegeria sp. R11]
          Length = 482

 Score =  231 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 91/487 (18%), Positives = 186/487 (38%), Gaps = 18/487 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP---ENVTVVTQRS 57
           M++ +  N A +    A +Q + +  N+ N     Y RR    T +      V V   + 
Sbjct: 1   MTITSALNSAMSGLTAAGRQTSVVSENLANVLTPGYSRRSVALTSAGDGFAGVRVNGVQR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            N       +   ++ +G  ++   F      +        S T  ++    +L      
Sbjct: 61  FNDPGLQASVRTANTELGVSKVQSDFYGRMVELVGKADDPYSVTQRLTDFDSALIEAISR 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                    +   AEE+ ++ + +A  ++  R  AD+ I++++  + + L ++  +N  I
Sbjct: 121 PDSGPRLNDLSIQAEELARSISDAAEGLRNERTAADRAIDVQVETVNQSLEKIQKLNAKI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
               A+  D    LDQRD+L+ +++EII +  + R+   + +++  G  L +  P ++ F
Sbjct: 181 AISQAAGADTVSLLDQRDLLIDQVNEIIPVKVVNRDRGQVALFSDGGAVLLDGQPAELTF 240

Query: 238 EKMNSYTV-----TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
           +                + + I+G+ V +  G  +  G + A  ++RD +    Q  LD 
Sbjct: 241 DGKADTLPYMTLGNGLLSGLQINGIDVDTGPGGPLRGGSLAANFEVRDVLTVEAQEDLDA 300

Query: 293 MARVLIGSFSEK---DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           +AR LI  F +      +      +     A         +   I     V  Q ++   
Sbjct: 301 VARDLIERFQDPALDTTLGALDPGLFTDQGAFFDPANTVGIANRIELNDKVAMQGQAETW 360

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
            LRD               AG   L+  Y D+ +   +   V     N+     + N + 
Sbjct: 361 RLRD------GLNAAGPGNAGDASLLRAYTDALDTKRLVSSVGLGTANLDASTLSANLLS 414

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
              ++   +      +Q     + +      GV+   EL  LI +E+ Y  + ++I   D
Sbjct: 415 RFAQSEYSAQQNVAFAQATHTEMQQRQLAQ-GVDSDAELQNLIVIEKVYQANARMISVVD 473

Query: 470 KMLQTLL 476
           ++++TLL
Sbjct: 474 ELMETLL 480


>gi|89100618|ref|ZP_01173476.1| flagellar hook-associated protein K [Bacillus sp. NRRL B-14911]
 gi|89084642|gb|EAR63785.1| flagellar hook-associated protein K [Bacillus sp. NRRL B-14911]
          Length = 527

 Score =  230 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 68/528 (12%), Positives = 163/528 (30%), Gaps = 61/528 (11%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----------------SPE 48
               A+               NI NA+   + R+                          
Sbjct: 2   GLETARRGMFTQQSALYVTGHNIANANTPGFSRQRINFEQTSPYPAASMNRPQVPGQMGT 61

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V   + +   +   D      ++ +G    +       E +  ++   +     + K  
Sbjct: 62  GVEAGSVQRIREGFLDLQYRVEANKVGYYSSMSESLTKMEEIM-NEPSESGLHATMEKFW 120

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  + +            + + V    N     + +++ D   EI +++  +   +S
Sbjct: 121 NSLQDIASHTENTGARDVAAASGQMVADTLNYYYNSLSRVQQDIGSEIGVKVKEINGLVS 180

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           ++  +N  I     + +  +D  D+RD+ + ++S+++ I       ++          L+
Sbjct: 181 QINALNKQIASVEPNGYLPNDLYDERDLYVDQLSQLVNIKVTNVKPDNYGHAKDISEGLY 240

Query: 229 ----------ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ--------------- 263
                        P  +  +      +   +     D    ++                 
Sbjct: 241 KIEIVGDDGKSFSPAAVLLDVTKEDGLKDPNLLEVTDITDAANEDLELVSGLITEVRVGG 300

Query: 264 ---GSAVPKGKIKALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNS 311
               S    G++  L++               P    +L++        F++      + 
Sbjct: 301 AALPSMNFSGELSGLIKSYGYIDNSGNKAGFYPDMLQKLNDFTTAFAMEFNKIHESGFDL 360

Query: 312 ENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGY 371
              PG    +     D       ++ I VN    ++ S +    + +     N       
Sbjct: 361 NGNPGKAFFE----FDPSQGDNPAQQIRVNKDILADSSLIAAAATSTGGSGDNDNAHELS 416

Query: 372 PDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNH 431
                 +    +K     P +  + N  L  Y    IG L  +   +      S V+ + 
Sbjct: 417 QIKTKAFGSFLSKGDAGFPASMTSGN--LDTYYSGIIGRLGVDSQSAQKNANNSIVLADS 474

Query: 432 ISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           + +S  +   V+L EE++ +IK + +YN + + I   D+ML  ++ G+
Sbjct: 475 VDKSRQSVSAVSLDEEMTNMIKFQHAYNAAARNITVVDEMLDKIINGM 522


>gi|147678447|ref|YP_001212662.1| flagellar hook-associated protein FlgK [Pelotomaculum
           thermopropionicum SI]
 gi|146274544|dbj|BAF60293.1| flagellar hook-associated protein [Pelotomaculum thermopropionicum
           SI]
          Length = 471

 Score =  229 bits (583), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 66/496 (13%), Positives = 162/496 (32%), Gaps = 48/496 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       ++               N+ NA+   + R+  +   S               
Sbjct: 4   STFFSLEISRRGLAAGQTGMEVSGHNVANANTPGFTRQRPVLAASDPYTMPSRGKPVAAL 63

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                VTV           D  +   + ++G     +   +  E +   +  +      +
Sbjct: 64  QVGTGVTVEHIERIRDGFLDGQIRTETGSLGNWETQRDALSEVETIFM-EPSDTGLNTLL 122

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           S   +S +  SKN     +   ++ N+  +    N   + ++ ++ +  +   + I+++ 
Sbjct: 123 SNFWNSWQELSKNAENSPIRAALVQNSVSLANGLNHMYQMLETVKTNQRELANICINDIN 182

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
               ++  +N  I     +    +D LD+RD+LL +++ +         +  + V     
Sbjct: 183 SKARQIADLNKQIVNIKVAGDQPNDLLDRRDLLLDELARLTNFEVAENADGSIRVDIGTF 242

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD-SVV 283
             +  T    I      +     + +P               +  G+++ +  + + + +
Sbjct: 243 NLVDGTDYSAIEPITGWTPPQPWDQSPY------------DQITSGQLQGIKDVLNKNKL 290

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
             + + LD +A  LI   +         +   GL                   T      
Sbjct: 291 QGYADDLDRLASTLITEINGLHSAGYGLDGSSGLNYF----------------TGTGASN 334

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
              N   + D   V+     +     G  D      ++     + +        +T   +
Sbjct: 335 IAVNSDIINDLNKVAAASTGDADG-DGACDAPGDGSNALLIAQLQNKSIAGLGGITFGNF 393

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
            +N    L  +  +S  +    Q + + +S    +  GV++ EE++ LI+ + +Y  + +
Sbjct: 394 YKNLTARLGVDTQESSRMAENQQALVDQLSSRRESISGVSMDEEMTSLIQYQYAYQGAAR 453

Query: 464 LIMFTDKMLQTLLEGV 479
           +I   D+ML TL+  +
Sbjct: 454 VITVLDEMLDTLINRM 469


>gi|281418802|ref|ZP_06249821.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           JW20]
 gi|281407886|gb|EFB38145.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           JW20]
          Length = 489

 Score =  229 bits (583), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 79/492 (16%), Positives = 180/492 (36%), Gaps = 26/492 (5%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV 53
            A    A++      +  +    N+ N + K Y R+  M T                ++ 
Sbjct: 3   FAGLEIARSGMYVNERALSVTGHNVANVNTKGYARQQAMITTGPYLNLMRYQIGLGASIQ 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R       D +    ++ +G            + +  D   +    + +++  ++ + 
Sbjct: 63  ETRQIRHLFLDNIYRNENTELGYWETRSKTFQEIQTILGDPMGD-GLQNVLNQFWNAWQE 121

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            SK      +   V   AE +V   N    ++ K++ D +++I L I  +     ++  +
Sbjct: 122 LSKEPDSLTVRALVRQRAEALVHQINHLGAQLDKLQEDLNQQIVLTIKQINDITKQIAEL 181

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I  +     +A+D+ DQR++LL ++S++         N D+ V       + +    
Sbjct: 182 NVKIMQEEVCGDNANDYRDQRNLLLDELSKLADFEFTEMQNGDVQVTLGGYILVTK---- 237

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV------VPIFQ 287
               E++N     S+ N +F    +   N    V  G ++ LL+ R  V      +    
Sbjct: 238 ---GEQINLVAGKSDINKMFFVPKIEGENIEVPVKSGVLRGLLESRGDVSGSIEGITDPA 294

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
                 +  ++     +  +  NS       +    K L N    G    + +NP Y   
Sbjct: 295 ANPVPASANIVSDLKMRLNVLVNSLVTQVNNLHRSGKTLGNPPSDGEDFFVAINPAYPLE 354

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              ++   +++              D       +  ++      A ++  V+L +Y +  
Sbjct: 355 MGNIKLNDNLADLDNIVASKSGASGDNTIALAIANLRDNRVI--ADVSGMVSLDDYYQTI 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           I  +    S++       + + N       + +GV++ EE+S +++ + +Y+ S++ I  
Sbjct: 413 ILIVGTGGSEAKKTAENQRTLVNSAEAQRQSVMGVSMDEEMSNMMRYKFAYSASSRAINV 472

Query: 468 TDKMLQTLLEGV 479
            D ML+T++  +
Sbjct: 473 IDDMLETIITRM 484


>gi|62317956|ref|YP_223809.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 1 str.
           9-941]
 gi|83269933|ref|YP_419224.1| flagellar hook-associated protein FlgK [Brucella melitensis biovar
           Abortus 2308]
 gi|189023207|ref|YP_001932948.1| flagellar hook-associated protein FlgK [Brucella abortus S19]
 gi|254698189|ref|ZP_05160017.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731633|ref|ZP_05190211.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 4 str.
           292]
 gi|260544141|ref|ZP_05819962.1| flagellar hook-associated protein [Brucella abortus NCTC 8038]
 gi|260759392|ref|ZP_05871740.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 4 str.
           292]
 gi|260762636|ref|ZP_05874968.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 2 str.
           86/8/59]
 gi|12330681|gb|AAG52878.1| FlgK [Brucella abortus]
 gi|62198149|gb|AAX76448.1| hypothetical FlgK, flagellar hook-associated protein FlgK [Brucella
           abortus bv. 1 str. 9-941]
 gi|82940207|emb|CAJ13263.1| flagellar hook-associated protein FlgK, putative KO: K02396
           flagellar hook-associated protein 1 FlgK [Brucella
           melitensis biovar Abortus 2308]
 gi|189021781|gb|ACD74502.1| flagellar hook-associated protein [Brucella abortus S19]
 gi|260097412|gb|EEW81286.1| flagellar hook-associated protein [Brucella abortus NCTC 8038]
 gi|260669710|gb|EEX56650.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 4 str.
           292]
 gi|260673057|gb|EEX59878.1| flagellar hook-associated protein FlgK [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 484

 Score =  229 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 142/484 (29%), Positives = 236/484 (48%), Gaps = 5/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y  + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYVASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDGTRQVQSLRNDADREIADSVANINDLLAKFEKANQDVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++   IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQLLGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S+ ++     ML  L
Sbjct: 421 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSWVLTTVSAMLDDL 480

Query: 476 LEGV 479
           L  V
Sbjct: 481 LNAV 484


>gi|163738040|ref|ZP_02145456.1| Flagellar hook-associated protein [Phaeobacter gallaeciensis BS107]
 gi|161388656|gb|EDQ13009.1| Flagellar hook-associated protein [Phaeobacter gallaeciensis BS107]
          Length = 482

 Score =  229 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 93/487 (19%), Positives = 188/487 (38%), Gaps = 18/487 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP---ENVTVVTQRS 57
           MS+ +  N A      A +  + +  N+ N     Y RR    T +      V V   + 
Sbjct: 1   MSITSALNSAMTGLTAAGRSTSVVSENLSNVLTPGYSRRSLALTSAGDGFSGVKVGHVQR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            N       + + +S +G   +  +F      +        S T  ++     L      
Sbjct: 61  INDPALQSSVRSANSEVGVAEVKSAFFGRMTELVGSADDPYSITQRLTDFDSGLIEVISR 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                    +   AEE+V++   +A  ++  R  AD+ I++++  + + L +L  +N  I
Sbjct: 121 PDSGPRLNDLAIQAEELVRSIADAAEGLRNQRTAADRAIDVQVDTVNQSLEKLQKLNAKI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
               ++  D+   LDQRD+L+ ++++II +  + R+   + +++  G  L +    +++F
Sbjct: 181 AISQSTGSDSASLLDQRDLLIDEVNKIIPVKVVNRDRGQVALFSEGGAVLLDGQAAELSF 240

Query: 238 EKMNSYTV-----TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
           +                + + I+G+ V++  G  V  G + A  ++RD +    Q  LD 
Sbjct: 241 DGKADTLPYMTLGNGLLSGLQINGIDVATGPGGPVRGGTLAAQFEVRDVLTVEAQEDLDA 300

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL---CQGISETICVNPQYRSNPS 349
           MA+ LI  F +       +   PG+F   G              I     +  Q ++   
Sbjct: 301 MAKDLIERFQDPALDPTLTATDPGIFTDQGAFFDPANTVGIANRIELNDKIAMQGQAETW 360

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
            LRD               AG   L+  Y D+ +       V     N+     + N + 
Sbjct: 361 RLRD------GLNAASPGNAGDATLLRGYADALDAKRTVSSVGLGTANLDASTLSANLLS 414

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
              ++ + +      +   +  + +      GV+   EL  LI +E+ Y  + ++I   D
Sbjct: 415 RFAQSENSAEQNVAFAAATYTEMYQRELAQ-GVDSDAELQNLIVIEKVYQANARMISVVD 473

Query: 470 KMLQTLL 476
           ++++TLL
Sbjct: 474 ELMETLL 480


>gi|125974729|ref|YP_001038639.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           ATCC 27405]
 gi|125714954|gb|ABN53446.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           ATCC 27405]
          Length = 489

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 79/492 (16%), Positives = 181/492 (36%), Gaps = 26/492 (5%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV 53
            A    A++      +  +    N+ N + K Y R+  M T +              ++ 
Sbjct: 3   FAGLEIARSGMYVNERALSVTGHNVANVNTKGYARQQAMITTAPYLNLMRYQIGLGASIQ 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R       D +    ++ +G            + +  D   +    + +++  ++ + 
Sbjct: 63  ETRQIRHLFLDNIYRNENTELGYWETRSKTFQEIQTILGDPMGD-GLQNVLNQFWNAWQE 121

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            SK      +   V   AE +V   N    ++ K++ D +++I L I  +     ++  +
Sbjct: 122 LSKEPDSLTVRALVRQRAEALVHQINHLGAQLDKLQEDLNQQIVLTIKQINDITKQIAEL 181

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I  +     +A+D+ DQR++LL ++S++         N D+ V       + +    
Sbjct: 182 NVKIMQEEVCGDNANDYRDQRNLLLDELSKLADFEFTEMQNGDVQVTLGGYILVTK---- 237

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV------VPIFQ 287
               E++N     S+ N +F    +   N    V  G ++ LL+ R  V      +    
Sbjct: 238 ---GEQINLVAGKSDINKMFFVPKIEGENIEVPVKSGVLRGLLESRGDVSGSIEGITDPA 294

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
                 +  ++     +  +  NS       +    K L N    G    + +NP Y   
Sbjct: 295 ANPVPASANIVSDLKMRLNVLVNSLVTQVNNLHRSGKTLGNPPSDGEDFFVAINPAYPLE 354

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              ++   +++              D       +  ++      A ++  V+L +Y +  
Sbjct: 355 MGNIKLNDNLADLDNIVASKSGASGDNTIALAIANLRDNRVI--ADVSGMVSLDDYYQTI 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           I  +    S++       + + N       + +GV++ EE+S +++ + +Y+ S++ I  
Sbjct: 413 ILIVGTGGSEAKKTAENQRTLVNSAEAQRQSIMGVSMDEEMSNMMRYKFAYSASSRAINV 472

Query: 468 TDKMLQTLLEGV 479
            D ML+T++  +
Sbjct: 473 IDDMLETIITRM 484


>gi|256005260|ref|ZP_05430227.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 2360]
 gi|255990811|gb|EEU00926.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 2360]
 gi|316941863|gb|ADU75897.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 1313]
          Length = 489

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 79/492 (16%), Positives = 180/492 (36%), Gaps = 26/492 (5%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV 53
            A    A++      +  +    N+ N + K Y R+  M T                ++ 
Sbjct: 3   FAGLEIARSGMYVNERALSVTGHNVANVNTKGYARQQAMITTGPYLNLMRYQIGLGASIQ 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R       D +    ++ +G            + +  D   +    + +++  ++ + 
Sbjct: 63  ETRQIRHLFLDNIYRNENTELGYWETRSKTFQEIQTILGDPMGD-GLQNVLNQFWNAWQE 121

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            SK      +   V   AE +V   N    ++ K++ D +++I L I  +     ++  +
Sbjct: 122 LSKEPDSLTVRALVRQRAEALVHQINHLGAQLDKLQEDLNQQIVLTIKQINDITKQIAEL 181

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I  +     +A+D+ DQR++LL ++S++         N D+ V       + +    
Sbjct: 182 NIKIMQEEVCGDNANDYRDQRNLLLDELSKLADFEFTEMQNGDVQVTLGGYILVTK---- 237

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV------VPIFQ 287
               E++N     S+ N +F    +   N    V  G ++ LL+ R  V      +    
Sbjct: 238 ---GEQINLVAGKSDINKMFFVPKIEGENIEVPVKSGVLRGLLESRGDVSGSIEGITDPA 294

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
                 +  ++     +  +  NS       +    K L N    G    + +NP Y   
Sbjct: 295 ANPVPASANIVSDLKMRLNVLVNSLVTQVNNLHRSGKTLGNPPSDGEDFFVAINPAYPLE 354

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              ++   +++              D       +  ++      A ++  V+L +Y +  
Sbjct: 355 MGNIKLNDNLADLDNIVASKSGASGDNTIALAIANLRDNRVI--ADVSGMVSLDDYYQTI 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           I  +    S++       + + N       + +GV++ EE+S +++ + +Y+ S++ I  
Sbjct: 413 ILIVGTGGSEAEKTAENQRTLVNSAEAQRQSIMGVSMDEEMSNMMRYKFAYSASSRAINV 472

Query: 468 TDKMLQTLLEGV 479
            D ML+T++  +
Sbjct: 473 IDDMLETIITRM 484


>gi|126652479|ref|ZP_01724651.1| flagellar hook-associated protein K [Bacillus sp. B14905]
 gi|126590750|gb|EAZ84865.1| flagellar hook-associated protein K [Bacillus sp. B14905]
          Length = 530

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 64/524 (12%), Positives = 169/524 (32%), Gaps = 47/524 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       ++           +   NI NA+   Y R+      +               
Sbjct: 3   STFMGLEASKRGLFVQQTALYTTGHNISNANTLGYSRQRVNMQATPGFPTAGLNQPTYPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +       D+     ++ +G      +  A  E +  ++          
Sbjct: 63  HLGTGVEASSIQRIRSEFIDRQYRQETNKLGYWESRTNAIAQMEDVM-NEPSEFGLDKAF 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +    L+  +   ++    +  I  AE + ++FN   ++++ I+ +   E+ +  + + 
Sbjct: 122 EQFWKGLQDIATKPADGASRQVAISRAEHLAESFNYLDKQLKMIQGNLGNELNVSTTQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L ++  VN  I+    S H  +D  D RD L+ K++E I +S     +  +    ++G
Sbjct: 182 TILKQIAAVNKQIQEVEPSGHVPNDLYDVRDTLVDKLNEYIPVSIERIPSGGLASEVAEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVV 283
           +        D     + +    ++   +  +G  V+ +   ++  + ++  L  +     
Sbjct: 242 SLKITFKGADGVVRDLVNGKDFAQFTAMGTNGTKVTGDDITNSFSELQLTGLESLDAHEA 301

Query: 284 PIFQNQLDEMARVLIGSFSE----------KDPIAGNSENVPGLFIADGIKDLDNKLCQG 333
               +    + +    +                  G+ +      +    +  +  + + 
Sbjct: 302 GAVTSTQTAIKQQDFEASKGKLLSLINSFGYQSAGGDIKGYYTETLQKLDQLANAFIKEF 361

Query: 334 ISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
            ++          + +      S      +      G     +   +        DP   
Sbjct: 362 NAQHAKGYTLEEKDANGNIINASKPGGVFFEGTGAGGIKVNEDIKKNPNLLAASSDPTEE 421

Query: 394 INT------------------NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
            N                   N +L  + +  +G +  +  ++  L   S+     + +S
Sbjct: 422 GNGKNAYELANMQHKLYADIDNASLQSFYQAIVGKVGVDGEEALRLAASSESQLQMVFKS 481

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +   V+L EE++ +I  +Q+YN + ++I   D+ L  ++ G+
Sbjct: 482 RDSVSAVSLDEEMTNMITFQQAYNANARMITVVDETLDKIINGM 525


>gi|169826733|ref|YP_001696891.1| flagellar hook-associated protein FlgK [Lysinibacillus sphaericus
           C3-41]
 gi|168991221|gb|ACA38761.1| Flagellar hook-associated protein 1 (HAP1) [Lysinibacillus
           sphaericus C3-41]
          Length = 530

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 65/524 (12%), Positives = 170/524 (32%), Gaps = 47/524 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       ++           +   NI NA+   Y R+      +               
Sbjct: 3   STFMGLEASKRGLFVQQTALYTTGHNISNANTLGYSRQRVNMQATPGFPTAGLNQPTYPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +       D+     ++ +G      +  A  E +  ++          
Sbjct: 63  HLGTGVEAGSIQRIRSEFIDRQYRQETNKLGYWESRTNAIAQMEDVM-NEPSEFGLDKAF 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +    LE      ++    +  I  AE + ++FN   ++++ I+ +   E+ +  + + 
Sbjct: 122 EQFWKGLEDVGTKPADGASRQVAISRAEHLAESFNYLDKQLKMIQGNIGNELNVSTTQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L ++  VN  I+    S H  +D  D RD L+ K++E I +S     +  +    ++G
Sbjct: 182 TILKQIAAVNKQIQEVEPSGHVPNDLYDVRDTLVDKLNEYIPVSIERIPSGGLASEVAEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVV 283
           +        D     + +    ++   +  +G  V+ +   ++  + ++  L  +     
Sbjct: 242 SLKITFKGADGVVRDLVNGKDFAQFTAMGTNGTKVTGDDITNSFSELQLTGLESLDAHEA 301

Query: 284 PIFQNQLDEMARVLIGSFSE----------KDPIAGNSENVPGLFIADGIKDLDNKLCQG 333
            +  +    + +    +                  G+ +      +    +  +  + + 
Sbjct: 302 GVVTSTQTAIKQQDFEASKGKLLSLINSFGYQSAGGDIKGYYSETLQKLDQLANAFIKEF 361

Query: 334 ISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
            ++          + +      S      +      G     +   +        +P   
Sbjct: 362 NAQHAKGYTLEEKDANGNIINASKPGGVFFEGTGAGGIKVNEDILKNPNLLAASANPTEE 421

Query: 394 INT------------------NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
            N                   N +L  + +  +G +  +  ++  L   S+     +S+S
Sbjct: 422 GNGKNAYELANMQHKLYADIDNASLQSFYQAIVGKVGVDGEEALRLAASSESQLLMVSKS 481

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +   V+L EE++ +I  +Q+YN + ++I   D+ L  ++ G+
Sbjct: 482 RDSVSAVSLDEEMTNMITFQQAYNANARMITVVDETLDKIINGM 525


>gi|163758033|ref|ZP_02165121.1| hypothetical protein HPDFL43_00370 [Hoeflea phototrophica DFL-43]
 gi|162284322|gb|EDQ34605.1| hypothetical protein HPDFL43_00370 [Hoeflea phototrophica DFL-43]
          Length = 487

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 161/487 (33%), Positives = 254/487 (52%), Gaps = 7/487 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N AQ   +N S Q   + RNI NA N +Y RR+   + +     VV+ +    
Sbjct: 1   MSLTTAINTAQTSLSNTSTQTNIVSRNIANASNPDYNRRNAALSTNVYGAQVVSIQRAQD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               +     +S+   Q+ L +     + +   + Y  SP   +  LRD+L +++    E
Sbjct: 61  QALFQQSIKSASSSSGQQSLLTGLTTLKGIFGGNDYEQSPAALLGTLRDTLSTFAAQPGE 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           + L ++ I +A+ +       +  VQ++R DAD+EI+ E+ NL   LS     N+ +   
Sbjct: 121 NTLAQSTIADAQILAAGLRDGSAAVQRVRLDADQEIQREVDNLNELLSRFETANNNVYQG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T ++ D    LD RD LL++IS+IIG++ I R+ NDM +YTSDGTTLFETV R + F+  
Sbjct: 181 TQARRDVSAHLDDRDSLLKQISQIIGVTPITRSGNDMALYTSDGTTLFETVARPVTFDSS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             ++ T + N +++DGV + + QGS+   KG I+ LLQIRD + P  Q QLDE+AR L+ 
Sbjct: 241 AGFSATIQGNGVYVDGVPLPAGQGSSSTAKGTIQGLLQIRDDIAPKLQTQLDEIARALVV 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLC------QGISETICVNPQYRSNPSFLRD 353
           SF+E D  A  +              +             I+    + P    +P  LRD
Sbjct: 301 SFAETDQSATPTLPDEPGLFTWSGGTVPAGSTLVPGISATITVNPALVPSLGGDPKLLRD 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG     +  N    A +   ++ +  + +    FD  AG++T+ +LL++A +SIGWLE 
Sbjct: 361 GGINGAAYNANPAGAASFSAQLDSFVVAIDNPTGFDATAGLSTSTSLLDFAADSIGWLEL 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           NRS++       +       E+YSN  GV++ EE+S L+++EQSY  S +LI   D+MLQ
Sbjct: 421 NRSEADSAAQTREAFMFRAEEAYSNDTGVSIDEEMSMLLELEQSYKASARLISAVDEMLQ 480

Query: 474 TLLEGVK 480
            L+  V+
Sbjct: 481 ALMSVVR 487


>gi|295707173|ref|YP_003600248.1| flagellar hook-associated protein FlgK [Bacillus megaterium DSM
           319]
 gi|294804832|gb|ADF41898.1| flagellar hook-associated protein FlgK [Bacillus megaterium DSM
           319]
          Length = 507

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 78/512 (15%), Positives = 181/512 (35%), Gaps = 46/512 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +       +I  N+ NA+   Y R+                      
Sbjct: 3   STFHGLQVAKRGMDAQQAALYTIGHNVSNANTPGYTRQRVSLETFPAYPAPGMNQTGTAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   T         D      +  +G            E +  ++   +  +   
Sbjct: 63  QIGMGVEASTVERIRDTFLDTQYRDETIKVGYWDARAGALEKMEEIM-NEPTEDGLSAVF 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++  +S++  + + SE      +I+ AE V   F+  +  ++ ++ D   E ++ ++ + 
Sbjct: 122 NQFFESIQDVASHPSESGARSVMIERAEAVGDTFSYLSTSLKTVQGDLQNERDVAVTQVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L +++ VN  I+    + +  +D  D+RD LL +IS+ + +S     ++     TS+G
Sbjct: 182 SLLEQISNVNQQIQNIEPNGYLPNDLYDERDRLLDEISKFMPVSLEYTKSSGNASATSEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS--------AVPKGKIKALL 276
               +          ++  T    +  +  +     +            + P+GK+K L+
Sbjct: 242 VVTVQLQTSQGAITLLDGKTHQVNAISLKTNQDSYVTEIHIGDEIRNPESFPQGKLKGLI 301

Query: 277 QI---------RDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
           +          +  V     + LDEMA   +  F++K       +   G+   + I   +
Sbjct: 302 EASGYIDNSGNKTGVYASMIDDLDEMAYEFVNWFNDKHQQGVTLDGDTGMSFFNEISQKE 361

Query: 328 NKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI 387
                 +      +       +     G        + KN               ++   
Sbjct: 362 GAATGIVIANKIKHNTNNIAAASSASSGDNGTGRKGDGKN-----------AQLLSQFRQ 410

Query: 388 FDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEE 447
              +   N  V+L  + ++ IG +  +   ++ L   S+ +   + +   +T  V+L EE
Sbjct: 411 QVLINSGNQAVSLDGFYQSVIGQMSVDAQQANRLKSNSETLQGAVEQRRQSTSAVSLDEE 470

Query: 448 LSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           ++ +I+ + +YN S +++   D+ML  ++ G+
Sbjct: 471 MTNMIQFQHAYNASARMVTMIDEMLDKIVNGL 502


>gi|169831934|ref|YP_001717916.1| flagellar hook-associated protein FlgK [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638778|gb|ACA60284.1| flagellar hook-associated protein FlgK [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 532

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 67/533 (12%), Positives = 168/533 (31%), Gaps = 56/533 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+   +   Q   +   NI N +   Y R++ +   +              
Sbjct: 1   MS-FLGIEIARRSLHGHQQAMNTTAHNIANINTPGYKRQEAVLQSTPAIAYPSVFSPRPG 59

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                ++ V  +  +    D+ +    SAIG    +++     E +   +  +      +
Sbjct: 60  QLGTGMSAVEIKRYSDAYLDRQVREAQSAIGYWSGVETALQRVEAVL-PEPTDFGIQALL 118

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADA---DKEIELEIS 161
                +     ++ +       V   AE +  + + +   +  +R D    +     ++ 
Sbjct: 119 GNFFSTWHYLVQDPANPGSRSAVRGAAETLANSLSLAYYSLTNVRNDLIGGNDLFAQQVG 178

Query: 162 NLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYT 221
            +     ++  +N  I ++  +  + +D L++RD LL ++S++  +S  V N    +V  
Sbjct: 179 RINSIGRQIAELNREIAYQRTAGANPNDLLNRRDYLLDELSKLADVSVTVTNAELNLVSV 238

Query: 222 SDG----TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG------- 270
           S            +  D  F ++ +   + ++    ++G       G+            
Sbjct: 239 SVYGLELVNGDGYLATDRGFTELAADHESLQNLIEALEGSTRGGLAGTFAVGARVKEYLK 298

Query: 271 -----------------KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSEN 313
                             ++      + V           A  L   +   + +    + 
Sbjct: 299 QLELLMLSLANAVNGVLALEFFAFNIERVTGETAAGGGTDAHRLANGWLIANTVTITVDG 358

Query: 314 VPGLFIADGIKDLDNKLCQGISETICVNPQYR----SNPSFLRDGGSVSKKFLWNVKNLA 369
            P     +G +         + +TI    Q+        + + D    +       +   
Sbjct: 359 NPFEVYFEGDELPPGSGDWVLVDTITGTLQFGRIIEGTETIVADYDYKTGPISIGPEAEG 418

Query: 370 GYPDLINHYCDSFNK---NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQ 426
               +      +  +     + D       + TL  Y +  +  +  + + +        
Sbjct: 419 ALAQVTAEQAWAVAQIREQRVVDADGDGEDDTTLDGYYQQLVTGIGADLNAAQRGRDNVS 478

Query: 427 VVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            +   I     +  GVNL EEL+ +I+ +  Y  + ++I   D++L TL+  +
Sbjct: 479 AILGQIEALRESVSGVNLDEELTRMIQYQYGYQAAARVITVLDELLDTLINRM 531


>gi|294501824|ref|YP_003565524.1| flagellar hook-associated protein FlgK [Bacillus megaterium QM
           B1551]
 gi|294351761|gb|ADE72090.1| flagellar hook-associated protein FlgK [Bacillus megaterium QM
           B1551]
          Length = 507

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 75/512 (14%), Positives = 177/512 (34%), Gaps = 46/512 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +       +I  N+ NA+   Y R+                      
Sbjct: 3   STFHGLQVAKRGMDAQQAALYTIGHNVSNANTPGYTRQRVSLETFPAYPAPGMNQTGTAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   T         D      +  +G            E +  ++   +  +   
Sbjct: 63  QIGMGVEASTVERIRDTFLDTQYRDETIKVGYWDARAGALEKMEEIM-NEPTEDGLSAVF 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++  +S++  + + SE      +I+ AE V   F+  +  ++ ++ D   E ++ ++ + 
Sbjct: 122 NQFFESIQDVASHPSEAGARSVMIERAEAVGDTFSYLSTSLKTVQGDLQNERDVAVTQVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L +++ VN  I+    + +  +D  D+RD LL +IS+ + +S     ++     TS+G
Sbjct: 182 SLLEQISNVNQQIQNVEPNGYLPNDLYDERDRLLDEISKFMPVSLEYTKSSGNASATSEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS--------AVPKGKIKALL 276
               +          ++  T    +  +  +     +            + P+GK+K L+
Sbjct: 242 VVTVQLQTSQGPITLLDGKTHQVNAISLKTNQDSYVTEIHIGDEIRNPESFPQGKLKGLI 301

Query: 277 QI---------RDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
           +          +  V     + LDEMA   +  F++K       +   G+   + I   +
Sbjct: 302 EASGYIDNSGNKTGVYASMIDDLDEMAYEFVNWFNDKHQQGVTLDGDTGMSFFNEISQKE 361

Query: 328 NKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI 387
                 +              +     G        + +N             +     +
Sbjct: 362 GAAAGIVIADKIKQNTNNIAAASSASSGDDGTGRKGDGQNAQLLSQFRQKVLINSGSQAV 421

Query: 388 FDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEE 447
                      +L  + ++ IG +  +   ++ L   S+ +   + +   +T  V+L EE
Sbjct: 422 -----------SLDGFYQSVIGQMSVDAQQANRLKSNSETLQGAVEQRRQSTSAVSLDEE 470

Query: 448 LSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           ++ +I+ + +YN S +++   D+ML  ++ G+
Sbjct: 471 MTNMIQFQHAYNASARMVTMIDEMLDKIVNGL 502


>gi|220927554|ref|YP_002504463.1| flagellar hook-associated protein FlgK [Clostridium cellulolyticum
           H10]
 gi|219997882|gb|ACL74483.1| flagellar hook-associated protein FlgK [Clostridium cellulolyticum
           H10]
          Length = 537

 Score =  227 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 81/530 (15%), Positives = 175/530 (33%), Gaps = 58/530 (10%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PENVT 51
               N A +    A +   ++  N+ NA    Y R+ ++ + S                 
Sbjct: 5   FFGLNIALSGLYTAQRNLDTVGHNLSNASTPGYSRQQSIQSASNPLAVMDGTGMVGTGSQ 64

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           V           D    + + A G+           ++   ++   +     +    DSL
Sbjct: 65  VTGVERIRDTYLDFKYWSENVANGEWSKKAELMGEIQVTF-NEPSKSGFVKIMDGFFDSL 123

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           +  SK+ S       V+  A  + + FN +A   ++ + D + +++ ++  +    S++ 
Sbjct: 124 QELSKDPSSGAARALVVQKATTLAKYFNNTATHFEQFQNDINDQVKTDVDQINIIASQIQ 183

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV--------RNNNDMVVYTSD 223
           ++N  I     +   A+D  D R +L+ ++S++  I              ++     T  
Sbjct: 184 LLNKQIYNYELTGGTANDLRDSRTLLVDQLSKLANIQAKEIPYGKLPNGEDDIHFQITLS 243

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS-- 281
           G TL +            +  +  E      D      N  + +  G+++ LL +RD   
Sbjct: 244 GKTLVDHFSATKLIVVQRNIKLNEEDIGNLYDIKWEDGNSVN-ITGGELRGLLDVRDGKD 302

Query: 282 ---------VVPIFQNQLDEMARVLIGSFSE------------------------KDPIA 308
                     VP +Q +L+E  R    +F+E                         D   
Sbjct: 303 GIDGTPIYKGVPYYQRKLNEFVRTFAINFNEGYTRNDALPDGYEHNGVGHIEGYGYDSDL 362

Query: 309 GNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNL 368
            ++      F    + D        I     V               SVS   + +   +
Sbjct: 363 TDAPTGIRFFTMLCVGDTPISGSAFIGTATSVGDIANQYNQITAKNFSVSSDIIDDANRI 422

Query: 369 A-GYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQV 427
           A    D  N   +   K         +       ++ ++ +  +  +   +       + 
Sbjct: 423 ATSDADGQNGNTNILKKLMGIRSNQSLFKEGAPEDFMKSLVAGMGIDAQQAETFAKTQKA 482

Query: 428 VFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +  GVNL EE++ ++K +QSYN + ++I+   ++  TL+ 
Sbjct: 483 LVRQVDNRRMSVSGVNLNEEMTNMVKFQQSYNAAARMIVTMGEIYDTLIN 532


>gi|23099962|ref|NP_693428.1| flagellar hook-associated protein FlgK [Oceanobacillus iheyensis
           HTE831]
 gi|22778193|dbj|BAC14463.1| flagellar hook-associated protein 1 [Oceanobacillus iheyensis
           HTE831]
          Length = 490

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 65/496 (13%), Positives = 158/496 (31%), Gaps = 28/496 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           M        ++           +   NI NA+   Y R+                     
Sbjct: 1   MGTFYGLEMSRQALAAQQSALYTTGHNISNANTPGYTRQRVNLEAMNGFPYASRNRPNMP 60

Query: 47  ---PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                 V   + +       D    + +++ G      +  +  E +  ++  ++  +  
Sbjct: 61  GQMGTGVEAGSVQRIRNQFLDNQFRSENNSSGYWTEKANALSRMENVM-NEPSDSGLSKT 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +++   SL+  + N         V+     +   FN  +  +  IR D   +I+  + + 
Sbjct: 120 MNQFWQSLQDLAVNPDNAGARSVVLQRGHALADTFNYISSSMSTIRTDLSNQIDTTVKDA 179

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              +  +  +N+ IK      +DA+D  D+RDVLL ++S I+ I     N++        
Sbjct: 180 NSLIDNIDNLNEQIKNLETHGYDANDLYDKRDVLLDELSGIVNIKVTYDNSHAKNRADG- 238

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              +      + + + + +     E     I+    +  + + +   +   +        
Sbjct: 239 ---VATVEVLNDSGDSIATLVDGVEGTVNHIEAPTYNEGEENDLTVIEDIQVNGESILSS 295

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
               + L E    +       D     S      +      +  +               
Sbjct: 296 KGSLSGLVESYGYMEDGERVGDYPEMMSRLDELAYSIATSFNEIHSEGDSGVPFFGELTD 355

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
            +     +       +    +    AG  DL +   D F           +    ++ +Y
Sbjct: 356 EKGAAGAISVILEDYEDINASADGEAGSGDLASDLADIFTNP------NDLLDGASINDY 409

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
             + IG L      ++ +   +  + + +     +   V+L EE+S +IK + +YN + +
Sbjct: 410 FGSIIGDLGVKSEQAYTMQENTMTLQHQVENQRLSISAVSLDEEMSNMIKFQHAYNAAAR 469

Query: 464 LIMFTDKMLQTLLEGV 479
            +   D+M+ T++  +
Sbjct: 470 GMTTMDEMIDTIINRM 485


>gi|302037635|ref|YP_003797957.1| first flagellar hook-filament junction protein FlgK [Candidatus
           Nitrospira defluvii]
 gi|300605699|emb|CBK42032.1| First flagellar hook-filament junction protein FlgK [Candidatus
           Nitrospira defluvii]
          Length = 464

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 73/491 (14%), Positives = 174/491 (35%), Gaps = 38/491 (7%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PEN 49
           MS L  +F    N      +  +   +NI N     Y R++   + S             
Sbjct: 1   MSGLNGLFGIGSNALATFQRALSVTGQNIANVSTPGYSRQEITLSESLPENGQPGQIGTG 60

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           VT    R    +  ++ L + +  +GQ        +  +++  +D  +      +++   
Sbjct: 61  VTATEIRRSVDSFVEQQLLSSNERVGQFGASHKALSQIQLVF-NDANDQGIAAGLNEFFK 119

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           + +  + N ++      ++  A+ + +  N +  ++   R   D +++  I+++    S+
Sbjct: 120 AWQDVATNPADLTARTVLLTKADGLTKLLNQADAQLSAQRTSLDGQVQSGINDVNALASK 179

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N  IK    S   A+D  DQR   L  ++ ++ IS+I      + V+   G  L  
Sbjct: 180 IADLNSQIKLTEISGQQANDLRDQRGRFLNDLAGLVDISSIEDATGQVTVFVGIGQVLVA 239

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      N        +  +  G   +++  SA+  G++K L+  RD+     Q  
Sbjct: 240 EKTAYRLTGVAN-IANNGLLDVRYDGGTGPNTDITSAISGGRLKGLIDARDTTAAGLQTS 298

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           L+ +   L+   + +  +    +                 +   +++             
Sbjct: 299 LNTLTAQLVSQVNTQHRLGYGLDGSTTQDFFTASGTTAGTISMALTDRQK---------- 348

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                          +   +    +  +  ++   + +         N T   Y     G
Sbjct: 349 ---------------IAASSTAAGVPGNNVNALALSNLQTASVAGLGNTTFQGYYSAMAG 393

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
                   +       +++ + +    +   GV++ EEL  L+K ++++  ++KLI  +D
Sbjct: 394 SFGGTLQGATRDLQGQEILHDQLLAHRAEVSGVSMDEELINLLKYQRAFEAASKLITTSD 453

Query: 470 KMLQTLLEGVK 480
           +MLQT+L   +
Sbjct: 454 EMLQTILTLKR 464


>gi|317130315|ref|YP_004096597.1| flagellar hook-associated protein FlgK [Bacillus cellulosilyticus
           DSM 2522]
 gi|315475263|gb|ADU31866.1| flagellar hook-associated protein FlgK [Bacillus cellulosilyticus
           DSM 2522]
          Length = 550

 Score =  226 bits (575), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 67/543 (12%), Positives = 175/543 (32%), Gaps = 66/543 (12%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+           +   NI NA+   Y R+    + +               
Sbjct: 4   STFHGLETARRAMTTHQSALHTTGHNIANANTPGYSRQRVNFSTTEAFPTPAFNMPNMPG 63

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V     +   +   D    + ++  G      +     E +  ++   +     +
Sbjct: 64  QIGTGVKAGEVQRIREAFLDTQFRSENNKNGYWTARHNALEKMEDIM-NEPTESGLASTM 122

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   SL+  S +  +      V      V + F  + + +Q I+ D   EI ++   + 
Sbjct: 123 DRFWQSLQDLSVHPEDAGARSVVRQRGIAVAETFQYTYQSLQAIQEDYRSEIGVQQDRIN 182

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             + ++  +N  I          +D  DQRD+L+ ++S  + ++    ++       + G
Sbjct: 183 SLIRQINNINKQISQVEPHGLLPNDLYDQRDLLVDELSGFMNVTVETVSSGGNASPQATG 242

Query: 225 ---TTLFETVPRDINFEKMNSYTVTSESNPIFID-------------------------- 255
                L +   RD+    ++   +      I                             
Sbjct: 243 RYTIKLADEHGRDMGVTLVDGARLERTELHISYSDDGLVQGLHVANERALNQVENASEIK 302

Query: 256 ----GVVVSSNQGSAVPKGKIKALLQIRD---------SVVPIFQNQLDEMARVLIGSFS 302
               GVV  +N  +    G ++A ++               P     LD M    +   +
Sbjct: 303 DLTSGVVHMNNLDAFRSPGALRATIETHGYIDRNGQVRGDYPEMMANLDLMVFTFVEELN 362

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS-----NPSFLRDGGSV 357
                  +   +     A+  + +        +     N +  +     N + + +  ++
Sbjct: 363 AVHSSGWSLSEIEAGVKANDGEGIPFFTFAENANISSDNMKGAAQFLQVNRAIIEELDNI 422

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVT-LLEYARNSIGWLEKNRS 416
           +     +  N            ++     + D       + T +  + ++ IG +  + +
Sbjct: 423 AASGFTSNPNEPLSEGFAGDGSNALALANVKDKNLSFGGSTTNVQSFYQSVIGNMAVDLN 482

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +++ +   ++ + + + +   + +GV+L EE++ +I+ + +YN + + I   D+ML  ++
Sbjct: 483 EANRMMKNTETLRDSVEDRRQSVMGVSLDEEMTNMIQFQHAYNAAARNITMIDEMLDIII 542

Query: 477 EGV 479
             +
Sbjct: 543 NRM 545


>gi|206895941|ref|YP_002246669.1| flagellar hook-associated protein FlgK [Coprothermobacter
           proteolyticus DSM 5265]
 gi|206738558|gb|ACI17636.1| flagellar hook-associated protein FlgK [Coprothermobacter
           proteolyticus DSM 5265]
          Length = 540

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 73/537 (13%), Positives = 174/537 (32%), Gaps = 67/537 (12%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------TISPE 48
               A+               NI N +   Y R++ +                       
Sbjct: 4   SLEIAKRSLQAQMLALDVTSHNIANVNTPGYSRQEAVFRPTQPYGIVSWLGTINPGQVGT 63

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V + + R    +  D      +S      +     ++ E  S ++  ++     +S   
Sbjct: 64  GVQISSIRRLRNDFVDMNYRNVTSESSYYSVKDQVFSILES-SINEIKDSGLQKALSDFF 122

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           D+    S +  +  + + +++ ++ ++  F     ++   R+D D +I   ++ +     
Sbjct: 123 DAWHEGSVSPEDPTVRRIIVEQSQNLIDAFKYVQNQLVSTRSDVDFQIVNSVARINDIGK 182

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           E+  +N+ I   T+     +D LDQRD LL ++S+ + I  +      + V+    + + 
Sbjct: 183 EIAKLNEQISLSTSQGQQPNDLLDQRDNLLDELSQYVNIQKVALPTGSVSVFIGGLSFVD 242

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFID--------------------------------- 255
           +    +I     +    + E                                        
Sbjct: 243 DRTVNEIKAIDNDRLIDSGEGYKYTEGLATYSVLPGLIQNDKWNESIALGTEDIYNGHVS 302

Query: 256 ------GVVVSSNQGSAVPKGKIKALLQIRDSVVP-------IFQNQLDEMARVLIGSFS 302
                 G  +       +  GK+K L+++RD V+            +++EMA       +
Sbjct: 303 TLWLTMGNSLVPLDDRHLAGGKLKGLVEMRDDVIAYGEEPGRGLLGKINEMAYYFFDKIN 362

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV-SKKF 361
                  +                 N + + I   + ++P   S+P+ L  G +  +   
Sbjct: 363 LMLKQGKDLNGDAYSSNFFNWD--VNVVPKNIISAVALDPTVVSDPTKLPIGVTGLAGDG 420

Query: 362 LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDL 421
              +       + +    +  N       + G     ++ +  R  +     + S +   
Sbjct: 421 SLALLIAQEQNNALETVPEILNSTLWNPSLPGFLKGQSVAQSWRTLVAEWSADISRNRAF 480

Query: 422 HMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
              +  V + ++   ++  GVNL EE   LI+ ++ Y +S +++   D ML  ++  
Sbjct: 481 MEGTNNVKSELTLLRTSESGVNLDEEAVNLIRFQKGYAMSARIVSVVDGMLDLIINM 537


>gi|299536009|ref|ZP_07049328.1| flagellar hook-associated protein FlgK [Lysinibacillus fusiformis
           ZC1]
 gi|298728614|gb|EFI69170.1| flagellar hook-associated protein FlgK [Lysinibacillus fusiformis
           ZC1]
          Length = 555

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 71/550 (12%), Positives = 162/550 (29%), Gaps = 74/550 (13%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       ++           +   NI NA+   Y R+      +               
Sbjct: 3   STFMGLEASKRGLFTQQTALYTTGHNISNANTLGYSRQRVNMQATPGFPTAGLNQPIYPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +       D+     ++  G      +  +  E +  D+         +
Sbjct: 63  HLGTGVEAGSIQRIRDEFIDRQYRQETNKFGYWESRSNAISQMEDIM-DEPSQFGLNAAL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +    LE  S N          I+ A+ + Q+FN    +++ I+ +   EI +    + 
Sbjct: 122 EQFWKGLEDVSTNPENASSRTVAIERAKHLAQSFNYMDTQIKTIQGNLGNEINVSTDRIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST--------------- 209
             L  +  +N  I+    + H  +D  D RDVL+ +++  I +S                
Sbjct: 182 SILKRIASINKQIQEVEPNGHVPNDLYDARDVLIDELNSYIPVSIERVPSGGVASEVAEG 241

Query: 210 -----IVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQG 264
                     +   +   +G           +     +    ++   +F +  +    + 
Sbjct: 242 SLTIKFKPYPSGAPIELVNGREYAAFTTTGTDATGTVASIDGNDLTKVFQEIKISKLGEP 301

Query: 265 SAVPKGKIKALLQIRDSVVPIFQNQLDEMA------------------------------ 294
              P      L  I+ + +   + +L  +                               
Sbjct: 302 PTKPAADAVGLESIKYNELEPGKGKLLSLINSYGYAEYDAGGAFSGIKGYYPEALANLDK 361

Query: 295 --RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD---NKLCQGISETICVNPQYRSNPS 349
                  +F+       +   V          D     N     I+E    +    +  S
Sbjct: 362 LASTFANTFNAVHKAGYDLTGVQNGLNFFETMDGSTTINAGNIKINEEFTKDTSKLAASS 421

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
              + G+                          N   +  P      + T   + +  IG
Sbjct: 422 APNEVGNGKWAIELANLQSKAIGAGGFTITVGAN-TVVIPPSTEHLDSATFNSFYQGMIG 480

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            L  +  +++ L+  S+ +   I+ + ++   V+L EE++ +I  +Q+YN + ++I   D
Sbjct: 481 KLGTDGEEAYQLNKTSENLLLSITYNRASVSSVSLDEEMTNMITFQQAYNANARMITVVD 540

Query: 470 KMLQTLLEGV 479
           + L  ++ G+
Sbjct: 541 ETLDKIINGM 550


>gi|188586845|ref|YP_001918390.1| flagellar hook-associated protein FlgK [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351532|gb|ACB85802.1| flagellar hook-associated protein FlgK [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 568

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 68/562 (12%), Positives = 173/562 (30%), Gaps = 85/562 (15%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+           +   NI NA+   Y R+    + +               
Sbjct: 3   STFHGMETAKRALFAQRNALDTTGHNIANAERDGYTRQKAHMSATSPYTMPAQNMPGTAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V +      +  D  +   S   G            E +   +  ++      
Sbjct: 63  QIGTGVEVESVERMRDDFIDSQIREESRFKGNWENKNDTLKKIETLY-TEPSDSGLRSVF 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +  +SL+  SKN  +      V++    +    N    +   ++ D D+ I++++  + 
Sbjct: 122 DQFWESLQDLSKNPEDRTARTQVMERGVSLADTVNHMYGQFVNLKEDLDESIDIKVDEIN 181

Query: 165 RFLSELTVVNDAIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
               ++  +N+ I+     +  +A+D  D+RD+LL ++SE+   +    +  ++ V    
Sbjct: 182 SIGHQIADLNEQIQNIELRTNQNANDLRDKRDMLLDELSELTNYNLSEDDKGNVRVSIGG 241

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVS-------------SNQGSAVPKG 270
            + +      ++ FE   +       N      + +              + +      G
Sbjct: 242 TSLVEGNRVNELEFEAEAADADNDNGNNEGNGNIYLDDQEPRGGKVKWSHTGEEVNFRDG 301

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKD--------------PIAGNSENVPG 316
            +  L+  RD +V    ++L  +      SF+                     +  +   
Sbjct: 302 AMGGLMDSRDKIVQDHIDELRSVMAQFQESFNVVHSDDRAFNHYQAQAAQDGEDPFSDDV 361

Query: 317 LFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR------------------------ 352
             + +  +  ++               Y  N  ++                         
Sbjct: 362 NQVDNFFEWKNDGNELLTVNEEIQEDVYLINAGYIDNDTLSEYLDGDYDDDDLSDMGLED 421

Query: 353 --------------DGGSVSKKFLWNVKNLAGYPDLINH-YCDSFNKNFIFDPVAGINTN 397
                         D       +  N +N     +L +            FD    I+ +
Sbjct: 422 IFGDNYETQEPENMDINPNKLMYRGNGENGKRLANLKDEDIIKEVPSEDNFDNDEKISGD 481

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            T  +Y    +  L     ++  +    +++ + +        GV++ EE++ +++ + +
Sbjct: 482 TTFNDYIDAVVSDLGVEAQEAERMVENQELLVDQLENRREAVSGVSMDEEMTKMVQQQHA 541

Query: 458 YNISNKLIMFTDKMLQTLLEGV 479
           YN +++++   D+ L T++  +
Sbjct: 542 YNAASRVVTTIDESLDTIINQM 563


>gi|254464939|ref|ZP_05078350.1| flagellar hook-associated protein FlgK [Rhodobacterales bacterium
           Y4I]
 gi|206685847|gb|EDZ46329.1| flagellar hook-associated protein FlgK [Rhodobacterales bacterium
           Y4I]
          Length = 482

 Score =  224 bits (570), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 88/487 (18%), Positives = 169/487 (34%), Gaps = 18/487 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV---TVVTQRS 57
           MS+ +  N A    + A +    +  N+ NA    Y RR          V    +   + 
Sbjct: 1   MSIYSALNSAMTGLSAAGRSSQVVAENLANALTPGYTRRVLDLNSPGAGVPGVRIGDVQR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            N  +         +  G  +    F +    +        S    +S    SL      
Sbjct: 61  LNDPVLISNRRVAEAEYGAAKAEGDFFSRISDLVGTVDDEMSLASQLSDFESSLIEAVSR 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                    +   A  +  + + +A  ++ +R +AD  I  ++  + + L E+  +N  I
Sbjct: 121 PDSQPRLNDLSVKANALADSISRTAEGLRGLRINADSAIGSQVDTVNQALKEIEKLNARI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
               A   DA    DQRD L+ +++ II ++ + R++  + +Y++ G  L +    +++F
Sbjct: 181 MVVEAGGMDAVSMQDQRDQLIDQVNAIIPVNVVRRDSGQVTLYSTGGVMLLDHKASELSF 240

Query: 238 EKMNSYTVTSE-----SNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                            + + ++G  + +     +  G + A  QIRD      Q  LD 
Sbjct: 241 APSRDIMPHMTLGNGMISGLQVNGKTIGTGPDGPLRGGTLTAQFQIRDVTAVEAQEDLDA 300

Query: 293 MARVLIGSFSEKD---PIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           MA  LI  F +      I      +     +         L   I     +         
Sbjct: 301 MAADLIERFQDPSLDATIGVTDAGIFTDDGSFYDPANIVGLSNRIELNDLLALDRAGETW 360

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
             RD                G   L+  Y D+ N       V     N+T    + N + 
Sbjct: 361 RFRD------GLYAAAPGDPGDSSLLQAYSDALNTTRTVSSVGLGTANMTAATLSANLLS 414

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
              ++   +      +   FN +S++     GV+   EL  L+ VE+ Y  + +++   D
Sbjct: 415 RFAQDNETAARASTFAATSFNELSQAELAL-GVDTDAELQNLMLVEKYYAANARMLSVVD 473

Query: 470 KMLQTLL 476
           ++++TLL
Sbjct: 474 ELMETLL 480


>gi|260431757|ref|ZP_05785728.1| flagellar hook-associated protein FlgK [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415585|gb|EEX08844.1| flagellar hook-associated protein FlgK [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 483

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 94/490 (19%), Positives = 183/490 (37%), Gaps = 19/490 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS---PENVTVVTQRS 57
           MS+    N A    + AS+  A +  NI NA    Y +R      S      V VV    
Sbjct: 1   MSMSTALNNALGGLSAASRGAAVVSGNIANALTPGYAKRTLELATSQISGNGVQVVGVTR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +  +    L A  + +     +  F +  E +        S +  +    +SL + + N
Sbjct: 61  HHDPVLAANLRAADADLALNSAIADFHSRFEALVGTPDDAASVSARLVDFENSLITAASN 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                    V  + +++ +  N ++  ++++R+DAD++I   +  L   L ++  +N  I
Sbjct: 121 PGSAERLDQVARSGDDLARALNDASEGLREMRSDADRKIGSYVDTLNTTLKDIEDLNARI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  D +  LD+R VL+ +++E+I ++ + R+NN + +Y+  G  L E    +  F
Sbjct: 181 PAVQNAGGDINGLLDRRQVLIDQVNELIPVNVVARDNNRVSLYSDGGLILLEGSAAEFAF 240

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQ------GSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                           + G+ ++          + +  G + A  QIRD +    Q QLD
Sbjct: 241 TTTGDTKPHMTIGNGLLSGLEINGQPVRTSGENAQIRGGALMAQFQIRDELSIEAQVQLD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIA---DGIKDLDNKLCQGISETICVNPQYRSNP 348
            +A+ LI  F             PGLF              L   I     V+P    N 
Sbjct: 301 AVAQDLIERFETPGLDPTALATDPGLFTDDGSRFSAAAPAGLASRIELNATVDPDAGGNS 360

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             LR              N +G    +  +    N+            ++   E +   +
Sbjct: 361 WKLR------AGLGAAAPNDSGDATQLQAFSTVLNQARPVSIPDFGTGSLRAAELSEALL 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
                N   +      +  +   + +  +   GV+   EL  ++++EQ+Y  + ++I   
Sbjct: 415 SKAGANAHTAQSRMTFAASLHQQMEQLVAEQ-GVDSDAELQRMMQIEQAYAANARIISVV 473

Query: 469 DKMLQTLLEG 478
           D++++ LL  
Sbjct: 474 DELMEMLLRL 483


>gi|51246541|ref|YP_066425.1| flagellar hook-associated protein 1 (FlgK) [Desulfotalea
           psychrophila LSv54]
 gi|50877578|emb|CAG37418.1| related to Flagellar hook-associated protein 1 (FlgK) [Desulfotalea
           psychrophila LSv54]
          Length = 480

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 78/487 (16%), Positives = 169/487 (34%), Gaps = 20/487 (4%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVT 51
            L    N  +     + +Q      NI N + K Y ++    +             + V 
Sbjct: 3   GLFNALNAGRTSLEVSQKQIEISGNNIANVNTKGYSKQSAKLSPYPAMNFGGFFVGQGVK 62

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           V     ++       L   S   G +    +  A  E + +    N      I    DS 
Sbjct: 63  VTDVDRQHNTFISNQLVNKSVDYGYENSKTASFAEIERIFSVSKDN--LAGDIDHFFDSW 120

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           +  S   ++ +L    +     +   FN SA E+ +++ +   +++  +S +   L +L 
Sbjct: 121 QELSTKPTDVVLRDITLQKGSVLAAKFNNSANELDQVQKNIGAQLKSGVSEVNNKLKQLG 180

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +ND I     +   A+   D R+ LLQ++++ IG  +   ++  + V    G  L    
Sbjct: 181 ELNDRIYQIENNGQTANGARDSRESLLQELAQTIGAQSYELSSGMVNVQLPSGLPLVNGN 240

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                    N  T       + +     +   G+    G+   LL ++D V+P  ++ L+
Sbjct: 241 SASTIETVQNGPT-----VGLKLHTTGATRELGTKSMGGEFAGLLDLQDEVIPALEDNLN 295

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           ++A  LI   +E        +   G    +     ++      +     N Q  +    +
Sbjct: 296 QLAYSLITKVNELHQGGAGLDGSTGHLFFEEPPHTNDVPIDPATGPSKDNWQDAARAMKV 355

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
              G  + +     K   G    +    ++     +   +  +N   +   +       +
Sbjct: 356 SLSG--AAQVAAAQKPTDGTSSKVGDNTNALKIADLSYALV-VNGTDSFNSFYGKITSTI 412

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
               + +      ++     +     +  GV+L+EE+  LI+ + S+  S K +   D++
Sbjct: 413 GIGSNQNKLNLKGAEDALVQVKNLRDSAAGVSLEEEMISLIQFQNSFQSSAKFLSTVDEL 472

Query: 472 LQTLLEG 478
           + TLL  
Sbjct: 473 MDTLLNM 479


>gi|304407695|ref|ZP_07389346.1| flagellar hook-associated protein FlgK [Paenibacillus
           curdlanolyticus YK9]
 gi|304343178|gb|EFM09021.1| flagellar hook-associated protein FlgK [Paenibacillus
           curdlanolyticus YK9]
          Length = 508

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 75/503 (14%), Positives = 165/503 (32%), Gaps = 27/503 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+          ++   NI NA+   + R+      S               
Sbjct: 3   STFHSIETAKRSLFTEQANISTTGHNIANANTPGFSRQRVNLVASRPIEAPGYMRSNIPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +     +   D      + ++G+  +     +  E +  ++  ++     +
Sbjct: 63  QLGTGVEFTSITRVREKFLDDQFRNANRSLGEWSIQSDTLSKLETVF-NEPSDSGIRTVM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                S    SK+       K V +NA  +V  FN +++ +  + AD    I  +   + 
Sbjct: 122 DNFWKSWTDLSKDPESITGRKIVRENALALVDAFNETSKHLTDLDADLTTNIATKTEQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDM----VVY 220
                ++ +N  IK   A   + +D +D+RD L+ ++S++I +S +   +        + 
Sbjct: 182 SIAKSVSDLNLEIKRLEAYGDNPNDLMDERDYLVDQLSKMINVSVVNTADGYDVSVGNIM 241

Query: 221 TSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV----VVSSNQGSAVPKGKIKALL 276
             DG     T  + +  +  +   V  E   + +          S   +         + 
Sbjct: 242 LVDGLNAPGTTVQALETQFNSGGVVGGEIQGLLVSRDQILKDYESQLDAMADTLVNGEIT 301

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE 336
               +      +QL       +   +    +     N P       +           + 
Sbjct: 302 ITIPAGSTYNGSQLAADLTTTVRGINGLHNLGYLFTNPPTQADDIFVTSDGTPTITAANI 361

Query: 337 TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
            +  +              +V+      VK      +L+    D+  +        GI T
Sbjct: 362 RLSQDIIDDPMNIATSLRTAVTNGVNETVKGNNVLANLMAGLKDTKFQFSPVASQNGI-T 420

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
           N T+ E+  + IG L     +++      Q +   +     +  GV+L EE+S LIK + 
Sbjct: 421 NGTIDEFYASMIGQLGLQSQEANRQATNQQDIVTQVDSRRQSVSGVSLDEEMSELIKYQH 480

Query: 457 SYNISNKLIMFTDKMLQTLLEGV 479
           +Y+ + + +   D+ L  ++ G+
Sbjct: 481 AYSAAARFMTTIDETLDKVINGM 503


>gi|15616183|ref|NP_244488.1| flagellar hook-associated protein FlgK [Bacillus halodurans C-125]
 gi|10176245|dbj|BAB07340.1| flagellar hook-associated protein 1 (HAP1) [Bacillus halodurans
           C-125]
          Length = 556

 Score =  220 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 87/549 (15%), Positives = 171/549 (31%), Gaps = 72/549 (13%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+           ++  NI NA+   Y R+                      
Sbjct: 4   STFHGLETARRGMMTQQAALRTVGHNIANANTPGYTRQRVNFVQTQAYPGVGRNAPSIPG 63

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +       D     H++  G            E +  +D  +N   + I
Sbjct: 64  QVGTGVMAGSIQRIRDAFLDLQYRQHNTQNGYWDARADALIRMEEIL-NDLDSNGLANQI 122

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++    L+  S +  +  +   + + A  +  +FN     ++++R D   EI +   +L 
Sbjct: 123 NQFWSKLQDLSGDPEDTAVRYVLREQAVSLADSFNEQYMLLEQVRDDYGNEIGVVTDHLN 182

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS+L  +N  I+    S +  +D  D++D LL +IS II I      +       ++G
Sbjct: 183 SLLSQLNEINAQIRKVEPSGYVTNDLYDEQDRLLDQISAIIPIEVQRVKSGGNPNPVAEG 242

Query: 225 TTLFETVPRDIN---------------FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK 269
                     I                 +  NS      S     +G    +     +P+
Sbjct: 243 AVTVTLKGTGITLVNGADKYALQQFEVTKTENSLGDEYVSGISISNGTDTVNLNVQELPQ 302

Query: 270 GKIKALLQIR--------------DSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSE--- 312
           G +K L++                + + P    +L+ M R  + + +    I    E   
Sbjct: 303 GGLKGLIEAFGYYQDPTDIDNSEVNGIYPKMLAELNVMVRTFVEALNSAHRIGYTLEDPL 362

Query: 313 ------NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVK 366
                         +       K+   I          R N   L D      + L   K
Sbjct: 363 TGEVSLGGDFFVFDENKPAGTLKVSDDILNNANNIAAARVNLDGLTDDARQQYQTLLAAK 422

Query: 367 NLAGYPDLINHYC----------------DSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           + A    L+                               +    T  T   Y R  +G 
Sbjct: 423 DFAAIRTLLEDDSSFKPGAKRAFAGDGQNALLLSEIKDIRLNFNGTASTFSNYYRGVMGR 482

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
                S++       +V+ +++    ++   V+L EE++ +I+ + +YN + + I   D+
Sbjct: 483 AAVETSEAVSKRDSYEVLRDNVQFERNSVSQVSLDEEMTLMIQFQHAYNAAARNITQIDE 542

Query: 471 MLQTLLEGV 479
           ML  ++ G+
Sbjct: 543 MLDRIINGM 551


>gi|229541552|ref|ZP_04430612.1| flagellar hook-associated protein FlgK [Bacillus coagulans 36D1]
 gi|229325972|gb|EEN91647.1| flagellar hook-associated protein FlgK [Bacillus coagulans 36D1]
          Length = 538

 Score =  219 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 76/534 (14%), Positives = 169/534 (31%), Gaps = 56/534 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS       A+           ++ +N+ NA+   Y R+      +              
Sbjct: 1   MSTFFGLETAKRALTAQQNALYTVGQNVANANTDGYTRQRVNLQATDPYPAASMNRPAIA 60

Query: 47  ---PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                 V     +       D     ++SA G         +  E +  +   ++S  + 
Sbjct: 61  GQLGTGVEAGEVQRIRDKYLDVQYRENNSAAGYWSAKSDALSKMEAVMDETSTDSSLANT 120

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +    +SL+  S N  +      V++  + +   F+     + + + D   EI + ++++
Sbjct: 121 MEAFWESLQDLSTNPEDVSARSVVLERGQTLTDTFHYLNSTLSQYKTDVGSEISVSVNDI 180

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              L +++ +N  I     + +  +D  D+RD L+ K+S  + ++  V+ +       +D
Sbjct: 181 NSTLKQISDLNQQIAVLEPNGYLPNDLYDKRDSLVDKLSNYLNVTVEVQKSGGNAKANAD 240

Query: 224 GTTLFETVPRDINFE-----------------------KMNSYTVTSESNPIFIDGVVVS 260
           G    +    D                            ++      E   I I G   +
Sbjct: 241 GIYNIKMAAADGTSVYLVQGSNYNAVEVQGGTDSNSDGILDGPPANGEMTGITIGGKNFA 300

Query: 261 SNQGS---AVPKGKIKALLQIRD------------SVVPIFQNQLDEMARVLIGSFSEKD 305
               +     P+GK+  L+                   P   + LD++A       +   
Sbjct: 301 VADTTGKVTFPQGKLLGLIDSYGYQYAGANGTVEAGAYPSLLDSLDKLAYTFGNVLNAVH 360

Query: 306 PIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNV 365
               + +   G          D K   G           +   S   D G          
Sbjct: 361 EKGTDLKGNAGTAFFTFGTLTDYKGAAGQIAVNSSLTYDKIAASSNGDSGDGLNAINLAN 420

Query: 366 KNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKS 425
                         +  +       +     + T+       IG L  +   + ++   +
Sbjct: 421 VVTFDLSSQSVQL-EGISGRLNIAALGLPLASGTITSNYEGLIGKLGVDAEQAGNMQTNT 479

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             + + +  +  +   V++ EEL+ +IK +Q+YN + ++I  TD+ML  ++ G+
Sbjct: 480 ASLLDSVDMNRKSVSSVSVDEELTNMIKYQQAYNAAARMITMTDEMLDKIINGM 533


>gi|222147590|ref|YP_002548547.1| flagellar hook-associated protein FlgK [Agrobacterium vitis S4]
 gi|221734578|gb|ACM35541.1| flagellar-associated protein [Agrobacterium vitis S4]
          Length = 484

 Score =  219 bits (556), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 164/483 (33%), Positives = 256/483 (53%), Gaps = 5/483 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N A     N+S Q   + +NI N+  + YV+RD  T  +      V       
Sbjct: 1   MSLSSTMNTATTSLGNSSTQSQVLSKNIANSQTEGYVKRDAATISTSTGGAQVVTTRSED 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
            +  K + +  S    Q  L +     + +   + Y +SP+ YI+KLRD+++SY+   SE
Sbjct: 61  AVLQKQMLSGQSQAEGQDTLNTGLDQLKALLGGNDYESSPSTYINKLRDAMQSYAAQPSE 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +T +  A++V  + N +A  +  +RA AD  I+ ++S L   LS+   VN ++   
Sbjct: 121 LSLAETAVSAAQDVATSINNTAEGISNVRAQADDAIKDDVSKLNDLLSQFETVNQSVVKA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+ +D +D LDQRD L+  IS+I+G+S++ R+NNDM +YT+DGT LF+  PR + F+  
Sbjct: 181 TATGNDPNDALDQRDKLVSDISKIVGVSSVKRDNNDMALYTNDGTVLFDKQPRTVTFDST 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +Y  ++E N ++IDGV V +   G+   +G I A LQIRDS+ P  Q QLDE +R LI 
Sbjct: 241 GAYGASTEGNSVYIDGVPVKAGTGGNTTAEGSIAANLQIRDSIAPQMQQQLDETSRSLIK 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNK----LCQGISETICVNPQYRSNPSFLRDGG 355
            FSE +P   +++        +G    D      + +              +P+ LRDGG
Sbjct: 301 MFSETEPSTKDNDMPGLFTWEEGTTPEDGTLVSGISESFKVNSAYVTAEDGDPTLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + WN      Y +L++ +   F     FD  AG+     +L+YA NS+GWLE  R
Sbjct: 361 ANGSNYTWNTTEGVSYSELLDDFVTGFEDKMDFDSSAGLGDTSNVLDYASNSVGWLESYR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
           S +   +     +    +E+Y N  GVNL EELS ++ +EQSY  S KL+   D+ML++L
Sbjct: 421 STADSANETKSALSQRATEAYQNKTGVNLDEELSKMLDIEQSYKASTKLMNAVDEMLKSL 480

Query: 476 LEG 478
           LE 
Sbjct: 481 LEI 483


>gi|320354350|ref|YP_004195689.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
 gi|320122852|gb|ADW18398.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
          Length = 465

 Score =  219 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 83/488 (17%), Positives = 165/488 (33%), Gaps = 36/488 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVT 51
           SLL   N  +       +    +  NI N + + Y R+                  + VT
Sbjct: 3   SLLNALNAGKTSLLTNQKSIEIVGNNIANVNTEGYSRQRAELMQIPAVNFGDFFVGQGVT 62

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           V     +     ++ L   S   G++       A  E +      N      I+   D+ 
Sbjct: 63  VSNVSRDYSVFINRQLQEKSIEYGEETGKSDSLAELERIFNVTEDN--LASDINDFFDAW 120

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           +  + N S  +    VI     + + F +   E+  +  + +  I  E+  L   ++E+ 
Sbjct: 121 QELTANPSGQVERDVVIQRGNLLGEAFRSITDELDTVEQNMNTAIIAEVEYLNEKIAEIA 180

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +ND I     S   A+   DQRD++++ +S+ +GI T   N   + V    G  L +  
Sbjct: 181 KLNDRINLVEISGQTANAARDQRDLIIKDLSQTLGIQTYTDNRGMLCVQLPGGMPLVQGT 240

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                        V      + ++ V V+ + G     GK K + ++RD  +   ++ L+
Sbjct: 241 MASTVKTVTVGTDVN-----LQLETVGVTLDIGLNNLGGKFKGMFEMRDVFIDNLRSDLN 295

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
            +A  L  + + +      S  + G    + I  L                +  S    +
Sbjct: 296 TLAIDLTSAVNAEHVTGYGSNGLSGYLFFNDISALPPG-------------EIASRNVLV 342

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
               +       N     G  +       +     +        TN T   +    +  +
Sbjct: 343 AITDTTQVAAAGNPSAAPGDNE------TALRIAQLEVTHKVGTTNDTFDNFFSQMVATV 396

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
               + +      +Q     +        GV+L+EE+  LI+ ++ +  S K +   D+M
Sbjct: 397 GIEAARNDLALQGAQDAAVQLQNLRDGYSGVSLEEEMIDLIQYQRGFESSAKFLATVDEM 456

Query: 472 LQTLLEGV 479
           +  LL+  
Sbjct: 457 MNALLQLK 464


>gi|205375049|ref|ZP_03227840.1| flagellar hook-associated protein FlgK [Bacillus coahuilensis m4-4]
          Length = 511

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 72/507 (14%), Positives = 164/507 (32%), Gaps = 29/507 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS  A    A+   N +     +   NI NA+   Y R+    + +              
Sbjct: 1   MSTFAGLETAKRAMNTSQSALYTTSHNIANANTPGYSRQQVSMSTTTPFPTAGFNAPQIP 60

Query: 47  ---PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                 V          +  D       + +G  +   +     E +  ++  ++     
Sbjct: 61  GQIGTGVEANAIIRIRDSFLDDQYRGEHNKLGYYQSQATALEKMEEIM-NEPSDSGLAAT 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +     SL+  + + + D     V      V + FN  +  ++ ++ D   EI +    +
Sbjct: 120 MDMFWKSLQDLAADPTNDGAKSVVRQRGIAVAETFNYLSTSIKNVQKDLQNEISVTEKQV 179

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              L+++  +N  I       +  +D  D+RD LL ++S ++ IS   + N      ++ 
Sbjct: 180 NSLLNQINNLNQQISDVEPHGYVPNDLYDRRDNLLDELSGLVDISVSYQQNGGQPHPSAV 239

Query: 224 GTTLFETVPRDINFEKMNSYTVTSES-------NPIFIDGVVVSSNQGSAVPKGKIKALL 276
           GT +      + +          + +           +  V V +   S      +  L 
Sbjct: 240 GTAVVYLSNGENSTRSAMLVGKNTVNEIKVNYNTDDLVSSVTVGAQTVSMEDFESVGKLR 299

Query: 277 QIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE 336
            + +S      +         +    +       +E             ++         
Sbjct: 300 GLVESYGYETSSNPVNGTYANMLEELDYMAFTFANEFNAVHSSGATAAMINGAPGPAPDF 359

Query: 337 TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD----PVA 392
                    +          +S     N+ N+A          ++ N   + +      A
Sbjct: 360 FAGEYGAAIATQKDFASKIGISNDIYQNLDNMATASTADLSMGNAENVTKLANVITTAPA 419

Query: 393 GINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
               N T   Y  + IG +     +++ L   S  +   +     +T  V+L EE++ ++
Sbjct: 420 FGAYNTTFKNYYESIIGDMAVQAQEANRLTTNSDTLRGAVENRRMSTSQVSLDEEMTNMV 479

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGV 479
           + + +YN + ++I  TD++L T++ G+
Sbjct: 480 QYQHAYNAAARMISLTDELLDTIINGM 506


>gi|258592553|emb|CBE68862.1| putative Flagellar hook-associated protein 1 (HAP1) [NC10 bacterium
           'Dutch sediment']
          Length = 466

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 78/490 (15%), Positives = 170/490 (34%), Gaps = 44/490 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------ISPENV 50
           SL A    A+           +   NI NA+   + R+    T                V
Sbjct: 3   SLQASLTMARKALQAQQVAIQTTGHNIANANTPGFTRQRVDLTPAVPFSLGSVGSLGTGV 62

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            +         + D        A+ +Q   ++  +  E++   +   N  ++ +S L  S
Sbjct: 63  DIKDITRIRDLLLDSQFRDAHQALSRQEAEEATLSQIELIVG-EPTENGLSNSMSALFAS 121

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  +   ++  +   V D A  +   F+      ++++ D   EI++ +  +     ++
Sbjct: 122 FQDLANYPTDLAVRSVVRDKAMALADQFHRLDDGFERLKIDLHNEIQVVVKQVNGLAQQI 181

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N  I         A+D  DQRD  L ++S+++G S +      + V    G TL + 
Sbjct: 182 ADLNRQIAMSEGGAGSANDLRDQRDQALDELSKLVGGSLVEDIGGQVRVTVGGGLTLVDG 241

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIR---DSVVPIFQ 287
               +    +   T       + + G +++         G++  LL  R   D  V  FQ
Sbjct: 242 ----LTSVPITVDTTDPAYVRLSLGGNLLTPG------GGRLAGLLNSRNASDGFVKGFQ 291

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
           +QLD +A+ ++   +         +   G  +   +    N      +  I V+P   ++
Sbjct: 292 SQLDALAKAIVDKVNVVHMAGFGLDGSTGNNLFTPLVATVNA-----ARLIVVDPVIDAD 346

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
            + +    +       N                +     + D       +VT   Y    
Sbjct: 347 VAKIAAASTAVGVPGDN--------------SQALALADLQDNSIVALGSVTFGSYLSGL 392

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           +  L +  + +         + + ++       GV+L EE++ LI+ +++Y  +      
Sbjct: 393 VSDLAEQEAGAKRSVNLHTTMADFLTSRRDQASGVSLDEEMTDLIRFQKAYEAAAHFANV 452

Query: 468 TDKMLQTLLE 477
            + +L TL+ 
Sbjct: 453 VNDLLGTLMS 462


>gi|310659650|ref|YP_003937371.1| flagellar hook-associated protein 1 [Clostridium sticklandii DSM
           519]
 gi|308826428|emb|CBH22466.1| flagellar hook-associated protein 1 [Clostridium sticklandii]
          Length = 518

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 75/515 (14%), Positives = 163/515 (31%), Gaps = 41/515 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI------------SPEN 49
           S  A  + A +    A +       NI N + + Y R+    +                 
Sbjct: 3   STFAGLSIASSGLFAAQRALDITGHNISNTNTRGYTRQRLNQSAQDPMNIQGGQGQLGLG 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V +         M D       + +G+     +     E +  ++         +    +
Sbjct: 63  VKMQFISQVRDEMLDIKYRQEVNTLGEWEEKYNSLTQVESIF-NEPSETGIRKVVDGFFE 121

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
            + S +K+ S        +  A  + QNFN      +K+  D+++E+E  +  +    ++
Sbjct: 122 GINSLTKDPSNPTNRSVFLQKAIGLAQNFNDMYSRFEKMVVDSNEEVEASVRAINSMATQ 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGIST----IVRNNNDMVVYTSDGT 225
           +  +N  I         A+D  D R++L+  +S+++ +      I    +  +     GT
Sbjct: 182 IAKLNRQILESELDGSRANDLRDARNLLVDDLSKLVDLEVKNVPINNGKSSTLTILIQGT 241

Query: 226 TLFETVPRDINFEKMNSYTV---------------TSESNPIFIDGVVVSSNQGSAVPKG 270
            L   V  ++   +                       E+  +        S        G
Sbjct: 242 PLVNHVDTNVLELETGMDHPMFTDGQDIQPVSSRKDLENIKVSNIKWASGSTLVQEKLGG 301

Query: 271 KIKALLQIRDS------VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK 324
            I   LQ RD         P +   L E A     + ++      +        +     
Sbjct: 302 AIGGQLQQRDGYKDETKGAPYYVRFLSEFANTFAQALNDIHDDGYSLNGAAASGLPLFT- 360

Query: 325 DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNK 384
             +       +  + VN     +P+ L     +      N KN     +L +        
Sbjct: 361 TKNGSTNFISASELKVNQALLDDPTKLSL--GLGDGAPDNNKNAIAMLNLRSKKDFEIRL 418

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
            +       +    T  +  +  I  L  +  ++  +    Q +   +     +  GV+ 
Sbjct: 419 TYDTSGAQIVLGEGTPEDVLKTMIASLGVDAQEAKRMFNNQQYLTEEVDSFRLSVSGVSQ 478

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            EE+S +IK + +YN + ++I   D+M+  ++  +
Sbjct: 479 DEEMSNMIKFQHAYNAAARMITTVDEMIDVIINRM 513


>gi|306821564|ref|ZP_07455162.1| flagellar hook-associated protein FlgK [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550309|gb|EFM38302.1| flagellar hook-associated protein FlgK [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 536

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 78/522 (14%), Positives = 176/522 (33%), Gaps = 51/522 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----------PENV 50
           S  +  N A +    A +   +I  NI N +   Y R+    + +              V
Sbjct: 17  STFSGLNAATSGLFAAQRVLDTIGHNIANQNTPGYTRQRANQSAASATSIENGNYLGMGV 76

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            + +       + D      ++  G         A  E +   +   N  T  +++   S
Sbjct: 77  KMSSISQIRDELLDIKYRNENTKKGYWSQSNVSFAQIENIFG-EPKGNGITKALNEFFTS 135

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           ++S  KN  +    +T I+      +  N    + + + +DAD ++   ++++     ++
Sbjct: 136 IDSVLKNPDDPTAKQTFIETGLTFTRFVNNVIGKFETLISDADHDVNSLVTDINSKTKQI 195

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGI------STIVRNNNDMVVYTSDG 224
             +N +I         A+D  D+R++L+ ++SE+  I      +T              G
Sbjct: 196 AELNKSILEAETQGGSANDLRDKRNMLIDELSEMADIRVNKSITTNNSGQKIEKYQIEIG 255

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSS---------------NQGSAVPK 269
             +     + +  +++        +     +                             
Sbjct: 256 DHVVVDHDKSVEIKRVERQDHPLYAASQKYNNPASDDLKNVKVTNLYFADGQQLNMNKIG 315

Query: 270 GKIKALLQIRDS-----------VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLF 318
           GK+ A LQ RDS            +P +   ++E  +      ++      +     GL 
Sbjct: 316 GKLGATLQQRDSYGDPAMGNDVRGIPYYVRAVNEFVKSFAAKANDIHQKGTDKNGDKGLP 375

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHY 378
           +      +     Q  +  + +NP   ++ S L  G S ++    N + L    +     
Sbjct: 376 LF----TISGNSRQIDARNVTINPDIVNSVSKLAIGISGNQSDNKNFQELYSMRNKELRL 431

Query: 379 CDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL-EKNRSDSHDLHMKSQVVFNHISESYS 437
             + N    F  +     N    +  ++ I  +   +  ++ D +     +      S  
Sbjct: 432 EINQNVQGQFKTLDLGKGN--PEDVIKSLITSVLGVDAKEAKDNYKNQVTLSLEADMSRM 489

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               V+  EEL+ ++K + +YN S ++I   D+M+  L+  +
Sbjct: 490 EVSSVSENEELTNMVKFQHAYNASARMITTVDEMIDVLINRM 531


>gi|54307275|ref|YP_128295.1| flagellar hook-associated protein [Photobacterium profundum SS9]
 gi|46911695|emb|CAG18493.1| Hypothetical flagellar hook-associated protein [Photobacterium
           profundum SS9]
          Length = 468

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 69/482 (14%), Positives = 157/482 (32%), Gaps = 21/482 (4%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT------ISPENVTVVTQRSE 58
           ++ N   +  N A+   +    NI NA    + R+                V V +    
Sbjct: 2   SLINIGLSGLNAANAGLSVTSHNIANAMTPGFSRQRVGFGAQVSAGSQGAGVGVSSVERM 61

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
             N  ++ ++  + + G  ++   +    E +  +   + +    + +   +L   S   
Sbjct: 62  ADNYLNQQIYKQNGSWGFNKISSQYMQKTESLLNN--ASTNLNTGLDRFYAALSEASAAP 119

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
            +    +T++  +E +VQ FN  + ++         +++  +S     ++ +  +N++I+
Sbjct: 120 QDIAFRQTIVSQSESMVQRFNNLSSQLDGQTKQVSGQLDATVSEANTLMAGIASMNESIR 179

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
              AS     D LD RD  ++++S ++ ++T   ++  + +    G  L       +  +
Sbjct: 180 DAGASGKSMTDLLDARDESVRQLSALVDVNTTYNDDGTISLTLDKGQPLVSGSSASVLKK 239

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +        N        +          G I  L+  RD  +   Q +LD MA    
Sbjct: 240 DNDGLLSLQRGNGTLALDGNI---------GGTIGGLVDYRDGELNELQRELDVMAYSFA 290

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F+E      +    PG  +  G+  +D             N    ++ +         
Sbjct: 291 AQFNEAHQAGFDLNGDPGKALFGGVDSIDGAAKNLTLLVDDPNQLAFASKAGEPGNSENL 350

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
           ++ +                 D+           G     +L        G      +  
Sbjct: 351 QQLIDLKNAPVSIDQTKLSIEDAETYQVAIAKFEGK----SLNNGYTGLTGDWAIKTAQI 406

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                 S+ +         +  GVNL EE + ++   Q Y  + K+I    ++    L  
Sbjct: 407 EADTEASKALVGQAQGERDSISGVNLDEEAASIMTYTQMYQANAKVISTAQQLFDVTLAM 466

Query: 479 VK 480
            +
Sbjct: 467 FR 468


>gi|323703356|ref|ZP_08115006.1| flagellar hook-associated protein FlgK [Desulfotomaculum
           nigrificans DSM 574]
 gi|323531719|gb|EGB21608.1| flagellar hook-associated protein FlgK [Desulfotomaculum
           nigrificans DSM 574]
          Length = 496

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 67/508 (13%), Positives = 151/508 (29%), Gaps = 51/508 (10%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------TISPE 48
               A+       +       NI NA    Y R++ +                       
Sbjct: 7   GLEIAKRGTMAHRKAMDVTGHNIANASTPGYSRQEAVIKPTDPWTLPGLETRMLPGQLGT 66

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
              V   R       D       S  G            E +   +         +    
Sbjct: 67  GSQVTEVRRIRDYYLDVQYRQSGSYEGYWEKKLDMAKRLETVF-PEPEGRGIQDVMLNFF 125

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADA---------------D 153
           +  +  + N  ++ + K V+++ +E+   F     ++  IR                   
Sbjct: 126 NDWQDLNNNPRDEGVVKAVMESGDELSAIFRQMHDQLTAIRDGIYVEGSQVIPGYTEVIS 185

Query: 154 KEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRN 213
             I+ E+  +   L ++  +++ I   T +    +D LD+RD  L ++S++  I   + +
Sbjct: 186 GSIDYEVDKVNLLLKKIADISNTIVRVTQNDATPNDLLDERDNYLDELSKMGHIKVEIND 245

Query: 214 NNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIK 273
           +  + VY  D T   E +       K+    + +    +  +                  
Sbjct: 246 DQTLKVYFIDETPGKEVI-------KIVGGQIVAAQVSVHRNNTDNKYYMFIDDDGNLQG 298

Query: 274 ALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG 333
               I  + +  +        +  +        +   S  +    I D + +L       
Sbjct: 299 TEPSINLTDMAEYNPAYPGSGQGSV--------LGLESARIENKEILDRLNNLAAAFITE 350

Query: 334 ISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
           ++  +        NP+ +          +           L+     + +   +      
Sbjct: 351 VNNILAGITDDNGNPAPVTFFEGTDASDIRLATIDTTQEKLLGQ--KAIDVARLRSTTVN 408

Query: 394 INTNVTL-LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
           I    TL   Y +  +  +  N     ++    Q +   I     +  GV++ EEL+ +I
Sbjct: 409 IGGQSTLFESYYQGIVAQVGANVDHHSNMLENQQAIGQQIDALRQSVSGVSVDEELTRVI 468

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLEGVK 480
           + +  Y  S ++I   D+ML  L+  ++
Sbjct: 469 QFQYGYQASARMIAIQDEMLDYLINRIR 496


>gi|308050018|ref|YP_003913584.1| flagellar hook-associated protein FlgK [Ferrimonas balearica DSM
           9799]
 gi|307632208|gb|ADN76510.1| flagellar hook-associated protein FlgK [Ferrimonas balearica DSM
           9799]
          Length = 457

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 75/481 (15%), Positives = 158/481 (32%), Gaps = 33/481 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-------SPENVTVVTQRS 57
            +     +  + A    A+   NI NA    Y R+  + +        +   V V   R 
Sbjct: 2   NMLGNGLSGLHAAQMHLATTSNNIANATTPGYSRQQLLVSARPGGFMGAGSGVQVDGVRR 61

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                    +   S+  G      S+    E +        S +  +  L  +L S  ++
Sbjct: 62  VADEYLTAQIWRASTQAGFSTTKASYLGKTEEVFG--SKGASISMGLDSLFAALNSSVES 119

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            ++    ++V++ A+ +   F+T  + ++      +++I+  ++ +   L  +  +N  I
Sbjct: 120 PNDIATRQSVMNEAKSLASRFSTINQSLESQLKQVEEQIKGSVTEVNTRLENIARINKEI 179

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
           +   ++       LD RD  + ++SE++ I T    +  + +    G  L          
Sbjct: 180 QRNMSNGDVPPQLLDARDQAVAELSEMVDIRTTENADGTINITLPKGQPLVLGTSAASFE 239

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +       S  + I        +      GK+ AL   RD      ++ +DE+A  L
Sbjct: 240 TFPDPANPQMSSLSLTIGNTTYEIQEN---VGGKMGALFDYRDGSWQQSRDFIDELAMQL 296

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+       +    P           +      +++              L  G   
Sbjct: 297 ADGFNSILANGTDLNGNPPALDLFTYDPDNPAGTLKVTDGFTAE--------MLAFGQDG 348

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +     N+K+L  + D    +               + ++ TL E     +G L      
Sbjct: 349 TPGDNSNLKDLLAFADTKLTF-------------TSLGSDATLNEAYAMYLGELGIQSRQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +      +                VNL EE   +I  +Q+Y  + K+I   D++ QT++ 
Sbjct: 396 AQLESDSADGELLRALNERDGVSAVNLDEEGINIIVYQQAYQANAKVISTADQLFQTMMT 455

Query: 478 G 478
            
Sbjct: 456 M 456


>gi|222053739|ref|YP_002536101.1| flagellar hook-associated protein FlgK [Geobacter sp. FRC-32]
 gi|221563028|gb|ACM19000.1| flagellar hook-associated protein FlgK [Geobacter sp. FRC-32]
          Length = 479

 Score =  216 bits (550), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 85/503 (16%), Positives = 181/503 (35%), Gaps = 47/503 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           M +  +F+ A        Q       NI N +   Y R+  +                 V
Sbjct: 1   MGINDIFSIATRGIAAQRQAIEVTSENIANVNTPGYSRQRVIMESGPANIASGFPIGGGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            VV  +    N+    L   +S   Q    Q+     E +  ++   +     +     S
Sbjct: 61  EVVAVQRSYDNLLQTQLVNGNSTYQQNLAKQTALQQVEPLF-NEVSTDGLGKAMESFFGS 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  S N       + +I  ++ +V  F+     +  +   AD+++    +++   L  +
Sbjct: 120 WQDLSLNPQGAPERQALIARSQILVDTFHQMNTNLNAVITSADQDLVSITADVSDKLGNI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY-TSDGTTLFE 229
            ++N  I        + ++  DQRD+L+Q+++  +GI+T  ++N  + V  T  G TL  
Sbjct: 180 ALLNQQIMTTQGMGGNVNEMKDQRDLLVQELAGKVGITTSEQSNGTLTVSLTLGGQTLVS 239

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK------------GKIKALLQ 277
                  +   +  T       +   G    +N  +                G+I   LQ
Sbjct: 240 GNQYSTVYTSPDGGTPQRNDIYVTPLGNPPPANTPATDTDVTATIGGLNNGYGEIGGTLQ 299

Query: 278 IRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISET 337
           +RD +VP +  +LDE+A  +I S + +     +     G+    G    D          
Sbjct: 300 VRDQIVPGYLAKLDELASKIITSVNTQHTAGADLAGGAGVAFFTGTSSAD---------- 349

Query: 338 ICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
           I V+    S+P+ +    +       N                    +     +A    N
Sbjct: 350 IAVSGTITSDPTRIAAAANPFVGPGDNRN-------------ALLIADIKNSSLAFSTGN 396

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            T+ ++    +  +  +   + +   + +     ++    +  GV+L EEL+ L+K +++
Sbjct: 397 STVADFFNAFVSNVGIDVQKAKNTAAQGEAFLKQLNTLRESNAGVSLDEELTNLLKYQRA 456

Query: 458 YNISNKLIMFTDKMLQTLLEGVK 480
           +  + +L+    +M+ T+L  V+
Sbjct: 457 FEGAARLVTTGSEMMDTILAMVR 479


>gi|154687656|ref|YP_001422817.1| flagellar hook-associated protein FlgK [Bacillus amyloliquefaciens
           FZB42]
 gi|154353507|gb|ABS75586.1| FlgK [Bacillus amyloliquefaciens FZB42]
          Length = 505

 Score =  216 bits (550), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 76/515 (14%), Positives = 172/515 (33%), Gaps = 54/515 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+   +      +++  N+ NA+ + Y R+      +               
Sbjct: 3   STFMGLETARRALSAQQTALSTVSNNVANANTEGYTRQRVTLQSTSPYPAVSKNSDLTAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +      +  D      ++ +G      +  +  E +   +  +N     +
Sbjct: 63  QIGTGVKAGSVERVRDSFLDYQYRTENTKLGYYTARSNSLSQMEGVM-KELDDNGLNGSL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           S   ++L+  + N         + +  + + ++FN  +  +  I+ D  K ++     + 
Sbjct: 122 SSFWNALQDLATNPENTGARSVLQEQGKSLAESFNYISTSLTNIQGDIKKNLDNTADQVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L++L  +N+ I     S    +D  DQRD L+ ++S +  I      +    + T++G
Sbjct: 182 SILNQLNDLNNQIAAVEPSGMLPNDLYDQRDRLIDQLSSMANIKVSYNKSGGHALATAEG 241

Query: 225 TTLFETVP------------RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E +                   +M             +     + N  +   KG +
Sbjct: 242 TVNVELLNGNNNSLGTLLDGNTKTVSEMKINYDKDSGLVSSVSVGSSTVNADAFTGKGSL 301

Query: 273 KALLQIRD--------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK 324
             L++            + P     LD MA     +F+             G    D   
Sbjct: 302 LGLIESYGYMSNGEEKGLYPEMLTALDNMALSFADAFNAVHEKGKTYTGEQGAAFFDFS- 360

Query: 325 DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNK 384
            ++    +G +  I V+ +  ++   +    +  K    N  NLA   +           
Sbjct: 361 GVEAVPAKGAAAKIKVSDKILASTDNIAASLNGEKSDGTNATNLAAVQN----------- 409

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
                 +       T+ ++  + IG L  N   + +L   S+       E   +   V+L
Sbjct: 410 ----SKLTINGETTTINDFYESLIGKLGVNSQKAANLMNNSESNTLSADERRQSVSAVSL 465

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            EE++ +I+ + +YN + ++I   D++   ++ G+
Sbjct: 466 DEEMTNMIQFQHAYNAAARIITMQDEIFDKIINGM 500


>gi|328555246|gb|AEB25738.1| flagellar hook-associated protein FlgK [Bacillus amyloliquefaciens
           TA208]
 gi|328913607|gb|AEB65203.1| flagellar hook-filament junction [Bacillus amyloliquefaciens LL3]
          Length = 505

 Score =  216 bits (548), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 76/515 (14%), Positives = 169/515 (32%), Gaps = 54/515 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+   +      +++  N+ NA+ + Y R+      +               
Sbjct: 3   STFMGLETARRALSAQQTALSTVSNNVANANTEGYTRQRVTLQSTSPYPAVSKNSDLTAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +      +  D      ++ +G      +  +  E +   +  +N     +
Sbjct: 63  QIGTGVKAGSVERVRDSFLDYQYRTENTKLGYYTARSNSLSQMEGVM-KELDDNGLNGSL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           S   ++L+  + N         + +  + + ++FN  +  +  I+ D  K ++     + 
Sbjct: 122 SSFWNALQDLATNPENTGARSVLQEQGKSLAESFNYISTSLTNIQGDIKKNLDNTADQVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L++L  +N  I     S    +D  DQRD L+ ++S +  I      +    + T++G
Sbjct: 182 SILNQLNDLNTQIAAVEPSGMLPNDLYDQRDRLIDQLSSMANIKVSYNKSGGHSLATAEG 241

Query: 225 TTLFETVP------------RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E +                   +M             +       N  +   KG +
Sbjct: 242 TVNVELLNGNNNSLGTLLDGNTKTVSEMKINYDKDSGLVSSVSIGSSEVNADAFTGKGSL 301

Query: 273 KALLQIRD--------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK 324
             L++            + P     LD MA     +F+             G    D   
Sbjct: 302 LGLIESYGYMSNGEEKGLYPEMLTALDNMALSFADAFNAVHEKGKTYTGEQGAAFFDFSG 361

Query: 325 DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNK 384
           D      +G +  I V+ +  ++   +    +  K    N  NLA   +           
Sbjct: 362 DE-AVPAKGAAAKIKVSDKILASTDNIAASLNGEKSDGTNATNLAAVQN----------- 409

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
                 +       T+ ++  + IG L  N   + +L   S+       +   +   V+L
Sbjct: 410 ----SKLTINGETTTINDFYESLIGKLGVNSQKAANLMNNSESNTLSADQRRQSVSAVSL 465

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            EE++ +I+ + +YN + ++I   D++   ++ G+
Sbjct: 466 DEEMTNMIQFQHAYNAAARIITMQDEIFDKIINGM 500


>gi|254511786|ref|ZP_05123853.1| flagellar hook-associated protein FlgK [Rhodobacteraceae bacterium
           KLH11]
 gi|221535497|gb|EEE38485.1| flagellar hook-associated protein FlgK [Rhodobacteraceae bacterium
           KLH11]
          Length = 483

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 93/490 (18%), Positives = 183/490 (37%), Gaps = 19/490 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS---PENVTVVTQRS 57
           M++    N A    N AS+  A +  NI NA    Y RR    T S      V VV    
Sbjct: 1   MNMSTALNNALGGLNAASRGAAVVSGNIANALTPGYARRTLELTTSPISGNGVRVVGITR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
               +      A  + +   + + +F A  E +        S    +++   SL + +  
Sbjct: 61  HQDPVLIANRRATDADLAAAKTVSAFHAGFEQLVGTADDATSIAARLAEFESSLITAASL 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                           +    N ++  ++++R+DAD+ I  +I  L + L ++  +N  I
Sbjct: 121 PDSAQRLDQAARAGAGLSATLNHASEGLRQMRSDADRTIGKQIDTLNQTLKDIEKLNARI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              + S  D    LDQR +L+ +++E++ ++ + R N+ + +Y+  G  L E    + +F
Sbjct: 181 PAVSNSGGDIGALLDQRQILIDQVNELVPVNVVARANDQVSLYSDGGLILLEGPAAEFSF 240

Query: 238 EKMNSYTVTSESNPIFIDGVVVSS------NQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                           + G+ V+          + +  G + +   IRD +    Q  LD
Sbjct: 241 STTGDTMPHMTIGNGLLSGLEVNGQPVRIDGDFAQIRGGALMSQFMIRDELAVEAQADLD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDN---KLCQGISETICVNPQYRSNP 348
            +AR LI  F             PGLF  +G +        L   I+    V+P    + 
Sbjct: 301 AVARDLIERFEAPGLDPTTLATDPGLFTDEGNRFDPALQTGLASRITLNATVDPDTGGDS 360

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             LR            +    G   L++ +  +  +      ++    ++   E +   +
Sbjct: 361 WRLR------AGLGATLPGAPGDASLLHAFGAALTEARPSPGLSFGTGSLRAAEISEALL 414

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
                N   +      +      + +  +   GV+   EL  L+++EQ+Y  + +++   
Sbjct: 415 SRAGANAHSADQRRSFAANAQLEMEKIVAEQ-GVDSDVELQRLMQIEQAYAANARIVAVV 473

Query: 469 DKMLQTLLEG 478
           D+++ TLL  
Sbjct: 474 DELMDTLLRL 483


>gi|118581855|ref|YP_903105.1| flagellar hook-associated protein FlgK [Pelobacter propionicus DSM
           2379]
 gi|118504565|gb|ABL01048.1| flagellar hook-associated protein FlgK [Pelobacter propionicus DSM
           2379]
          Length = 456

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 87/493 (17%), Positives = 173/493 (35%), Gaps = 51/493 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           M L +     +               NI N + + Y R+  +   S             V
Sbjct: 1   MGLSSAMEIGKRGLIIYQVATEVTGENIANVNTEGYSRQRVILETSPPTTHNGFPLGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            + T      ++  + L   +SA G   L        E    ++  N+     I+    +
Sbjct: 61  KISTVERYYDSLLQQQLVTANSASGYDTLCSEVLQQIEPSF-NELTNDGIGSAITNYFQA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            E  S N S     + ++  A+ +V++FN+ +  +       D  +    +++   L+ +
Sbjct: 120 WEDLSTNASGTTERQVLLSQAQVLVESFNSVSTTLTDTIKAQDSSLTALTADINNKLTNI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT---- 226
             +N  IK       +A++  DQRD+L+++++E +GI      +    VY  D T     
Sbjct: 180 ATLNAQIKQTELVSGNANEMRDQRDLLVKQLAEQMGIKYTENADGTTDVYVQDSTPATYY 239

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF 286
           L +            S   T   + +      V S   +A   G + A LQ+RD ++P +
Sbjct: 240 LVQGNQAGSLTVGGTSPARTVTIDSVSGATKTVDSTLYTAQDGGTLWATLQLRDVIIPDY 299

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
            +QLD++A  +I   + +     +    PG     G       +               +
Sbjct: 300 IDQLDDLASTIITDVNTQHQAGFDINGDPGADFFSGTSAATFSVSI-------------T 346

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           +P+ +   GS +     N                        + +   +           
Sbjct: 347 DPNNIAAAGSSAAAPGGNG-----------------------NALLIADLQSGFSISYNT 383

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
            +  +  +   +  +  + +     ++    +  GV+L EEL+ L+  ++SY  S KLI 
Sbjct: 384 LVSQIGLDVDQAETVVEQDEAYLKQLNTLRDSKSGVSLDEELTNLVMYQRSYQASAKLIT 443

Query: 467 FTDKMLQTLLEGV 479
              +M+ TLL  V
Sbjct: 444 TVTEMMDTLLAMV 456


>gi|321313088|ref|YP_004205375.1| flagellar hook-associated protein FlgK [Bacillus subtilis BSn5]
 gi|320019362|gb|ADV94348.1| flagellar hook-associated protein FlgK [Bacillus subtilis BSn5]
          Length = 507

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 73/516 (14%), Positives = 167/516 (32%), Gaps = 54/516 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +      ++   N+ NA+   Y R+                      
Sbjct: 3   STFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATDYFPAVSKNAEKTAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +         D      +++ G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVQGKSVERIRDIFLDYQYRLQNNSAGYYDTKAKALSQMEGVL-NETDDSGLNSVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  S N +E+     V    + V + FN  +  +  ++++   E+   + ++ 
Sbjct: 122 NSFWNSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS+L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++G
Sbjct: 182 SLLSQLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAEG 241

Query: 225 TTLFETVPRDI------------NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E + ++                ++ +           I     +    S   KG +
Sbjct: 242 TVSIEILDKNKQSLGTVLDGKNYEVSELAANYDNETGLVSSISIGDTAVQVESFSSKGSL 301

Query: 273 KALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI 323
              ++             V P   + LD MA     +F+E            G    D  
Sbjct: 302 LGFIESYGYITADGQEKGVYPEMLSDLDNMALEFAKAFNEVHRNGVTKSGEQGGDFFDFT 361

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
                       +    +    S  + +    + +     N   LA              
Sbjct: 362 GGETEPAKGAAGKIKVADSIIDSKGANIAFSLTGAANDNANATKLA-------------- 407

Query: 384 KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
            N +   +       ++L+Y    IG L     +++ L   ++   N    +      V+
Sbjct: 408 -NVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADINRQQMSAVS 466

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 467 LDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGM 502


>gi|254473300|ref|ZP_05086697.1| flagellar hook-associated protein FlgK [Pseudovibrio sp. JE062]
 gi|211957416|gb|EEA92619.1| flagellar hook-associated protein FlgK [Pseudovibrio sp. JE062]
          Length = 479

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 132/485 (27%), Positives = 212/485 (43%), Gaps = 11/485 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT----TISPENVTVVTQR 56
           MSL +    AQ+     S + A   RN+ N +N  Y R++ +     + +   V V    
Sbjct: 1   MSLTSAMLTAQSSIAARSAEMAIASRNVANVNNPGYSRQEAVVQNIVSDTGSVVYVSHAS 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
                   K      SA        +                S    I  L +++ SY  
Sbjct: 61  RMVNQAAFKATLKTGSAAIASGSYANMLDQLNPSGQVPF-GTSIASGIGTLGEAIVSYGN 119

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           + S  +LG++V+++A  +V +   S+  +++ R +AD  +   + N+   LS+L  VN  
Sbjct: 120 DPSNQVLGQSVVNSATALVDDIKQSSESLKETRLEADAAMGRAVDNINNILSDLEEVNGK 179

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I   + +  D +  +DQRD +L+ +SE IGI+ + + NN + VYT  G TLFE V R+++
Sbjct: 180 IVTGSNAGQDVNSLMDQRDEMLRVLSEEIGITVLDQENNGVAVYTDSGVTLFEKVAREVS 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
           FE   S         I +DG+ V        V  G I    +IRD  +   Q QLDE A 
Sbjct: 240 FETSLSLGSGEVGKNILVDGIAVAGPGATMPVSGGAIAGYAKIRDDTLVTMQTQLDEAAE 299

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG 355
            L+ +F E  P                       L   +     VNP    +   LRDGG
Sbjct: 300 ALVDAFQETQPGGT-----APQDGLFTFAAGTGDLIGRLKVHDAVNPAAGGDVKLLRDGG 354

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
                +  N  + AGY DL+  Y  + N+   FDP +G+N   TL ++A N++ W    R
Sbjct: 355 INGAAYKHNTGDNAGYSDLLKSYEAALNQERTFDPTSGVNPTSTLKDFASNTVSWFSAER 414

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             + +        F+  ++  SN  GVN+  E+  L+ +E +Y+ S +L+   D+M Q L
Sbjct: 415 KIATETSTLDASAFSSNAQMLSNKTGVNIDTEMQRLLTIETAYSASARLMTAVDRMFQEL 474

Query: 476 LEGVK 480
           L  V+
Sbjct: 475 LSAVR 479


>gi|163742564|ref|ZP_02149950.1| flagellar hook-associated protein K [Phaeobacter gallaeciensis
           2.10]
 gi|161384149|gb|EDQ08532.1| flagellar hook-associated protein K [Phaeobacter gallaeciensis
           2.10]
          Length = 472

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 89/477 (18%), Positives = 183/477 (38%), Gaps = 18/477 (3%)

Query: 11  QNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP---ENVTVVTQRSENKNMFDKVL 67
                 A +  + +  N+ N     Y RR    T +      V V   +  N       +
Sbjct: 1   MTGLTAAGRSTSVVSENLSNVLTPGYSRRSLALTSAGDGFSGVKVGHVQRINDPALQSSV 60

Query: 68  HAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTV 127
            + +S +G   +  +F      +        S T  ++     L               +
Sbjct: 61  RSANSEVGVAEVKSAFFGRMTELVGSADDPYSITQRLTDFDSGLIEVISRPDSGPRLNDL 120

Query: 128 IDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA 187
              AEE+V++   +A  ++  R  AD+ I++++  + + L +L  +N  I    ++  D+
Sbjct: 121 AIQAEELVRSIADAAEGLRNQRTAADRAIDVQVDTVNQSLEKLQKLNAKIAISQSTGSDS 180

Query: 188 HDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV-- 245
              LDQRD+L+ ++++II +  + R+   + +++  G  L +    +++F+         
Sbjct: 181 ASLLDQRDLLIDEVNKIIPVKVVNRDRGQVALFSEGGAVLLDGQAAELSFDGKADTLPYM 240

Query: 246 ---TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFS 302
                  + + I+G+ V++  G  V  G + A  ++RD +    Q  LD MA+ LI  F 
Sbjct: 241 TLGNGLLSGLQINGIDVATGPGGPVRGGTLAAQFEVRDVLTVEAQEDLDAMAKDLIERFQ 300

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKL---CQGISETICVNPQYRSNPSFLRDGGSVSK 359
           +       +   PG+F   G              I     +  Q ++    LRD      
Sbjct: 301 DPALDPTLTATDPGIFTDQGAFFDPANTVGIANRIELNDKIAMQGQAETWRLRD------ 354

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                    AG   L+  Y D+ +       V     N+     + N +    ++++ + 
Sbjct: 355 GLNAASPGNAGDATLLRGYADALDAKRTVSSVGLGTANLDASTLSANLLSRFAQSKNSAE 414

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
                +   +  + +      GV+   EL  LI +E+ Y  + ++I   D++++TLL
Sbjct: 415 QNVAFAAATYTEMYQRELAQ-GVDSDAELQNLIVIEKVYQANARMISVVDELMETLL 470


>gi|261409644|ref|YP_003245885.1| flagellar hook-associated protein FlgK [Paenibacillus sp. Y412MC10]
 gi|261286107|gb|ACX68078.1| flagellar hook-associated protein FlgK [Paenibacillus sp. Y412MC10]
          Length = 520

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 71/518 (13%), Positives = 164/518 (31%), Gaps = 45/518 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+           +   NI NA    Y R+                      
Sbjct: 3   STFHGIETAKRSLFAQMAGMNTTGHNIANASTPGYSRQVVGLIASRPLAMPGMYNQISPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   +       D+     + ++G   +     +  E +  ++   +  T  I
Sbjct: 63  QLGTGVEVNYIKRVRDQFLDQQYWNANRSLGDWEVQAGTLSKLETIF-NEPSESGLTTVI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                +   +SK+       K V +NA  + + FN +++++  ++AD  + I +   ++ 
Sbjct: 122 DNFWKAWSEFSKDPENVTSRKIVRENALAMAEAFNETSKKITDMQADLTQGIAVNADHIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVV----- 219
              +++  +N  I      + +A+D  DQRD+++ ++S +  ++ +       V      
Sbjct: 182 TLTTQVAQLNYEINRIEGFRDNANDLRDQRDLIIDELSRMANVTVVEEETGYRVTVGGLE 241

Query: 220 ----------------YTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ 263
                               G TL       I   +        +      + +      
Sbjct: 242 LVAGDAAVPVTPAQLETAYAGNTLNSGELFGIIKSRDGIVKDYLDQLNELANTIANGDVS 301

Query: 264 GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI 323
            +      +     +           L     V +   +    +     +          
Sbjct: 302 ITIPAGSVLPEGTVLNGVTYSGTTRTLTADTTVTVKGLNGLHKLGYLFTSPAQAAGDFFS 361

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
                 +    + +  VN     +P+ +     V      + + + G   L         
Sbjct: 362 SKDGGPIT---AASFSVNNAIVQDPNKIASSLRVVAGTNGD-EVVKGNNTLALLMSQLRE 417

Query: 384 KNFIFDPVAGINT--NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVG 441
           + F F+ +A  N     T+ +Y R  +G L     ++      +Q++ + +     +  G
Sbjct: 418 RPFTFNAIASNNGITTGTVDDYYRAVMGQLGVQSREALRQQDNNQLLVDQVDSRRQSVSG 477

Query: 442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           V+L EE+S LIK++ SY  +++ +   D+ L  ++  +
Sbjct: 478 VSLDEEMSNLIKLQHSYGAASRFMTTVDQNLDKIINSM 515


>gi|296330251|ref|ZP_06872732.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676144|ref|YP_003867816.1| flagellar hook-filament junction [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152519|gb|EFG93387.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414388|gb|ADM39507.1| flagellar hook-filament junction [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 507

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 73/516 (14%), Positives = 167/516 (32%), Gaps = 54/516 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +      ++   N+ NA+   Y R+                      
Sbjct: 3   STFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATDYFPAVSKNAEKTAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +         D      +++ G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVQGKSVERIRDIFLDYQYRLQNNSAGYYDTKAKALSQMEGIL-NETDDSGLNSVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  S N +ED     V    + V + FN  +  +  ++++   E+   + ++ 
Sbjct: 122 NSFWNSLQELSNNTNEDSARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS+L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++G
Sbjct: 182 SLLSQLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALSSAEG 241

Query: 225 TTLFETVPRDIN------------FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E + ++                ++ +           I     +    S   KG +
Sbjct: 242 TVSIEILDKNKQSLGTVLDGKNYAVSELAANYDNETGLVSSISIGDTAVQVESFSSKGSL 301

Query: 273 KALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI 323
              ++             + P   + LD MA     +F+E            G    D  
Sbjct: 302 LGFVESYGYITADGEEKGIYPEMLSDLDNMALEFAKAFNEVHRNGLTKSGDQGGDFFDFT 361

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
                       +    +    S  + +    + +     N   LA              
Sbjct: 362 GGDTEPAKGAAGKIKVADSIIDSKGANIAFSLTGAANDNANATKLA-------------- 407

Query: 384 KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
            N +   +       ++L+Y    IG L     +++ L   ++   N    +      V+
Sbjct: 408 -NVLTGKITINGKETSVLDYYAGLIGELGIKAQEANRLASNTETQLNDADINRQQMSAVS 466

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 467 LDEEMTNMIQFQHAYNAAARMVTLQDEILDKVINGM 502


>gi|114330367|ref|YP_746589.1| flagellar hook-associated protein FlgK [Nitrosomonas eutropha C91]
 gi|114307381|gb|ABI58624.1| flagellar hook-associated protein FlgK [Nitrosomonas eutropha C91]
          Length = 467

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 63/485 (12%), Positives = 164/485 (33%), Gaps = 34/485 (7%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV 53
            ++ N   +    A     +   NI NA    Y R+  + + +             V V 
Sbjct: 3   NSIMNVGVSGLQAAQTALLTTSHNISNATTPGYNRQQAIQSTNTPLPHSNGFIGRGVQVS 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
           T +                   Q     +     + + AD       T  +    ++++ 
Sbjct: 63  TVQRIYNQYLVSQSLQAQGQSSQLDSHYNEIKQIDNLLADTTS--GLTPALHNFFNAVQD 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            + N +     + ++ NAE +V  F +  + + ++R   + +I   ++ +     ++  +
Sbjct: 121 VASNPTSIPSRQAMLSNAEALVSRFQSMDQRLSEMREGVNSQIASSVNEINSLAQQVVRL 180

Query: 174 NDAIKFKT--ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           N  I+     A+   A+D  DQRD L++ +S++  +  + ++N    V+  +G +L    
Sbjct: 181 NTNIQAVEGSANSQPANDLYDQRDALIRDLSKLANVDVVRQSNGHYNVFIGNGQSLVVGT 240

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                    +S         + + G          +  G +  LL  R   +   Q   +
Sbjct: 241 SAMALKAVPSSSDPQRLVVAMDV-GDKEILLPEHQLQGGSLGGLLAFRSETLDAIQTDFN 299

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           ++A+ L  +F+++  +  + +   G    +                             +
Sbjct: 300 QLAKGLADTFNDRHTLGLDLQGTVGKNFFEVTDSNHVARS-------------------I 340

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
               S   +    + +   + D +    ++     +           +      + +  +
Sbjct: 341 EVAISDPAEIAAALNDGGSFDDRVADNRNALQLAKLQTTNTLQGGTASYQSAYASLVSQV 400

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
                +        + +     ++  +  GVNL+EE + L++ ++ +  S+K+I  ++ +
Sbjct: 401 GNKTRELEVTSQAQESLLAQTDQAIQSLSGVNLEEEAANLLRYQRMFQASSKVIEISNSL 460

Query: 472 LQTLL 476
             +LL
Sbjct: 461 FDSLL 465


>gi|16080594|ref|NP_391421.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221311492|ref|ZP_03593339.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315819|ref|ZP_03597624.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320734|ref|ZP_03602028.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325019|ref|ZP_03606313.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|2828498|sp|P39810|FLGK_BACSU RecName: Full=Flagellar hook-associated protein 1; Short=HAP1
 gi|1762338|gb|AAC44946.1| flagellar-hook associated protein 1 (HAP1) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|2636067|emb|CAB15558.1| flagellar hook-filament junction [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 507

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 73/516 (14%), Positives = 167/516 (32%), Gaps = 54/516 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +      ++   N+ NA+   Y R+                      
Sbjct: 3   STFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATDYFPAVSKNAEKTAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +         D      +++ G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVQGKSVERIRDIFLDYQYRLQNNSAGYYDTKAKALSQMEGVL-NETDDSGLNSVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  S N +E+     V    + V + FN  +  +  ++++   E+   + ++ 
Sbjct: 122 NSFWNSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS+L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++G
Sbjct: 182 SLLSQLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAEG 241

Query: 225 TTLFETVPRDI------------NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E + ++                ++ +           I     +    S   KG +
Sbjct: 242 TVSIEILDKNKQSLGTVLDGKNYEVSELAANYDNETGLVSSISIGDTAVQAESFSSKGSL 301

Query: 273 KALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI 323
              ++             V P   + LD MA     +F+E            G    D  
Sbjct: 302 LGFIESYGYITADGQEKGVYPEMLSDLDNMALEFAKAFNEVHRNGVTKSGEQGGDFFDFT 361

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
                       +    +    S  + +    + +     N   LA              
Sbjct: 362 GGETEPAKGAAGKIKVADSIIDSKGANIAFSLTGAANDNANATKLA-------------- 407

Query: 384 KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
            N +   +       ++L+Y    IG L     +++ L   ++   N    +      V+
Sbjct: 408 -NVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADINRQQMSAVS 466

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 467 LDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGM 502


>gi|326202857|ref|ZP_08192724.1| flagellar hook-associated protein FlgK [Clostridium papyrosolvens
           DSM 2782]
 gi|325986934|gb|EGD47763.1| flagellar hook-associated protein FlgK [Clostridium papyrosolvens
           DSM 2782]
          Length = 544

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 79/537 (14%), Positives = 176/537 (32%), Gaps = 65/537 (12%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PENVT 51
               N A +    A +   ++  N+ NA    Y R+ T+ + S                 
Sbjct: 5   FFGLNIALSGLYTAQRNLDTVGHNLSNATTPGYSRQQTIQSASNPLAVLDGTGMVGTGSQ 64

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
               +    +  D    + + A G+           ++   ++   +     +    DSL
Sbjct: 65  ATGVQRIRDSYLDFKYWSENVASGEWSKKAELMGEIQVTF-NEPSKSGFVKIMEGFFDSL 123

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           +  SK+ S       V+  A  + + FN +A   ++ + D + +++ ++  +    S++ 
Sbjct: 124 QELSKDPSSGAARALVVQKATTLTKYFNNTATHFEQFQNDLNDQVKTDVDQINIIASQIQ 183

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV--------RNNNDMVVYTSD 223
           ++N  I     +   A+D  D R  L+ ++S++  I              ++     T  
Sbjct: 184 LLNKQIYNYELTSGTANDLRDSRTKLVDQLSKLANIQAKEISYGKLPNGEDDVHFQITLG 243

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS-- 281
           G TL +            +  + +E      D      N  + +  G+++ LL +RD   
Sbjct: 244 GKTLVDHFSSTKLNVVQRTTKLNAEDIGNLYDIKWEDGNSVN-ISGGELRGLLDVRDGKD 302

Query: 282 ---------VVPIFQNQLDEMARVLIGSFSEKDP---IAGNSENVPGLFIADGIKDLDNK 329
                     VP +Q +L+E  +    +F+E            +V  +       DL + 
Sbjct: 303 GIDGTPIYKGVPYYQKKLNEFVQTFAIAFNEGYTKTNSGYAHTDVGHIDGYGYDPDLTDA 362

Query: 330 LCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD--------- 380
                           + P    D  +       +   +                     
Sbjct: 363 NTAPTGIRFFTMLGVGNTPISSADLIAGVTVGKSDPDYINQVAQQYKQITAKNFSVSSDI 422

Query: 381 --------------SFNKNFIFDPVAGINTNVTL------LEYARNSIGWLEKNRSDSHD 420
                               +   + GI TN +L       ++ ++ +  +  +   +  
Sbjct: 423 IDNPNNIAASETTGQNGNTGVLKKLMGIRTNQSLFKEGAPEDFMKSLVAGMGIDAQQAET 482

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
             +    +   +     +  GVNL EE++ +IK +QSYN + ++I+   ++  TL+ 
Sbjct: 483 FAITQDTLVRQVDNRRMSVSGVNLNEEMTNMIKFQQSYNAAARMIVTMGQIYDTLIN 539


>gi|291486094|dbj|BAI87169.1| flagellar hook-associated protein FlgK [Bacillus subtilis subsp.
           natto BEST195]
          Length = 507

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 73/516 (14%), Positives = 167/516 (32%), Gaps = 54/516 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +      ++   N+ NA+   Y R+                      
Sbjct: 3   STFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATDYFPAVSKNAEKTAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +         D      +++ G         +  E +  ++  ++     +
Sbjct: 63  QMGTGVQGKSVERIRDIFLDYQYRLQNNSAGYYDTKAKALSQMEGVL-NETDDSGLNSVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +   +SL+  S N +E+     V    + V + FN  +  +  ++++   E+   + ++ 
Sbjct: 122 NSFWNSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS+L  +N  I          +   DQRD+L+ K+S ++ I      +    + +++G
Sbjct: 182 SLLSQLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAEG 241

Query: 225 TTLFETVPRDI------------NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E + ++                ++ +           I     +    S   KG +
Sbjct: 242 TVSIEILDKNKQSLGTVLDGKNYEVSELAANYDNETGLVSSISIGDTAVQAESFSSKGSL 301

Query: 273 KALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI 323
              ++             V P   + LD MA     +F+E            G    D  
Sbjct: 302 LGFIESYGYITADGQEKGVYPEMLSDLDNMALEFAKAFNEVHRNGVTKSGEQGGDFFDFT 361

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
                       +    +    S  + +    + +     N   LA              
Sbjct: 362 GGETEPAKGAAGKIKVADSILDSKGANIAFSLTGAANDNANATKLA-------------- 407

Query: 384 KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
            N +   +       ++L+Y    IG L     +++ L   ++   N    +      V+
Sbjct: 408 -NVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADINRQQMSAVS 466

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           L EE++ +I+ + +YN + +++   D++L  ++ G+
Sbjct: 467 LDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGM 502


>gi|212637791|ref|YP_002314316.1| flagellar hook-associated protein [Shewanella piezotolerans WP3]
 gi|212559275|gb|ACJ31729.1| Flagellar hook-associated protein, putative [Shewanella
           piezotolerans WP3]
          Length = 457

 Score =  214 bits (544), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 83/486 (17%), Positives = 165/486 (33%), Gaps = 36/486 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT-------VV 53
           MS+    N   +  N +     +   N+ NA    Y R+  M +     V        V 
Sbjct: 1   MSM---LNIGMSGLNASMAALNATSNNVANAMVPGYSRQQVMMSSVGNGVYGSGAGVMVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +S +G  ++  S+    E +   +   NS +  +  L  SL S
Sbjct: 58  GVRRISDQYEVAQLWNTTSNLGFAKVQSSYFGQVEQVFGSE--GNSISAGLDLLFASLNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +E    + V++ A  + Q FN+ +  V       + +I      +   L  +   
Sbjct: 116 AMEQPNEIAYRQGVLNEARAISQRFNSISEGVSSQITQVEGQIGASAKEINAQLDSIAKF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+   A+ +     LD RD  +  +SEI+ +  +  +N  + +  + G  L      
Sbjct: 176 NAEIQAANANGNVPLALLDARDAAIDDLSEIVDVKVVEESNGLVNISLAQGQPLLAGTTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +          I         ++      G + AL+  RD+ +      +DE+
Sbjct: 236 SKIQVSPDPANPQFSQISIQFGQSNFPLDE---KAGGSLGALIDYRDNSLVDSMAFIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A  +   F+       +    P           +      I+                  
Sbjct: 293 AMTMADEFNAVLAGGTDLNGNPPTQDLFSYDPSNPAGSMKITA----------------- 335

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
            G  +    +      G    +    +  N +F F+    +  + T+ +   + +G L  
Sbjct: 336 -GFNADMLAFGKDGTPGDNSNLKDLVELANASFTFNS---LGVDTTMGDAFASKVGELGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      +  +       +++T GVN+ EE + LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAQMAEDTAVKLQMEAQSQWASTSGVNMDEEGTNLIIYQQSYQANAKVISTADQLFQ 451

Query: 474 TLLEGV 479
           T+L  +
Sbjct: 452 TILNSI 457


>gi|308175273|ref|YP_003921978.1| flagellar hook-filament junction [Bacillus amyloliquefaciens DSM 7]
 gi|307608137|emb|CBI44508.1| flagellar hook-filament junction [Bacillus amyloliquefaciens DSM 7]
          Length = 505

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 76/515 (14%), Positives = 168/515 (32%), Gaps = 54/515 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+   +      +++  N+ NA+   Y R+      +               
Sbjct: 3   STFMGLETARRALSAQQTALSTVSNNVANANTAGYTRQRVTLQSTSPYPAVSKNSDLTAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +      +  D      ++ +G      +  +  E +   +  +N     +
Sbjct: 63  QIGTGVKAGSVERVRDSFLDYQYRTENTKLGYYTARSNSLSQMEGVM-KELDDNGLNGSL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           S   ++L+  + N         + +  + + ++FN  +  +  I+ D  K ++     + 
Sbjct: 122 SSFWNALQDLATNPENTGARSVLQEQGKSLAESFNYISTSLTNIQGDIKKNLDNTADQVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L++L  +N  I     S    +D  DQRD L+ ++S +  I      +    + T++G
Sbjct: 182 SILNQLNDLNTQIAAVEPSGMLPNDLYDQRDRLIDQLSSMANIKVSYNKSGGHSLATAEG 241

Query: 225 TTLFETVP------------RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E +                   +M             +       N  +   KG +
Sbjct: 242 TVNVELLNGNNNSLGTLLDGNTKTVSEMKINYDKDSGLVSSVSIGSSEVNADAFTGKGSL 301

Query: 273 KALLQIRD--------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK 324
             L++            + P     LD MA     +F+             G    D   
Sbjct: 302 LGLIESYGYMSNGEEKGLYPEMLTALDNMALSFADAFNAVHEKGKTYTGEQGAAFFDFSG 361

Query: 325 DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNK 384
           D      +G +  I V+ +  ++   +    +  K    N  NLA   +           
Sbjct: 362 DE-AVPAKGAAAKIKVSDKILASTDNIAASLNGEKSDGTNATNLAAVQN----------- 409

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
                 +       T+ ++  + IG L  N   + +L   S+       +   +   V+L
Sbjct: 410 ----SKLTINGETTTINDFYESLIGKLGVNSQKAANLMNNSESNTLSADQRRQSVSAVSL 465

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            EE++ +I+ + +YN + ++I   D++   ++ G+
Sbjct: 466 DEEMTNMIQFQHAYNAAARIITMQDEIFDKIINGM 500


>gi|77918753|ref|YP_356568.1| flagellar hook-associated protein [Pelobacter carbinolicus DSM
           2380]
 gi|77544836|gb|ABA88398.1| flagellar hook-associated protein [Pelobacter carbinolicus DSM
           2380]
          Length = 464

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 76/491 (15%), Positives = 169/491 (34%), Gaps = 38/491 (7%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PEN 49
           MS L    N  +               NI N +   Y R+                    
Sbjct: 1   MSGLTDALNLGKTSLATHQTLLDVTGNNIANVNTDGYSRQSVDLGTVPALNFRGFQIGRG 60

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           VT    +       ++ +   +S +G+Q    +  A  E +    + N   T  I +  D
Sbjct: 61  VTANNIQRAEDTFLNRQILDKNSGLGEQSAQTTPLAEMETIFNLGNDN--LTAKIDQFFD 118

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
             E  S      +   TV+     +  +F++ ++++  + +  D+ +  +++ + + L++
Sbjct: 119 GWEQLSVTPDGSVERDTVLQYGTLLADSFHSMSQDLADLSSQVDEALTSKLAEINQKLAQ 178

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +   N  I    ++  +A+   D RD LL+++S  +G  +   N+ ++ V    G  L  
Sbjct: 179 VADYNQRITTLESTGINANADRDGRDALLEELSFSLGTQSYENNDGNVSVQLPTGLPLIS 238

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                         T T+  + + ++    +    +    G+ K LL +RD  +P  Q+ 
Sbjct: 239 GNRAFSL-----EATATATGSELQLNLGTTTRPVDANGLGGEFKGLLNLRDQFIPQVQDN 293

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           LD +A  L    +         +   G                       ++    ++P 
Sbjct: 294 LDRLAYTLSTEVNTLHAGGTGLDGSTGQDFF------------------SLSISGGADPW 335

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                G        N +  AG    +    ++     + +     +   +   +      
Sbjct: 336 SGAAAGIEVALTASN-QVAAGQSSAVGDNTNALLMTELKNAKTM-DGAHSFGTFYAKIAS 393

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +    + +       +     +     + VGV+L+EE+  LI+ ++ +  S KL+   D
Sbjct: 394 DIGLESAQNQLSVTGLEDTMLQLENLRDSKVGVSLEEEMINLIQYQRGFEASAKLLTTVD 453

Query: 470 KMLQTLLEGVK 480
           +M+ T+L   +
Sbjct: 454 EMMDTVLSLKR 464


>gi|325288761|ref|YP_004264942.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964162|gb|ADY54941.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 493

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 67/510 (13%), Positives = 159/510 (31%), Gaps = 55/510 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------P 47
           S  A     +   +       +   NI NA  + Y R+      +               
Sbjct: 3   STFAGLELGKRALSAQQLALNAAGHNISNASTQGYTRQVANLATTIPDQLYLFGHTQSVG 62

Query: 48  ENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL 107
             V V T      N  D+     ++        Q+     E +  ++   +S  + + K 
Sbjct: 63  TGVAVATIIRVRDNFIDRQYRWETARQQYWTERQNSLQQVEGIL-NEDSADSLHNDLDKF 121

Query: 108 RDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
             +    S +         V + A  +    N  ++++  ++ D D ++ +++  +    
Sbjct: 122 WVAWSDLSTSSETLGAKAVVRERAIALTGTLNHISKQITDMQNDLDNKVNVQVGLINNIA 181

Query: 168 SELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD---- 223
            ++  +N  IK    +    +D  D RD L+ ++S+I+ +  I   +             
Sbjct: 182 QQIKDLNMQIKSAEVAGDKPNDLYDVRDNLVDELSKIVSVRVIESTDPMFTDRQVGIYKV 241

Query: 224 -------GTTLFETVPRDIN------FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
                  G  L +                      T +  P    G             G
Sbjct: 242 QIGDEAAGQLLVDDSQVTELAWIDSVTNTTQDLDTTPDGIPDVEFGPGSGIKLQLGSQMG 301

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
            +++L+  R + +   Q +LD +A  ++ + +        +                   
Sbjct: 302 SLQSLIDTRYTYLQNLQGKLDNLAAGIVTAVNSLHQDTDPATTDYFF------------- 348

Query: 331 CQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP 390
                       +  ++   L          +      +G  D+ +      +       
Sbjct: 349 ---------DPTKLTASDITLYSDIEDDAGRIITGTTGSGDGDVASSIAALAHGWSSAAT 399

Query: 391 VAGINTNVTLLEYAR-NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELS 449
            A + +  +L +Y   N +     +   +  +      + N +S    +  GV++ EE++
Sbjct: 400 PAEMGSAASLGDYYNGNIVAVFGVDVQQAQRMTAVEDALINQLSNRRDSVSGVSIDEEMT 459

Query: 450 FLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            LIK + +Y+ + +++   D ML  ++ G+
Sbjct: 460 NLIKFQTAYSAAARMVTIMDDMLDKVVNGM 489


>gi|295697521|ref|YP_003590759.1| flagellar hook-associated protein FlgK [Bacillus tusciae DSM 2912]
 gi|295413123|gb|ADG07615.1| flagellar hook-associated protein FlgK [Bacillus tusciae DSM 2912]
          Length = 540

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 76/534 (14%), Positives = 170/534 (31%), Gaps = 61/534 (11%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS---------------- 46
                  A            +   NI+NA+   Y R+    + S                
Sbjct: 4   TFFGLETAVRGLRGQQAAINTASHNIDNANTPGYTRQRVDLSASTPIEMPSLYKTATPGQ 63

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
               V V           D      +  +G+  + Q        +  ++  ++     ++
Sbjct: 64  IGTGVQVEQITRLRDQFLDDQYRHQNQYLGEWNVRQDALDKISAIL-NEPSDSGLATVMA 122

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
              ++      N  +      V      V Q  N +A+++  + AD  + ++ +++ +  
Sbjct: 123 NFWNAWGKLGPNSDDLAARMQVKQTGIAVAQTLNQTAKQLSDLDADLQRSLQAKVTQVNS 182

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
           +L+++  +N+ I          +D LD+RD L+ ++S++  +          +  T  G 
Sbjct: 183 YLNQIATLNNQIAEIRQVGDQPNDLLDRRDYLVDQLSQLADVQATESGGTYTL--TIGGQ 240

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPI-------------------FIDGVVVSSNQGSA 266
           T+ +            +         +                     +G +     G  
Sbjct: 241 TVLQNSTVTSLDPANLTVGGGELKGLLEARQDVASYRAQLDAFANGLANGKMTIKLPGDW 300

Query: 267 VPKGKIKALLQI-RDSVVPIFQN--QLDEMARVLIGSFSEKDPIAGNSENVP-------- 315
              G          D  +   +   Q D++   LI + ++   +A   +           
Sbjct: 301 TLVGSGGGAPTFPVDVTLADGRQFKQGDQVPADLITTLADGTQVATIPKGAAVTVNGLNG 360

Query: 316 --------GLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNV-K 366
                        D     D       + TI V+P   S+   +    + + +   +   
Sbjct: 361 LHRLGYSLNGPGGDFFVSTDPNGGPITAATIAVSPDIVSDVGNIASALTTAPQKGTDPLT 420

Query: 367 NLAGYPDLINHYCDSFNKNFIFDPVA--GINTNVTLLEYARNSIGWLEKNRSDSHDLHMK 424
            LAG   L     +  +    +  +      TN TL +Y +  IG L     ++      
Sbjct: 421 GLAGDGTLAIAINNIKDTKIDYTGLGVPTPLTNGTLDDYFQAVIGGLGVQSQEAERQVAN 480

Query: 425 SQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            +V+   +     +  GV++ EE++ +I+ +Q+Y  S +++   D+ML  L+ G
Sbjct: 481 QEVLVQQLDGKRQSVAGVSIDEEMANMIRFQQAYGASARMVTAIDQMLDKLING 534


>gi|209963558|ref|YP_002296473.1| flagellar hook-associated protein 1 FlgK, putative [Rhodospirillum
           centenum SW]
 gi|209957024|gb|ACI97660.1| flagellar hook-associated protein 1 FlgK, putative [Rhodospirillum
           centenum SW]
          Length = 495

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 103/496 (20%), Positives = 200/496 (40%), Gaps = 19/496 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MS+      A        Q+ A + RN+ NA    Y R++              VTV   
Sbjct: 1   MSIGLALQTALTGLQAQQQKSAILSRNVANATTPGYTRKEVTLASLTVGGEGRGVTVQDV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           R        +     SS    +       A+            S +  ++ L  +  +  
Sbjct: 61  RRNADAHLARETRTQSSDYAAKAARADALAVYTESIGQPQEERSLSSAVTALETAFLALE 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
           +     +  + V+D A  +    N +  +++++R  AD +I   ++++ + L +L  +N 
Sbjct: 121 ELPDNPVQQRAVVDAAVSLANRLNAADDKIKQVRQQADSDIAASVADVNQALVQLEKLNR 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            +K +T S  D  +  DQRDVLL +I+  IGI    R+ N++VV T  G TL +   R +
Sbjct: 181 EVKMRTGSGQDTTELEDQRDVLLDRIAGQIGIQYFTRSPNELVVMTDGGVTLLDGSARML 240

Query: 236 NFEKMNSYTVTSES----NPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQ 289
            F        T+E     + + ++G  ++   G  +P   G+I  L ++RDS++P  + Q
Sbjct: 241 EFTPTAVIGSTTEYPSMLSGLKVEGADIAPGSGYPLPLKSGRIAGLFEVRDSLMPQARRQ 300

Query: 290 LDEMARVLIGSFSEKDP----IAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
           +DE+A VL+  F   D        +   +         +             +       
Sbjct: 301 IDEIASVLVDRFQAADASITGTGLSDTGLFTDAGVRHYRAPPYSPASPGPAGLAGRIA-V 359

Query: 346 SNPSFLRDGGSVS---KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLE 402
           ++   +  GG+ +              G    I  +   F +   FD  AG+    TL  
Sbjct: 360 NDLVRVEAGGNPALLRTGIHAATTGDVGDTAQIRSFLGVFQQTVSFDADAGLIPTGTLKG 419

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           +A  ++G  +  R+ + +      V+   +  +  +  GVN++EE+  L+ +E+++  + 
Sbjct: 420 FASAAMGHQQMLRATAANDAKAQSVLLETVETARISKDGVNIEEEMQELLLIEKAFAAAG 479

Query: 463 KLIMFTDKMLQTLLEG 478
           +++    +ML TL+E 
Sbjct: 480 QVMQAASRMLDTLMEI 495


>gi|262273522|ref|ZP_06051336.1| flagellar hook-associated protein FlgK [Grimontia hollisae CIP
           101886]
 gi|262222500|gb|EEY73811.1| flagellar hook-associated protein FlgK [Grimontia hollisae CIP
           101886]
          Length = 464

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 82/480 (17%), Positives = 156/480 (32%), Gaps = 25/480 (5%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFD 64
            +FN   +  N AS   +   +NI  +    Y R+          V V +    +     
Sbjct: 2   NLFNIGLSGLNAASAGLSVTGQNINQSLVPGYSRQRISFGSQDGGVQVSSVERMSDTFTH 61

Query: 65  KVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILG 124
             +    S  G  +    + +  E +      N S    + +   +L   S    +    
Sbjct: 62  LQIQRQRSGFGYHQATTQYLSQAEALL--TSDNTSLNVGLDRFYAALNEASAQPQDIAYR 119

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           +T+I  +E +V  FN  +++++  R   D ++E  ++     ++ L  +N +++    S+
Sbjct: 120 QTIISQSEAMVDRFNNLSQQLESQRKQVDGQLEASVNKANTLMANLASLNRSLREANGSE 179

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYT 244
            +    LD RD  L ++S ++ I+T   ++  + V    G  L          +  +   
Sbjct: 180 AEKASLLDARDATLTELSSMMDINTTYHSDGSVSVSLDQGQPLVNGASASQLMKNSD--- 236

Query: 245 VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEK 304
                    +     S+    +   G I  +L  RD  +   + +LD MA      F+ +
Sbjct: 237 ------GGLVLKRGESTFTLGSSAGGTIGGMLNYRDGHLQSLERELDVMAYSFATQFNAQ 290

Query: 305 DPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWN 364
                +     G  +              I           S+P  L   G+ +     N
Sbjct: 291 HTQGVDLNGKQGQPLF--------GGVDQIEGAAKNLTLLVSDPKALAFAGNGTVDEPGN 342

Query: 365 VKNLAGYPDLINHYCDSFNKNFIFDPVAGIN------TNVTLLEYARNSIGWLEKNRSDS 418
             NL     L N              +A            TL        G      S S
Sbjct: 343 SDNLEALIGLKNAPITLDKAKLSETDLAQYGDTIDKVNGKTLFTAYTGLCGDWAIKTSQS 402

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                 ++    H   +  +  GVNL EE   L++  Q Y  + K+I    ++L   +  
Sbjct: 403 KTDMASAESQVKHAENARDSVSGVNLDEEAVSLMQFTQMYQANAKVISTAQQLLDITMGM 462


>gi|90422625|ref|YP_530995.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisB18]
 gi|90104639|gb|ABD86676.1| Flagellar hook-associated protein [Rhodopseudomonas palustris
           BisB18]
          Length = 490

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 151/489 (30%), Positives = 252/489 (51%), Gaps = 10/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           M+L    N A++    A  Q A++ RNI  A    Y R++ +        V V   +   
Sbjct: 1   MTLTVALNSARSSLMAAGAQAAAVSRNIAGAKQDGYSRKNVLLATMPGSGVFVEGIQRAA 60

Query: 60  KN-MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
              +F+ VL A S++  Q  L    + +      D   + SP   ++KLR +L+  +   
Sbjct: 61  SAGLFNNVLKAASTSAMQDTLYNGLQKIAAATIDDPELDQSPAAQLAKLRTALQQSATAP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
               L +  +  A+ V  + N + + VQ +R DAD E+E  ++ + + L++   VN +I 
Sbjct: 121 DNVTLAQAAVTAAKGVAASLNDATKTVQGVRLDADAELETSVATINQLLAQFETVNTSIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +  D  D+LD RD +L K+S+ +GI+   R NNDMV+YT  G T+FE   R ++F+
Sbjct: 181 KGTITGADTTDYLDLRDSILSKLSQEVGITVSTRANNDMVIYTDSGVTMFEKTARSVSFD 240

Query: 239 KMNSYTVTSESNPIFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
           +   ++ T+  N ++IDGV V  ++    V  GK+  L  +RD     +QNQLDE+AR L
Sbjct: 241 QTYGFSPTTTGNAVYIDGVPVIGASAVMPVQSGKLAGLAALRDDTTVSYQNQLDEIARGL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL------CQGISETICVNPQYRSNPSFL 351
           + +F+E+D    +  +VPGLF   G   +             I+ +  V+     +P+ L
Sbjct: 301 VEAFAERDQSGASLPDVPGLFTYPGAPAIPGSGVIAVGLAGTITVSASVDQSVGGDPTRL 360

Query: 352 RDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDGG S +  + +N    AGY   +    D   ++  FDP A    N  L+++A +S+ W
Sbjct: 361 RDGGISGNPAYTYNTTGHAGYFARLQQMADGLTQSRAFDPAALAKPNTGLIDFAGSSVSW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           LE  R  + D    SQ +    +++ SN  GVN+ +E++F+++VE++Y+ S+KLI   D+
Sbjct: 421 LESQRKGASDESTYSQTLLERSADALSNVNGVNMDDEMTFMLQVERTYSASSKLISAVDQ 480

Query: 471 MLQTLLEGV 479
           ML+ LL  V
Sbjct: 481 MLKDLLAAV 489


>gi|189426324|ref|YP_001953501.1| flagellar hook-associated protein FlgK [Geobacter lovleyi SZ]
 gi|189422583|gb|ACD96981.1| flagellar hook-associated protein FlgK [Geobacter lovleyi SZ]
          Length = 465

 Score =  213 bits (542), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 72/495 (14%), Positives = 154/495 (31%), Gaps = 45/495 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           M L AV                 +  NI N +   Y R+  +   +             V
Sbjct: 1   MGLSAVLQIGTTGMRVYQVATEVVSENIANVNTPGYSRQRIVLETAEASTHNGFPLGSGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V         +  K L   S+  G            E +  ++   +     IS    S
Sbjct: 61  NVAAVERYYDALLQKQLVNASTTSGYDSKKSEVLQQIEPIF-NEVALDGLGAAISDYFSS 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  S N S +   + V++  + +   F+ +A  V       ++ ++     +   LS++
Sbjct: 120 WQDLSVNPSGNAERQAVLNQGQALADQFHYAAGTVSDAITTQNESLQPLTDEMNNMLSDI 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD-----GT 225
             +N  IK       +A++  DQRD L++++SE + +S    ++    V  +D       
Sbjct: 180 ARLNGQIKLTELVSGNANEMRDQRDYLVRQLSEKLAVSFTENSDGSTDVSYTDATGTYSL 239

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
               +           +    S    + +      +    A   G++ A L +RD+ +  
Sbjct: 240 VSGSSAGSFSLVNSGTTLPDGSARLSVQVTPAGGGAAATIAPTTGELGATLTMRDTTLQG 299

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
           + +++D +A  +I   +         ++    F                           
Sbjct: 300 YLDEVDALAFTMINQVNAVHSAGYGLDSTQNNFFTPVAVSTGAAESM------------- 346

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
                                ++            +   N     +A +N      +   
Sbjct: 347 ----------------ALAFTDINKVAAAQGPLPIATGDNRNALALATLNRTNGYSDDYN 390

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
             +  +  +  ++  +  +       ++    +  GV+L EEL+ L+K ++SY    KLI
Sbjct: 391 KLVAQVGLDVQNAATVVKQDAAFMKQLNTLRDSNSGVSLDEELTDLMKYQRSYQACAKLI 450

Query: 466 MFTDKMLQTLLEGVK 480
                ML   +  V+
Sbjct: 451 TTAGDMLDIAVNLVR 465


>gi|311070047|ref|YP_003974970.1| flagellar hook-associated protein FlgK [Bacillus atrophaeus 1942]
 gi|310870564|gb|ADP34039.1| flagellar hook-associated protein FlgK [Bacillus atrophaeus 1942]
          Length = 507

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 77/516 (14%), Positives = 165/516 (31%), Gaps = 54/516 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S       A+   +      ++   N+ NA+   Y R+                      
Sbjct: 3   STFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATSSFPAVSKNAEKVAG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +      +  D      ++  G            E +  ++  ++  +  +
Sbjct: 63  QMGTGVEAKSVERIRDSFLDYQYRLQNNNSGYYDTRAKALGQMEGVM-NETDDSGLSSVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +    S++  + N +ED     V    ++V   FN  +  +  ++++   E++  + ++ 
Sbjct: 122 NSFWKSIQELTNNSNEDSARSVVSQKGQDVAGTFNHISESLTNVQSNLKTELDSSVLDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             LS+L  +N  I     S +  +   DQRDVLL K+S ++ I      +    + +S+G
Sbjct: 182 SLLSQLNSLNQQIAQVEPSGNLPNGLYDQRDVLLDKLSSLVDIKVSYNKSGGNALASSEG 241

Query: 225 TTLFETVPRDIN------------FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKI 272
           T   E + ++                ++             +          S    G +
Sbjct: 242 TVSIEILDKNKQSLGTVLDGKDYKATELKVNYDEETGLAKSVSIGDSEIQADSFSSNGSL 301

Query: 273 KALLQIRD---------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI 323
              +Q             + P   + LD MA     +F+E       +    G    D  
Sbjct: 302 LGFIQSYGYVTADGEEKGIYPEMLSDLDNMALEFAKAFNEVHRNGLTASGEQGGDFFDFS 361

Query: 324 KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
               N      ++    +    S    +    S       N   LA              
Sbjct: 362 SGEANPAKGAAAKIKVTDSIKNSKGQNIAFSLSGEPNDNSNATKLASVLTGNITIS---- 417

Query: 384 KNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
                          T+L+Y  + IG L     +++ L   ++   N    +      V+
Sbjct: 418 -----------GKKTTVLDYYASLIGELGIKTQEANRLAANTETQLNAADLNRQQMSAVS 466

Query: 444 LQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           L EE++ +I+ + +YN + +++   D+ML  ++ G+
Sbjct: 467 LDEEMTNMIQFQHAYNAAARMVTLQDEMLDKVINGM 502


>gi|325291963|ref|YP_004277827.1| flagellar hook-associated protein FlgK [Agrobacterium sp. H13-3]
 gi|325059816|gb|ADY63507.1| flagellar hook-associated protein FlgK [Agrobacterium sp. H13-3]
          Length = 492

 Score =  212 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 157/492 (31%), Positives = 252/492 (51%), Gaps = 12/492 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQ+I NN  +Q     +NI N  N NYV+R  +   +    ++V       
Sbjct: 1   MSLTSAMNTAQSIFNNTGKQTDVTSKNIANVGNANYVKRTAILGTTMSGASIVANGRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               +   + +S    Q+ + +     + +   + Y +SP  Y+ +L  SL+ Y+   S+
Sbjct: 61  ESLLRQTISSASLASGQKTVLTGLEEMKSLFGGNDYESSPATYMKELLKSLDGYASKPSD 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L  T + +A +V  + N ++ E+Q +R  ADKE+ L++  L   L++    N+ +K +
Sbjct: 121 SALAATAVTSAVDVANSLNKASSELQAMRLRADKEMSLQVDKLNGLLAKFEEANNEVKAQ 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   +  D LDQR+ LL+ IS IIGI+ + R NND+ +YT+DG TLFE VPR + F+  
Sbjct: 181 TAIGGNPSDALDQRETLLKDISSIIGINVVNRENNDVALYTADGATLFEVVPRKVTFKAQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             Y  T   N I++DGV + ++ GS    +G ++ L+Q+RD + P  Q+QLDE+AR LI 
Sbjct: 241 PGYDATVTGNAIYVDGVAIKASSGSNTTAEGSLQGLMQVRDDLAPTMQSQLDEIARGLIT 300

Query: 300 SFSEKDPI---------AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
            F+EK               +   P          +   L   I+    +      NP  
Sbjct: 301 MFAEKPASPTSTLPKMPGLFTYGSPAATTIPASGVVSPGLAASITVNPALIISKGGNPEL 360

Query: 351 LRDGGSVSKKFLWN--VKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           LRDGG     ++ N       G+  LI+ Y  +F+    F     I+TN ++L+Y  NS+
Sbjct: 361 LRDGGINGTAYVINSTTSGGTGFSALIDSYVTAFDAPMNFAASTRIDTNTSILKYGTNSV 420

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RS +   +     ++   + SYSN   V+L EELS L+ +EQSY  + KL+   
Sbjct: 421 GWLEQERSGATSANEAKSALYERSATSYSNNTAVSLDEELSLLMDIEQSYKAATKLVTTI 480

Query: 469 DKMLQTLLEGVK 480
           D ML++L++ V+
Sbjct: 481 DDMLKSLMDMVR 492


>gi|148558589|ref|YP_001258003.1| flagellar hook-associated protein FlgK [Brucella ovis ATCC 25840]
 gi|148369874|gb|ABQ62746.1| flagellar hook-associated protein FlgK [Brucella ovis ATCC 25840]
          Length = 464

 Score =  212 bits (540), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 138/484 (28%), Positives = 230/484 (47%), Gaps = 25/484 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y+ + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGLDRLSALYSADNYSGSPSGLIGDLRDALQTYAASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +              R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSL--------------RNDADREIADSVANINDLLAKFEKANQDVVGG 166

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL+++S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 167 TRMGRDVSDYLDQRDALLKQLSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 226

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD      Q QLDE+AR L+ 
Sbjct: 227 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRD------QMQLDEIARGLVT 280

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 281 VFAESDQTGSSPDQTGLFSWSGSPAIPGADLSAGIAGTIEVSVPFIASEGGSALLLRDGG 340

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE  R
Sbjct: 341 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLEGKR 400

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             ++     +  V +    + SN  GV++  E++ L+ +E SY  S++++     ML  L
Sbjct: 401 QKANSEFTYNGTVASQADFALSNATGVDIDTEMALLLDLEHSYQASSRVLTTVSAMLDDL 460

Query: 476 LEGV 479
           L  V
Sbjct: 461 LNAV 464


>gi|121601813|ref|YP_989382.1| flagellar hook-associated protein FlgK [Bartonella bacilliformis
           KC583]
 gi|120613990|gb|ABM44591.1| flagellar hook-associated protein FlgK [Bartonella bacilliformis
           KC583]
          Length = 456

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 125/481 (25%), Positives = 225/481 (46%), Gaps = 26/481 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M+L +  N A+N     + QF  + +NI  A + NY RR +     P     V  R ++ 
Sbjct: 1   MALSSALNTARNSLKATTSQFDVVAKNIAGARDPNYTRRTSYLESGPRGAVHVAVRRDDS 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS       L +       +   D ++NSP+  +S  + +L++Y+ +  +
Sbjct: 61  PFLLDNYLVKSSQAAAAGSLANGLHRLAEIHGADGFSNSPSQLLSDFQKALQAYANDPDQ 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
              G   +D A ++V   N   RE++K+R DAD +I+  + ++   L +   ++  +  +
Sbjct: 121 RAAGDAAVDRARDLVNALNKGNREIEKLRNDADSDIQDSVDHINDLLQKFHDLDQKVVQE 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
             +  DA+ ++DQRD +L+++S+ IGI+T+   +    +Y  DG+TL++  PR + FE  
Sbjct: 181 KNAGRDAYSYMDQRDAVLKQLSQEIGINTVSHQDGSTSIYGMDGSTLYDKSPRKVTFESS 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           NS         +F+DGV +   +       G +  LL++RD + P +Q QLDEMA  L+ 
Sbjct: 241 NSLPAGVAGKQVFVDGVPLGHPSFVEPNGGGNLGGLLKVRDEMAPQYQKQLDEMASALMS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F             P LF+     + +     G+S  I +NP + SN            
Sbjct: 301 IF----------PGPPPLFLDSDKPEGEIGPMVGLSGRIKLNPIFDSNTP---------- 340

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                      +   I    D+F++   F    G+ T  +L+ + +NS+GWLE  RSD+ 
Sbjct: 341 -----GGGPEHFGKDIQSLVDAFDQKREFGSDTGLATEQSLMSFGKNSMGWLEGVRSDAD 395

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +F   +E+ SN  GVN  +E++ ++++EQ+Y  + ++I    KML  L+  +
Sbjct: 396 KNAKYQGTMFARAAEALSNETGVNTDDEMAVMLQLEQAYAATTRIISTVGKMLDDLMIAI 455

Query: 480 K 480
           +
Sbjct: 456 R 456


>gi|15887920|ref|NP_353601.1| flagellar hook-associated protein FlgK [Agrobacterium tumefaciens
           str. C58]
 gi|15155516|gb|AAK86386.1| flagellar hook associated protein [Agrobacterium tumefaciens str.
           C58]
          Length = 492

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 159/492 (32%), Positives = 254/492 (51%), Gaps = 12/492 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQ+I NN  +Q     +NI N  N NYV+R  +   +    ++V+      
Sbjct: 1   MSLTSAMNTAQSIFNNTGKQTDVTSKNIANVGNANYVKRTAILGTTMAGASIVSNGRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               +   + SS    Q  + S     + +   ++Y +SP +Y+ +L  SL+ Y+   S+
Sbjct: 61  ESLLRQTISSSSLASGQSSVLSGLEEIKSIFGGNNYESSPANYMKELLKSLDGYAAKPSD 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L  T + +A +V  + N ++ E+Q +R  ADKE+ L++  L   L++    N+ +K +
Sbjct: 121 AALAATAVTSASDVASSLNNASSELQGMRLRADKEMSLQVDKLNGLLAKFEEANNEVKAQ 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   DA D LDQR+ LL+ IS I+GI+ + R NND+ +YT+DG TLFE VPR + F+  
Sbjct: 181 TAIGGDASDALDQRETLLKDISSIVGINVVNRPNNDVALYTTDGATLFEIVPRSVTFKTQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             Y  T+  N I+IDGV + +    +    G ++ L+Q+RD + P  Q+QLDE+AR LI 
Sbjct: 241 PGYDATTTGNAIYIDGVALKAGTGTNTTAAGSLQGLMQVRDDLAPTMQSQLDEIARGLIT 300

Query: 300 SFSEKDPI---------AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
            F+EK               +   P          +   L   I+    +      NP  
Sbjct: 301 MFAEKPADPTSGLPNMPGLFTYGSPAATTIPPDGVVSPGLAASITVNPALIISKGGNPEL 360

Query: 351 LRDGGSVSKKFLWN--VKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           LRDGG     ++ N       G+  LI  Y  +F+    F     I+TN ++L+Y  NS+
Sbjct: 361 LRDGGINGTDYVINTATSGGTGFSALIRSYVTAFDAPMNFAASTRIDTNTSILKYGTNSM 420

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
           GWLE+ RS +   +     ++   ++SYSN   V+L EELS L+ +EQSY  + KL+   
Sbjct: 421 GWLEQERSGATSANEAKGALYERSAKSYSNNTAVSLDEELSLLMDIEQSYKAATKLVTTV 480

Query: 469 DKMLQTLLEGVK 480
           D+ML++L++ V+
Sbjct: 481 DEMLKSLMDMVR 492


>gi|157959896|ref|YP_001499930.1| flagellar hook-associated protein FlgK [Shewanella pealeana ATCC
           700345]
 gi|157844896|gb|ABV85395.1| flagellar hook-associated protein FlgK [Shewanella pealeana ATCC
           700345]
          Length = 457

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/486 (17%), Positives = 166/486 (34%), Gaps = 36/486 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-------SPENVTVV 53
           MS+    N   +  N +     +   N+ NA    Y R+  + +        S   V V 
Sbjct: 1   MSM---LNIGMSGLNASMAALTATSNNVSNAMVPGYSRQQVVMSSVGNGTYGSGSGVMVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +           +S +G      S+    E +   +   NS +  +  L  SL S
Sbjct: 58  GVRRISDQYQVTQQWNATSNLGFAETQASYFGQVEQIFGSE--GNSISAGLDLLFASLNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +E  L + V++ A+ + Q FN+ +  V       + +I      +   L  ++  
Sbjct: 116 AMEQPNEIALRQGVLNEAKALTQRFNSISEGVHTQVNQIEGQIGASAKEINAQLETISSF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N+ I+   AS +     LD RD  +  +S+II ++ +   NN + +    G  L      
Sbjct: 176 NEQIQASNASGNVPLSLLDARDAAIDDLSKIIDVNIVHDANNMVNISLVQGQPLLSGTTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +          +         ++ +    G + ALL  RD+ +       +E+
Sbjct: 236 SKIQVSPDPSNPLFSQLSVQFGQSSFPLDESA---GGSLGALLDYRDNSLVESIAFNNEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A+ +   F+       +                +      IS     +            
Sbjct: 293 AQTMADEFNTILKAGTDLNGNTPTQDLFTYDPTNPAGTLKISADFKPDMLAFGQ------ 346

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    +    +  +K+F FD    +  + T+ +   + IG L  
Sbjct: 347 ------------DGTPGDNSNLKALVELADKSFTFDS---MGIDATMGDAFASKIGELGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      ++ V       +++T GVN+ EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAKMAKETAEKVQIEAQSQWASTSGVNMDEEGVNLIIYQQSYQANAKVISTADQLFQ 451

Query: 474 TLLEGV 479
           T+L  +
Sbjct: 452 TILNSI 457


>gi|258622494|ref|ZP_05717516.1| putative flagellar hook-associated protein 1 [Vibrio mimicus VM573]
 gi|258585194|gb|EEW09921.1| putative flagellar hook-associated protein 1 [Vibrio mimicus VM573]
          Length = 457

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 63/481 (13%), Positives = 153/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN----------VTVVTQRS 57
           N A +  N          +N+ N +   + R+  + T               V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGFSRQQAIMTSVGGGKYEKHSPGMGVEVNSVRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K + + +S         +  +  E          + +  +  L  +L   +  
Sbjct: 65  ITDQFLVKQIWSTNSLASYASDYTNSMSKLENTLG--ADGLNISAGLDTLFSALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FN+ +  +     + + +    + +    +  +  +N  I
Sbjct: 123 PESIPYRQQIINESEALARRFNSLSESMNNQHKNMNDQRMAAVKHANSLMVNIAKINKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S++I + T  + +  + V  + G  L          
Sbjct: 183 TEMEGTGGNPAQLMDKRDELIGELSQVIEVKTTDQLDGSIQVTLASGQPLVMGGEYGQLK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +        S   S    G++ A+   ++ ++   Q  +++MA+ L
Sbjct: 243 AIPDPDDPQLADLHVEF---GEQSLVISGSVGGRLGAINDYQNEILKPNQVAINDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+       +    PG  +                               L      
Sbjct: 300 ADEFNAALATGTDLNKKPGKPLFTYDPANPAAS--------------------LNITDIQ 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
            K+   +  +  G  D++       NK            N+++ +   + +G        
Sbjct: 340 PKQLALSGDDTPGNGDVLKKLIAIGNKPVTI----TGFGNISINDAFTSMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +     ES  N   VN  EE + L+    +YN + K+I   +++  ++L+
Sbjct: 396 ADSDYQTRASMNQQAIESRDNVSAVNSDEEAANLMTFSNAYNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|56964843|ref|YP_176574.1| flagellar hook-associated protein 1 FlgK [Bacillus clausii KSM-K16]
 gi|56911086|dbj|BAD65613.1| flagellar hook-associated protein 1 FlgK [Bacillus clausii KSM-K16]
          Length = 528

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 66/522 (12%), Positives = 151/522 (28%), Gaps = 46/522 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE------------ 48
           MS        +   N       ++  N+ NA    Y R+      +              
Sbjct: 1   MSTFFGMETMRRAVNTNQTAIQTVGNNVANAKTPGYTRQRVNLQATGGYPATGVWTQPAM 60

Query: 49  ------NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH 102
                  V V         + D+   A +   G   +        E +  +   + + + 
Sbjct: 61  NGRIGSGVQVTGIERIRDQLLDRQYRAEAHVEGAAFIQYKILERMEGLYNEAPSDTTTSR 120

Query: 103 YISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
              +       + +  S       +++  + V   F    R  Q      + E EL  + 
Sbjct: 121 LSDQFDSFWNGWKELASGKESQAVLLEQGKAVTDAFTHLQRSFQTEMNMLETEAELTTAK 180

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           + + L +L   N  I+   +S    ++  D +D LL ++S ++ I      N        
Sbjct: 181 VNQILEQLHETNKDIRAAESSGQVPNELYDAQDKLLDQLSSLVPIQVSRSPNPQEHAAAG 240

Query: 223 DGTT----LFETVPRDINFEKMNSYTV---TSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
                   L       I             T +    +  G        +    G++  L
Sbjct: 241 AEGPYKVELKLGGSETITLVDATEEAPQLLTLQEGMQWTVGDSNQPFTYNGAGGGELVGL 300

Query: 276 LQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGIS 335
            +  + V      ++  +A+      ++    A + +   G        D          
Sbjct: 301 QKAHERVGQEL-EEIKALAQTFAKEVNQIYAFAYSEQGGFGQEFFTIHLDDAGAFSHISV 359

Query: 336 ET----------ICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDS---- 381
            +               +    P +  +       +  +  N   + DL+    ++    
Sbjct: 360 NSELSNNPKALATARFNEEGIKPEYKDEFAEKWAAWENDKDNEEAFRDLLAFLNEADHFV 419

Query: 382 ------FNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
                      +   ++ +  +  ++   R+ +G L        D    S     +   +
Sbjct: 420 GGKMIVEGDVDVAKEISRLEDSAAIMGKYRDMMGKLGVETKSQRDQTEASNARLANTESN 479

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
             +  GV+L EE++ LI+ + +YN + + +   D+ML  ++ 
Sbjct: 480 RMSISGVSLDEEMTLLIQFQHAYNAAARTMTAMDEMLDQIIN 521


>gi|260574381|ref|ZP_05842385.1| flagellar hook-associated protein FlgK [Rhodobacter sp. SW2]
 gi|259023277|gb|EEW26569.1| flagellar hook-associated protein FlgK [Rhodobacter sp. SW2]
          Length = 485

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 92/492 (18%), Positives = 181/492 (36%), Gaps = 21/492 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MSL A  + A +    +S+    +  N+ NA  + Y RR+          + + V V   
Sbjct: 1   MSLSASLSNAMSGLTASSRAAEVVSSNVANAMTEGYARREINLAALSLGGAGKGVVVTGI 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                           + +G +    +F    E         +S    ++    +L   S
Sbjct: 61  NRVVNQSLLADRRVAEAGVGDRDARTAFLQRLESTLGTSDSASSVLGRVAAFDSALIEAS 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                +     V+  A+ +    N ++ ++Q  RA AD +IE E++ L   L+ +  +N 
Sbjct: 121 SRPESEARLSNVLVAAQSLASGINAASTDIQAARASADDQIETEVATLNAGLARIAELNV 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I+ +     DA   +DQR  L+ +++ I+ +  + R +N + +YT+ G  L +     I
Sbjct: 181 QIRAQFGVSRDATALMDQRQQLVDQLASIVPLREVDRGHNQIALYTTGGIQLLDGRAAVI 240

Query: 236 NFEKMNSYTVTSESNPIFIDGVV------VSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            F  +   T         + G+        +S   S +  G + A   +RD + P  Q +
Sbjct: 241 EFTPVGVVTPDMTLASGSLSGLTLNGRSLPTSGAASMIGGGSLAAHFAVRDELAPAAQTK 300

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL---CQGISETICVNPQYRS 346
           LD +AR L+  F++       +   PGLF   G   +        Q ++    V+P    
Sbjct: 301 LDAVARDLVERFADPAIDTTRAPGDPGLFTDAGSAFVATDEVGLSQRLALNGAVDPAQGG 360

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
               LRD              L+G   L++    +            +    +      +
Sbjct: 361 ALWRLRD------GMGAVAPGLSGNSALLSSLQTALAAPRAPVSGGFMPGARSFSSLNAD 414

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
            I  +   R  +      +      + +      GV+  +E+  L+ +EQ+Y+ + ++I 
Sbjct: 415 VISGVSTARLGAEAESSFATARATALQQQELEN-GVDTDQEMQKLLLIEQAYSANARVIQ 473

Query: 467 FTDKMLQTLLEG 478
               M+  L+  
Sbjct: 474 TAGDMIDILMGI 485


>gi|167626161|ref|YP_001676455.1| flagellar hook-associated protein FlgK [Shewanella halifaxensis
           HAW-EB4]
 gi|167356183|gb|ABZ78796.1| flagellar hook-associated protein FlgK [Shewanella halifaxensis
           HAW-EB4]
          Length = 457

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 86/486 (17%), Positives = 167/486 (34%), Gaps = 36/486 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-------SPENVTVV 53
           MS+    N   +  N +     +   NI NA    Y R+  M +        S   V V 
Sbjct: 1   MSM---LNIGMSGLNASMAALTATSNNINNAMVPGYSRQQVMLSSVGNGVYGSGSGVMVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +S +G      S+    E +   +   NS +  +  L  SL S
Sbjct: 58  GVRRISDQYEVAQLWNTTSGLGYANTQSSYFGQVEQIFGSE--GNSISAGLDLLFASLNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +E    + V++ A+ + Q FN+ +  +       + +I      +   L  +  +
Sbjct: 116 AMEQPNEIAHRQGVLNEAKALTQRFNSISEGLNSQVTQVEGQINASAKEINTQLETIASL 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+   AS +     LD RD  +  +S II ++ +  ++  + +  + G  L      
Sbjct: 176 NAEIQSSNASGNVPLALLDARDSAIDDLSSIIDVNVVEDSSGMLNISLAQGQPLLSGTTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +          I         ++ +    G + AL+  RD+ +      +DE+
Sbjct: 236 SKLEVTPDPSNPKFSQISIQFGQSSFPLDETA---GGSLGALIDYRDNSLVDSMAFIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A  +   F+       +                +                     S    
Sbjct: 293 AMTMADEFNAVLAGGTDLNGNTPTQDLFTYDPTNPA------------------GSLKMT 334

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
            G  ++   +      G    +    D  NK+F F     +  + T+ +   + IG L  
Sbjct: 335 AGFNAEMLAFGKDGTPGDNSNLKELVDIANKSFTFSS---MGVDTTMGDAFGSKIGELGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      ++ +     + +++T GVN+ EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAQMSKTTAENLQMEAQKQWASTSGVNMDEEGVNLIIYQQSYQANAKVISTADQLFQ 451

Query: 474 TLLEGV 479
           T+L  +
Sbjct: 452 TILNSI 457


>gi|56695116|ref|YP_165463.1| flagellar hook-associated protein FlgK [Ruegeria pomeroyi DSS-3]
 gi|56676853|gb|AAV93519.1| flagellar hook-associated protein FlgK, putative [Ruegeria pomeroyi
           DSS-3]
          Length = 483

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 87/487 (17%), Positives = 171/487 (35%), Gaps = 13/487 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT---TISPENVTVVTQRS 57
           M++ A  N A +    AS+       NI NA    Y RR       TI    V ++    
Sbjct: 1   MTISAALNSALSGLTAASRATGVASDNIANALTPGYARRSLEVAGNTIGGAGVRILGVVR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +  +         +A G    +  F      +  + +   S  + I++   SL + +  
Sbjct: 61  NSDPVLLASRRGADAAQGYADGVSGFHTRMARLVGNVNDPRSVPNLIAEFESSLIAAAST 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S       V   A E+    N ++  +++ R DAD+ I  ++  L   L  +  +N  I
Sbjct: 121 PSVQTRLDAVATAASELATALNAASNGLREARNDADRSIGQQVDRLNTVLQNVETLNGRI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
           +    S  D+   LDQR  L+ +++ +I ++ + R++  + ++T  G  L +     ++F
Sbjct: 181 QSVKLSGGDSAPLLDQRQKLIDEVNTMIPVNVVARDHGSVALFTDGGAILLDGPAAQLSF 240

Query: 238 EKMNSYTVTSESNPIFIDGVVVSS------NQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                           + G+ ++          SA+  G + A  ++RD +    Q  LD
Sbjct: 241 TPTLQTMPHMTLENGLLSGLELNGMPLRLSGPTSAIRGGSLAAAFEVRDDLAIEAQQDLD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
            +AR LI  F        +    P                        +      +P   
Sbjct: 301 AVARDLIERFEAP---GLDPTAAPTDAGLFTDNGARFSASAQTGLAGRLKLNASVDPGQG 357

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
                +       V    G    IN +  +               ++T  +     +  +
Sbjct: 358 GQSWRLRDGLGAAVPGAVGNAQQINAFHQALTATRTPSDPRFGTGDMTANQVGAALLSRV 417

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
            +N S + +    +      + +      GV+   EL  L+++EQ+Y  + ++I    +M
Sbjct: 418 AQNESLATERLTFASASRTEMQKLELEQ-GVDTDVELQMLMQIEQAYAANARMIETVGEM 476

Query: 472 LQTLLEG 478
           + TLL  
Sbjct: 477 MDTLLRL 483


>gi|260779341|ref|ZP_05888233.1| flagellar hook-associated protein FlgK [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605505|gb|EEX31800.1| flagellar hook-associated protein FlgK [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 457

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 70/481 (14%), Positives = 150/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVSNINTPGYSRQQALMASVGGTKHDKLSPGLGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   A +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDEFLVKQTWATNSLSAYATRYSSTMSQLENTLG--ADGFSLSAGLDTLFSALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D + +    IS+    +S +  VN  I
Sbjct: 123 PESVPYRQQIINESEALARRFNTLTESLSHQHKDVNDQRNAAISHANSLMSNIADVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RD L+ ++S+++ + T  + +  + V  S G  L       +  
Sbjct: 183 VEMEGTGGNPAQLMDTRDALIGELSKVVEVKTTSQADGSLQVTLSSGQPLVMGGDAAVLK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +       P G++ AL   +  V+  +++ +D+MA+ L
Sbjct: 243 AVPDPSDPYLADLHVEFGTQSFAITDT---PGGQVGALTDYQTEVLKPYRSAIDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+       +     G  +                               L      
Sbjct: 300 ADEFNALLVTGQDLNGNAGKPLFSYDPANPAAS--------------------LTITDLK 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
            ++   +     G  D+++      NK            +VTL +     +G        
Sbjct: 340 PEELALSGDGNPGNADVLDSLIAVSNKAVSISGF----GSVTLNDAFAAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLSMSEQAMAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|229916660|ref|YP_002885306.1| flagellar hook-associated protein FlgK [Exiguobacterium sp. AT1b]
 gi|229468089|gb|ACQ69861.1| flagellar hook-associated protein FlgK [Exiguobacterium sp. AT1b]
          Length = 504

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 69/502 (13%), Positives = 153/502 (30%), Gaps = 29/502 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT---------------IS 46
           S       A+   +       +   N+ NA N  Y R+                      
Sbjct: 3   STFMGLETARRSLSTHQWALQATGNNVANASNPGYSRQRLTLGMTEQLSVNFGGTKAGQF 62

Query: 47  PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V   T       M D+     S         ++     E +  ++   N   H + K
Sbjct: 63  GTGVRGETLARIRDLMIDQQYRDESVKNAFYATKEAAFGRMEDI-INEPSENGLAHALDK 121

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
              SL+  + N  +      V   A  + Q FN  +  + K++ D   E  +    +   
Sbjct: 122 FWSSLQDLAVNPDDTGARSVVRQRALTLTQTFNYMSSSLSKVQEDLKAEAGVVTKKINDL 181

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
           L+++  VN  I          ++  D+RD  + ++S+ I    +  +  +     +    
Sbjct: 182 LTKIGDVNRQIGDAEPLGVLPNELYDERDRYMDELSQYIEFERVPVDYTNGETRGNSQRV 241

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF 286
               +   I+     + T  +  + +      V       +          + D +    
Sbjct: 242 AEGRIDIQISVPGTPTPTKITLVDGLT---GGVGKINDMEITDAAAGTTTLVFDDLPNGK 298

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
              L +M     G+ +         +++  +         D               Q   
Sbjct: 299 LKALVDMYGSATGTETHDGAFTKMLKDLDVMAKEFTTAFNDLHKTFYDGNVQDNPRQTGI 358

Query: 347 NPSFLRDGGSVSKKFLW---------NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
           +   + D  +V+              +     G         +  N    F   +     
Sbjct: 359 DFFIVGDAKTVTVNPTILSNLNLIAISKDQNIGDGSGALDLANLKNAQITFTGGSS-TAT 417

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            ++ +Y +N IG +    S + +L   +  + +   +   +   V+L EE++ +I+ + +
Sbjct: 418 TSIGKYYQNVIGNMAVEASQNGNLAKSTFALLSSSDQRRQSVSAVSLDEEMTMMIQYQHA 477

Query: 458 YNISNKLIMFTDKMLQTLLEGV 479
           YN + + I   D+ML  ++ G+
Sbjct: 478 YNAAARNITAVDEMLDKIINGM 499


>gi|262173360|ref|ZP_06041037.1| flagellar hook-associated protein FlgK [Vibrio mimicus MB-451]
 gi|261890718|gb|EEY36705.1| flagellar hook-associated protein FlgK [Vibrio mimicus MB-451]
          Length = 457

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 63/481 (13%), Positives = 154/481 (32%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN----------VTVVTQRS 57
           N A +  N          +N+ N +   + R+  + T               V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGFSRQQAIMTSVGGGKYENHRPGMGVEVNSVRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K + + +S         +  +  E          + +  +  L  +L   +  
Sbjct: 65  ITDQFLVKQIWSTNSLASYASDYTNSMSKLENTLG--ADGLNISAGLDTLFSALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FN+ A  +     + + +    + +    +  +  +N  I
Sbjct: 123 PESIPYRQQIINESEALARRFNSLAESMNNQHKNMNDQRMAAVKHANSLMVNIAKINKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S+++ + T  + +  + V  + G  L          
Sbjct: 183 TEMEGTGGNPAQLMDKRDELIGELSQMVEVKTTDQLDGSIQVALASGQPLVMGGENGQLK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +        S   S    G++ A+   ++ ++   Q  +++MA+ L
Sbjct: 243 AIPDPDDPRLADLHVEF---GEQSLVISGSVGGRLGAINDYQNEILKPNQVAINDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+       +    PG  +                               L      
Sbjct: 300 ADEFNAALATGTDLNKKPGKPLFTYDPANPAAS--------------------LNITDIK 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
            K+   +  +  G  D++       NK            N+++ +   + +G        
Sbjct: 340 PKQLALSGDDTPGNGDVLKKLIAIGNKPVAI----TGFGNISINDAFTSMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +     ES +N   VN  EE + L+    +YN + K+I   +++  ++L+
Sbjct: 396 ADSDYQTRTSMNQQAIESRNNVSAVNSDEEAANLMTFANAYNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|163794165|ref|ZP_02188138.1| hypothetical protein BAL199_02089 [alpha proteobacterium BAL199]
 gi|159180779|gb|EDP65298.1| hypothetical protein BAL199_02089 [alpha proteobacterium BAL199]
          Length = 476

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 114/487 (23%), Positives = 196/487 (40%), Gaps = 18/487 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MSLL     A +    A  +     RNI +A  + Y R+   T+          V V   
Sbjct: 1   MSLLNAIYSASSGIAAAQAKIDVASRNIASASVEGYTRKTQETSTRVVDGRGGLVLVEQV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                    + +   +S + +  +L  F A  E+       N+S +  I+ L+   ++ +
Sbjct: 61  TRNVNAQLQRDVREQTSVVEKLTILDDFLARFELEFGRPEDNSSISSKITDLKTKFQALA 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            N  +      VI  A+EV    N  +  +Q +RA+AD  +E  +  + + L  +  +N 
Sbjct: 121 TNPDQSTAQNDVISAAQEVALTLNNLSARLQALRAEADLRVEDSVDIINQALQNVQSLNA 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I  + A+     D  DQRDV + K+SE + I T  R +  + + T D   L +     +
Sbjct: 181 EIGSRKAAGESTADLEDQRDVWISKLSEQMDIKTFERPDGKIAILTGDSQFLLDQEAVTL 240

Query: 236 NFEKMNSYTVTSESNPIFID-GVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
            F    + +  S  N + +D G +   +  ++   G +  LLQ+RD+ +P+ Q+QLD +A
Sbjct: 241 TFVASTTVSAGSVLNDVMLDNGFMAPFSITNSFSGGTVSGLLQLRDTTLPLAQSQLDSLA 300

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
             L   F      A  ++       AD I          I     V      + +     
Sbjct: 301 FELAEQFDAITVGATTADLDLFTDAADAIPGAAAGFAAVIQVRSTVTGAELRDGTGGTFA 360

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT-NVTLLEYARNSIGWLEK 413
            S                 L     D F+   +F  V G+NT + TL E+A   I +   
Sbjct: 361 SSGVS-----------DSSLPLAIIDMFDTKQVFTAVTGLNTASSTLEEFAAQFISYQAN 409

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
             +D          V N +SE  ++  GVNL EEL+ LI++E ++  S +++    + L 
Sbjct: 410 QAADYESQLQFQDQVRNLLSERLTDDSGVNLDEELASLIQLEAAFAASARVLSSVQQALD 469

Query: 474 TLLEGVK 480
            LL  ++
Sbjct: 470 ELLGAIR 476


>gi|258625228|ref|ZP_05720140.1| putative flagellar hook-associated protein 1 [Vibrio mimicus VM603]
 gi|258582475|gb|EEW07312.1| putative flagellar hook-associated protein 1 [Vibrio mimicus VM603]
          Length = 457

 Score =  209 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 63/481 (13%), Positives = 153/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN----------VTVVTQRS 57
           N A +  N          +N+ N +   + R+  + T               V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGFSRQQAIMTSVGGGKYEKHSPGMGVEVSSVRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         +  +  E          + +  +  L  +L   +  
Sbjct: 65  ITDQFLVKQTWSTNSLASYASDYTNSMSKLENTLG--ADGLNISAGLDTLFSALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FN+ A  +     + + +    + +    +  +  +N  I
Sbjct: 123 PESIPYRQQIINESEALARRFNSLAESMNNQHKNINDQRMAAVKHANSLMVNIAKINKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S+++ + T  + +  + V  + G  L          
Sbjct: 183 TEMEGTDGNPAQLMDKRDELIGELSQMVEVKTTDQLDGSIQVALASGQPLVMGGENGQLK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +        S   S    G++ A+   ++ ++   Q  +++MA+ L
Sbjct: 243 AIPDPDDPRLADLHVEF---GEQSLVISGSVGGRLGAINDYQNEILKPNQVAINDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+       +    PG  +                               L      
Sbjct: 300 ADEFNAALATGTDLNKKPGKPLFTYDPANPAAS--------------------LNITDIK 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
            K+   +  +  G  D++       NK            N+++ +   + +G        
Sbjct: 340 PKQLALSGDDTPGNGDVLKKLIAIGNKPVAI----TGFGNISINDAFTSMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +     ES +N   VN  EE + L+    +YN + K+I   +++  ++L+
Sbjct: 396 ADSDYQTRASMNQQAIESRNNVSAVNSDEEAANLMTFANAYNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|253575863|ref|ZP_04853197.1| flagellar hook-associated protein FlgK [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251844657|gb|EES72671.1| flagellar hook-associated protein FlgK [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 523

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 75/522 (14%), Positives = 174/522 (33%), Gaps = 50/522 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------------- 44
           S       ++      +    ++  NI NA+ + Y R+    T                 
Sbjct: 3   STFHGIETSKRALFVNTVSMQTLGHNIANANTEGYTRQRVNLTEANPIWAMGMTKSAQPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +         D      +  +G   +L S     + +  ++   N  +  +
Sbjct: 63  QLGTGVEYTSITRVRDTFLDTQFRRENQMLGSWEVLNSSMTAIQNI-INEPSGNGLSAVM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               +S E+ +++ S       V   A  +V      +  +  +R D +  I+ ++    
Sbjct: 122 DDFWNSWETLNRDPSLLSARVAVAGAASNLVDTLKHISESLNNLRNDINTNIDKKVLEAN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L  +  +N  I+   +    A+D+ DQRD+LL ++S I+ +      N  + + ++  
Sbjct: 182 NILDNIARLNVLIRDNESFGDHANDYRDQRDLLLDQLSTIVDVQYTEDENGMVNITSAGV 241

Query: 225 TTLFETVPRDINFEKMN---------------------------SYTVTSESNPIFIDGV 257
             L       +     N                             T+ +    + +   
Sbjct: 242 NVLTGDTVTPLTAANANTATAGQLNGYVKSLQETDLIRNQLNGLVSTLVTGDIKVTLSNG 301

Query: 258 VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
            V+S+   A+    +  +  +    V    +++     V++  F+    +  +       
Sbjct: 302 YVTSSDIVALNDVTVDGMGTVAAGTVIPAGSKITSSMDVMVKGFNGLHQLGYSLTKPSST 361

Query: 318 FIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
            I   + D          + I VNP   ++ + +            N   + G  D+ N 
Sbjct: 362 GIPFFVSDSGT----FSIDDIKVNPDILADTNKIAASSQYEVINGVNTT-IRGNSDIANA 416

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
                +  F F       +  T  +Y R     L    S++   +   + + +++     
Sbjct: 417 IAGLRDAIFKFPDALTSLSEGTTDDYFRALTADLGIRASNTERNYENERTMTDNLQILRQ 476

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +  GV++ EEL+ +I+ +Q+YN + + +   D+ML  ++  +
Sbjct: 477 SVSGVSMDEELADMIRFQQAYNAAARNMTVVDEMLDRVINSM 518


>gi|315649834|ref|ZP_07902917.1| flagellar hook-associated protein FlgK [Paenibacillus vortex V453]
 gi|315274808|gb|EFU38189.1| flagellar hook-associated protein FlgK [Paenibacillus vortex V453]
          Length = 552

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 63/517 (12%), Positives = 161/517 (31%), Gaps = 42/517 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S   +    +           +   N+ NA+   Y R+ T                    
Sbjct: 3   STFHLLEIGKRGLIAQQAAINTAGHNVTNANTPGYSRQTTRLVAANPIAFPGMQRSQAAG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + R     + D      ++ +    + Q   +  E +  ++  ++S +  I
Sbjct: 63  QLGMGVEADSIRRVRDFLLDIEYRNQNTNLSTWSVQQETLSNIEGIF-NEPSDSSLSASI 121

Query: 105 SKLRDSLESYSKNLSED--ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
           ++   + ++ SKN S+        V   A  + + FN    ++  +  +    I+ +++ 
Sbjct: 122 AEFWTAWQTLSKNPSDTDLSARMAVQQKAIALTETFNHIYSQLDTLSNNLTSRIDTKVAE 181

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
              ++ ++  +  +IK       +A+D  D+RD+L+ ++S +  ++     +    V   
Sbjct: 182 ANNYIDQVAELTQSIKRIEGLGDNANDMRDKRDLLIDQLSLLGNVNVTETGDVYQ-VTFG 240

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
           +   + +     I      + T    +  +    V V              A  ++  ++
Sbjct: 241 NQVVVDDMTSTPITNAIAGTLTGGEIAGYVTSRDVHVQGYITQLNIMANTLATGKVEVTL 300

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNS---------------------ENVPGLFIAD 321
                          +   +    +A ++                           F++ 
Sbjct: 301 PAGTILPPGVNIPNAVMDANNPRKLAVDTKHTVDGLNGLHKLGYTLNEPATTGSDFFVSA 360

Query: 322 GIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDS 381
               +     +             ++                 +K   G   LI    + 
Sbjct: 361 NGGPITAGNMRLSQNIQSDLKNIGASLRTEMKTNPDGTTSEVVLKGNGGMALLIAGLSER 420

Query: 382 FNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVG 441
                  +    +        Y ++ I  L  + S++  +     ++  H      +   
Sbjct: 421 TFSFNPNNSNGAVTDITNFEGYLQSVISKLGTDSSNAIKMVENGTLLVEHADTLRLSISS 480

Query: 442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
           V+L EE+S LI+ + +Y+ S++++   D+ML  L+ G
Sbjct: 481 VSLDEEMSDLIRFQHAYSASSRVVTTIDEMLDKLING 517


>gi|325295212|ref|YP_004281726.1| flagellar hook-associated protein FlgK [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065660|gb|ADY73667.1| flagellar hook-associated protein FlgK [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 451

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 77/482 (15%), Positives = 160/482 (33%), Gaps = 33/482 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           MSL    + A     +         RNI N     Y R   +        VTV T R   
Sbjct: 1   MSLFESLSIASQALLSNKAAINVTNRNISNVYTDGYSRETPVFADIPGTGVTVETVRRIF 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
              +     + +         +      E +  +D   +  +  ++   +++   +    
Sbjct: 61  NKAYFTRYISENQNNKGLSSYKDILEQIESVF-NDLQGSGFSQELTDFFNAMNDVAVKPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +      ++  A+ +V     S   + +I+     +I+ E++ L   L +L  +N  +K 
Sbjct: 120 DIAARSELLAKAQALVGRIRDSYSTLSEIKNTTVAKIKDEVTQLNNLLEKLAGINKDLKI 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
             +     + +LD+RD  L +IS +I    +++ +  + +YT+ G  L           K
Sbjct: 180 YASDPERVNQYLDERDKTLTEISNLIDTKAVIKEDGTVDLYTAKGFALVLGNEAK----K 235

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           ++  T  +    +   GV ++S   +    G +K +       +      L+        
Sbjct: 236 ISFETDGNGDPILKSSGVDITSELKNGTIGGYLKGISY-----LNKVLGNLNTFTTNFAD 290

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
             + +     +     G+                I+       +  +  S          
Sbjct: 291 EINAQHKAGFDLYGETGIDFFKAENGAPTIDASNITLNFEDPKKIAAAESKDYLNADNG- 349

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR-NSIGWLEKNRSDS 418
                               +      + D V     + +  EY   + I  +      +
Sbjct: 350 --------------------NIKKLIALKDNVWTNLGDKSFSEYYNTDIIVAIGAELEST 389

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            DL   S  V   IS+       VN+ EEL  L + +++Y  + K++  TD++LQT+L  
Sbjct: 390 KDLLTNSDFVLQAISDKMKELSSVNMDEELLNLTRYQRAYEAAAKVVNVTDELLQTILGM 449

Query: 479 VK 480
           V+
Sbjct: 450 VR 451


>gi|225851146|ref|YP_002731380.1| flagellar hook-associated protein FlgK [Persephonella marina EX-H1]
 gi|225645441|gb|ACO03627.1| flagellar hook-associated protein FlgK [Persephonella marina EX-H1]
          Length = 485

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 78/495 (15%), Positives = 159/495 (32%), Gaps = 25/495 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSL    + A            +   NI N     Y R+       P   V + T     
Sbjct: 1   MSLFYSLSIAGQSLLTHKNAINTTNSNISNVYTDGYSRKIPQLANIPTGGVELKTVERAF 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
              +       ++        +      E +  +D   +     +++  +S    + N  
Sbjct: 61  NQAYFNRYVNTNNLKTGYENYKDILQQVESVF-NDIQGSGFADELNQFFNSFNDIAVNPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +     + +  AE +V     S   +  I+      I   ++ L     ++  VN  I+F
Sbjct: 120 DIAARYSALSKAEALVGRIRNSYETLTDIKEKTSLSIRDNLNRLNDLTGQIATVNKNIRF 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA     +++LD+RD LL++IS +I +    R++  + + T  G  L           +
Sbjct: 180 YTADPAKRNEYLDERDRLLKEISSLIDVKVTFRDDQTVDISTVKGHPLVIFDRNIPLTYE 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +S         I  +G  ++         G ++ +       +    N+L++   VL  
Sbjct: 240 TDSNGDP----VIRHEGTDITFLFDKGKIGGYLQGI-----KKINESINKLNDFTTVLAM 290

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLD-----------NKLCQGISETICVNPQYRSNP 348
             +++     +     G+         +                             S+ 
Sbjct: 291 VVNKQHRAGFDLNGNTGIDFFTIDPSSNKNNLDASNIVVGITDPESIAAASDPAYTNSDN 350

Query: 349 SFLRDGGSVSKKFLW--NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
           + ++   ++                    +                    N +  E+  +
Sbjct: 351 TNIKKIIALKDDITGVLTAAEETTLSTTGSLTIGGITYTLNSFDSYTFIKNKSYSEFYSS 410

Query: 407 -SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
             I  L    +   +L+ +  ++   +         VNL EEL  L K++++Y  S K+I
Sbjct: 411 EMIAPLGFEINRVENLYQEQNLILETVDSKMKEISSVNLDEELINLTKLQRAYEASAKII 470

Query: 466 MFTDKMLQTLLEGVK 480
             TD++LQTLL  VK
Sbjct: 471 NVTDELLQTLLGLVK 485


>gi|284989567|ref|YP_003408121.1| flagellar hook-associated protein FlgK [Geodermatophilus obscurus
           DSM 43160]
 gi|284062812|gb|ADB73750.1| flagellar hook-associated protein FlgK [Geodermatophilus obscurus
           DSM 43160]
          Length = 482

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 61/493 (12%), Positives = 151/493 (30%), Gaps = 37/493 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE------------- 48
           S     N A+     + +      +NI N +   Y R+                      
Sbjct: 3   STFGGLNTARTALWASQRGLDVTGQNIANVNTDGYSRQRVELRAMGGTAVPAIHSVSSPV 62

Query: 49  --NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V             ++     ++   Q  +     A  E     +         +  
Sbjct: 63  GNGVDANQVDRIRDVFLERRGQVETARTAQLTVGNEALAQVEAAFR-EPGETGIRSMLDD 121

Query: 107 LRDSLESYS--KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +     + +   + +E  +   V++  + +     T+   + +        +    + + 
Sbjct: 122 VWAGFSALANATDPTEPAVRSQVLERLDILASGMRTTRATLDQQWRQTRDNVVALAAEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
              S +  +N  I+  T S    ++  D+RD+L+ +++E +G +++  ++  + V     
Sbjct: 182 TTASSIADLNTQIRQATRSGLPTNELSDRRDLLVVQLAEKVGATSVAASDGMVDVIVGGT 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
           T +       +    ++        N   +   V +    +    G     + +  + +P
Sbjct: 242 TLVAGGSALGLRVAGVDDPDAVGAGNDPRV---VTAPGGTTLAVGGTAGGQMAVLSTTLP 298

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            ++N LD +AR L+G  +       +     G           N +    +         
Sbjct: 299 SYRNALDGLARDLVGKINAVQAQGYDVYGASGAAEPLMDDGSGNPVVDLANVDAGNIRVR 358

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
            + P  +    + +   L       G  D                       N  +    
Sbjct: 359 VTRPELIAA-ATTAPGVLGAPSADGGNADAFFDLSL---------------ENGGVDATY 402

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           R  +  L    S         +V+   +  +  +  GVNL EE++ ++  + +Y+ + ++
Sbjct: 403 RALVVALGVEASVVARDVAVQKVISTQVDAARESVSGVNLDEEMTNMLSFQHAYSAAARM 462

Query: 465 IMFTDKMLQTLLE 477
           +   D+ L TL+ 
Sbjct: 463 VTAIDEALDTLIN 475


>gi|312884828|ref|ZP_07744520.1| flagellar hook-associated protein FlgK [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367480|gb|EFP95040.1| flagellar hook-associated protein FlgK [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 457

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 66/481 (13%), Positives = 151/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVTQRS 57
           N      N +        +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIGLTGLNASRVALDVTAQNVANINTPGYSRQQALMASVGGPKHDKLSAGAGVEVPSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +     K     +S         +  +  E          S +  + K  ++L   S  
Sbjct: 65  ISDEFLVKQTWQTNSIASYAERYTTNFSQLENTLK--ADGFSISTGLDKFFNALNDASVT 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                L + +I+ AE + + FNT    +     +   +    +++    +  +  +N+ +
Sbjct: 123 PDSTPLRQQIINEAEALSRRFNTLTESLYNQHKEMSDQRTATVNHANSLMVNIADINNQV 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    LD+RD L+ ++S++I + T  + +  + +  S G  L          
Sbjct: 183 VEMRGTGGNPAQLLDERDSLIGELSKLIEVKTTKQADGSLQLSLSSGQPLVIGGDAGQIQ 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              ++         I      V          GK+ AL   +  ++  +++ LD+MA  L
Sbjct: 243 ALPDAGDPYLAKMQIEF---GVQVYPVPGAMGGKMGALNDYQTDILKPYRDALDDMASNL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
               +       + +  PG  + +                             L      
Sbjct: 300 ADEVNTVLATGLDLQGNPGAALFEYDPANPAAS--------------------LNITSIT 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
             +  ++     G  D++       NK            N +L +   + +G        
Sbjct: 340 PDQLAFSSDGNHGNSDVLKDLVALSNKAMAVSGF----GNTSLNDAFVSMVGKTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +    ++      +  N   VN  EE + L+    ++N + K+I   +++ +++L 
Sbjct: 396 ASSDYKAKSLLNEQAIAARDNVSSVNSDEEAANLMTFANAHNANMKVISTANELFESVLR 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|327478815|gb|AEA82125.1| flagellar hook-associated protein FlgK [Pseudomonas stutzeri DSM
           4166]
          Length = 459

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 69/486 (14%), Positives = 149/486 (30%), Gaps = 36/486 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT--------TISPENVTV 52
           MS+L+      +    +     +  +NI N +   + R             T     V V
Sbjct: 1   MSVLS--QIGYSGVRASQIALTATGQNIANVNTPGFSRLAPEMHSVGGQTATSIGGGVQV 58

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
            + R  + +  ++ L   S+        Q +    E +   +   +S +  +     +L 
Sbjct: 59  SSIRRLSNDFQNQQLWRASTDKNYYGTSQQYLTALEGLIHSE--GSSVSVGLDNFFAALS 116

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             S       L + +I  A ++ Q FN     +         +    ++ +      +  
Sbjct: 117 EASSTPESIGLRQQIIGEARQLAQRFNGLNGNIGTQLNALQGQRVAMVAEINGLSGNIAE 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I    ++  D     D R+ L++ +S+  GI      +  + V  ++G  L     
Sbjct: 177 LNAEILKMESAGRDTATLRDYRENLIKDLSQYAGIRVQEVADGTLTVSLANGQPLVAGTT 236

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                 + N     +    + +     +         G + AL  +    +   Q  L +
Sbjct: 237 AGQLRVEQNL----AGEQELTLVFAKTTFPLVQEGLGGSLGALYDMEYGALRPAQADLHD 292

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           MA  L    ++      +    PG  +                          S    L 
Sbjct: 293 MAAALAQMVNDTLAGGFDLNGNPGQPLFVHTP--------------------GSTSGMLA 332

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
                 ++  ++    +G  ++ N+             V    ++V L +     +G + 
Sbjct: 333 VTALTPEQLAFSSAGQSGTGEVGNNQNLLALLELKSAKVNVAGSDVPLNDAYAGLVGRVG 392

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
                +      + VV         +   VNL EE   L+  EQ+Y  + K+I  ++ + 
Sbjct: 393 SASRQNKADLAAATVVAEQAQAQRDSVSAVNLDEEAVNLMAYEQAYQANMKVISTSNDLF 452

Query: 473 QTLLEG 478
             +L  
Sbjct: 453 NAVLAM 458


>gi|255099395|ref|ZP_05328372.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-63q42]
 gi|255305252|ref|ZP_05349424.1| putative flagellar hook-associated protein [Clostridium difficile
           ATCC 43255]
          Length = 436

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 80/495 (16%), Positives = 170/495 (34%), Gaps = 79/495 (15%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
            L ++ N A +  N   +   +I  NI N D   Y R+ T    +               
Sbjct: 3   GLFSILNTANSGMNAHQKAIQTISHNISNLDTDGYSRQRTEFATNSPMYMPSLSNSIARG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V        + +D    A +   G+      +    E +  ++  +   +  I
Sbjct: 63  QLGTGVHVTDVTRARNSFYDYQFRAEAHKYGKTVSKYDYYNTIETIL-NEPSDYGISAGI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                  ES SK+++ D     V++NA  +    + S +++ K++ D D  I+ EI  + 
Sbjct: 122 DDFFKGWESLSKDINSDSKKSLVVENASNLATLISESYKKLDKLKEDIDSNIDTEIKQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L  L  +N +I   + S    +D LD+RD +L  +S  +        N          
Sbjct: 182 DMLKSLEDLNKSIDIISGSGSTPNDLLDERDRILDNLSFKLDFENSDVKNMLAD------ 235

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                                      + ++ +            G ++ L ++    + 
Sbjct: 236 -------------------------GKLELNELKNPDGTWKTGISGTLQGLFEMH-GKID 269

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            +++ L +++  L    ++    +              + D          + I +NP  
Sbjct: 270 TYKSDLKDVSDGLAKQINDVYNTSAGIT----------VTDFFITSNVDGEDIIKINPAI 319

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           +SNP+ L+     + K                    +  K+   D         T+ ++ 
Sbjct: 320 KSNPNELKLTADEASKI-------------------AKLKDEKIDIGVAGGKVSTISDHY 360

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           +     +  +    +      + + N+I  S  +  GV+L EE++ LIK+++SY  S K+
Sbjct: 361 KAFAESIGLDSQKVNQDEANQRKIINNIDNSRMSVSGVSLDEEMTELIKIQRSYQASAKV 420

Query: 465 IMFTDKMLQTLLEGV 479
           +    ++L  ++ G+
Sbjct: 421 MSTAVQLLDVVINGI 435


>gi|172058468|ref|YP_001814928.1| flagellar hook-associated protein FlgK [Exiguobacterium sibiricum
           255-15]
 gi|171990989|gb|ACB61911.1| flagellar hook-associated protein FlgK [Exiguobacterium sibiricum
           255-15]
          Length = 509

 Score =  207 bits (527), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 61/503 (12%), Positives = 146/503 (29%), Gaps = 26/503 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S        +           S   NI NA    + R+  +   +               
Sbjct: 3   STFMGIETGRRALTTNQWALQSTGNNIANAGTAGFSRQRLVMATTEQLSMAIGTGKMGQI 62

Query: 47  PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V           M DK     ++        ++     E +  ++  +         
Sbjct: 63  GTGVRGEILERVRDVMLDKQYRDEATKTAYYGTKEAAFGRMEDI-INEPSDTGLAKAFDG 121

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
             +SL++ S N  +      V   AE + Q FN  ++ + +++ D   EI++    +   
Sbjct: 122 FWESLQTLSTNPQDSGARSVVRQKAETLTQTFNYMSKSLSQVKEDLKSEIDVSTKKVNDL 181

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
             ++  +N  I          +   D+RD  + ++++ +    +  +   +        T
Sbjct: 182 FKKIHNINAEIHTVEPLGVLPNALYDERDRYMDELAQYVDFEKVSVDAEAITQGKLGNAT 241

Query: 227 ---------LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ 277
                    L +    +      +        +    D  + +  + ++       A   
Sbjct: 242 KTAEGRIDILVKLPNGNKLRAVDSDVAQAGILSFTTNDKGLYTGFETNSQTISFDAAGGG 301

Query: 278 IRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISET 337
             +  +        ++          K     +          +     + K  +     
Sbjct: 302 FANGRIAGLLEMYGQIKNGQPTGEFVKMQSNLDEMATTFATAFNAAHAANFKKDKTNGTD 361

Query: 338 ICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV-AGINT 396
                   S  +     G   K  L N+          +       +      + A   T
Sbjct: 362 QFFVATSGSISAATIAVGQDIKGSLDNIATSTDGNIGDSAGALKLAQMKTTSLLFATSVT 421

Query: 397 NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQ 456
             T+  + +N IG +         L   S V+ +   +   +   V++ EE++ +I+ + 
Sbjct: 422 TTTIGSFYQNVIGDMGVATDQVGRLGQSSAVLMDSAEQRRMSVSAVSIDEEMTMMIQYQH 481

Query: 457 SYNISNKLIMFTDKMLQTLLEGV 479
           +YN + + I   D+ML  ++ G+
Sbjct: 482 AYNAAARNITTVDEMLDKIINGM 504


>gi|294675565|ref|YP_003576180.1| flagellar hook-associated protein FlgK [Rhodobacter capsulatus SB
           1003]
 gi|294474385|gb|ADE83773.1| flagellar hook-associated protein FlgK [Rhodobacter capsulatus SB
           1003]
          Length = 484

 Score =  207 bits (527), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 99/491 (20%), Positives = 183/491 (37%), Gaps = 20/491 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MS+ + FN A +    +S++   +  NI NA  + Y RR+          +   V ++  
Sbjct: 1   MSIASAFNFAISGLTASSRKAEVVSSNIANAMTEGYARRELSIASQTLGGTGGGVRILGV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                 +  + L    SA         F    E    D     S +  +S    +L + +
Sbjct: 61  NRIVNQVVQQDLLLMDSAAANTTAKADFYNRLETQIGDPETAGSLSATMSDFESALLTAA 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                     T +  A  V    N+ + ++Q  R  ADK I  ++  L   L +L  +N 
Sbjct: 121 SMPDSTARLTTAVRAASTVADKLNSISEDLQAARLTADKSIAKQVRTLNETLVQLQEMNR 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I  + +  +DA   +D+R  L+ +I+EI+ +  + R NN + ++T+ G  L +     I
Sbjct: 181 TITTQISIGNDAAGLMDERQSLVNQIAEIVPLRVVQRENNQIALFTTGGAILLDGSAATI 240

Query: 236 NFEKMNSYTV-----TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
            F+            +   + + I+G   S+     +  G + A   +RD + P  Q+QL
Sbjct: 241 GFDGAGVMAPHLTLDSGALSGLTINGYPTSTKDDGPLGGGTLGAAFAVRDELAPEAQSQL 300

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL---CQGISETICVNPQYRSN 347
           D  AR L+  F +       S   PGLF   G     +        I     V+P+   +
Sbjct: 301 DAFARDLMTRFEDPSVDTTLSAGDPGLFTDAGSAFDASTEVGLAGRIRMNAIVDPEQGGS 360

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              LRD        +           ++N    +  +          +   +    A   
Sbjct: 361 SWHLRD------GLMAAAPGAVSDGTILNALSAALTRESAPASGNYGSALRSASGLAAEL 414

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           + +    R  +      +      ++E      GV+   E+  L+ +E++Y  + K++  
Sbjct: 415 LSFASSGRQSAELTQGYATARHEALTEMSLAD-GVDTDYEMQSLLVIEKAYAANAKVVQT 473

Query: 468 TDKMLQTLLEG 478
            D MLQ LL+ 
Sbjct: 474 IDAMLQELLDI 484


>gi|296452609|ref|ZP_06894303.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP08]
 gi|296880979|ref|ZP_06904925.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP07]
 gi|296258570|gb|EFH05471.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP08]
 gi|296428000|gb|EFH13901.1| flagellar hook-associated protein FlgK [Clostridium difficile
           NAP07]
          Length = 436

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/495 (16%), Positives = 175/495 (35%), Gaps = 79/495 (15%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
            L ++ N A +  N+  +   +I  NI N D + Y R+ T    +               
Sbjct: 3   GLFSILNTANSGMNSHQKAIQTISHNISNLDTEGYSRQRTEFATNSPMYMPSLSNSIGRG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V        + +D    A +   G+      +    E +  ++  +   +  I
Sbjct: 63  QLGTGVHVTDVTRARNSFYDYQFRAEAHKYGKTVSKYDYYNTIETIL-NEPSDYGISAGI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                  ES SK+++ D     V++NA  +    + S +++ K++ D D  I+ EI  + 
Sbjct: 122 DDFFKGWESLSKDINSDSKKSLVVENASNLATLISESYKKLDKLKGDIDSNIDTEIKQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L  L  +N +I   + S    +D LD+RD +L  +S  +        N          
Sbjct: 182 EMLKSLEDLNKSIDIISGSGSMPNDLLDERDRILDNLSFKLDFENSDVKNMLAD------ 235

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                                      + ++ +  +         G ++ L ++    + 
Sbjct: 236 -------------------------GKLELNELKNADGTWKTGVSGTLQGLFEMH-GKID 269

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            +++ L +++  L    ++    +              ++D          + I VNP  
Sbjct: 270 TYKSDLKDVSDGLAKQINDVYNTSAGIT----------VRDFFVTSNVDGEDIIKVNPAI 319

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           +SNP+ L+     + K                    +  K+   D         T+ ++ 
Sbjct: 320 KSNPNELKLTADEASKI-------------------AKLKDEKIDIGVAGGKVSTISDHY 360

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           +     +  +    +   +  + + N+I  S  +  GV+L EE++ LIK+++SY  S K+
Sbjct: 361 KAFAELVGLDSKKVNQDEVNQRKIINNIDNSRMSVSGVSLDEEMTELIKIQRSYQASAKV 420

Query: 465 IMFTDKMLQTLLEGV 479
           +    ++L  ++ G+
Sbjct: 421 MSTAVQLLDVVINGI 435


>gi|260429026|ref|ZP_05783003.1| flagellar hook-associated protein FlgK [Citreicella sp. SE45]
 gi|260419649|gb|EEX12902.1| flagellar hook-associated protein FlgK [Citreicella sp. SE45]
          Length = 485

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 107/490 (21%), Positives = 189/490 (38%), Gaps = 17/490 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---SPENVTVVTQRS 57
           MSL    + A +     S+  + +  NI NA  ++Y RR   T+        V +     
Sbjct: 1   MSLSGALSNALSGLTANSRAASLVASNIANATTESYGRRTLETSSRTVGVGGVQIDGVNR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                         +  G    +Q+F +  E +        S + + S   +++ S S +
Sbjct: 61  RIDTAVLSDRRLSDAQTGFAENMQTFASKIESLLGPSGEAGSLSSFYSAFENAILSASSD 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S     +TV   A++ V   N  +  +Q  RA AD+ I  ++ +L   L  +  +N+AI
Sbjct: 121 PSSTQRLQTVALAAQDFVGKLNDVSTTLQLSRATADRTIAAQVDSLNTALGRVKDLNEAI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV----PR 233
                   DA   +D+R  ++ ++SEI+ + T+ R+N  + VY + G  L +      P 
Sbjct: 181 AESMYRNGDASSLMDERQRVIDQVSEIVPLRTVQRDNGMIAVYAASGNPLLDPTIHSEPA 240

Query: 234 DINFEKMNSYTVTSE-----SNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           +I F   N  T          + + I G  V+S     +  G + A LQIRD+V    Q+
Sbjct: 241 EIGFTAQNLVTADMTLGNGLLSGLTISGKAVNSTNEGPLGGGTLGAQLQIRDTVAVELQS 300

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
            LD +AR LI  F    P        PGLF   G+                      ++ 
Sbjct: 301 VLDGIARDLIERFEPGGPDTTLVAGDPGLFTDAGLAFDPLNEVGLAGRISLNALVDPTDS 360

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
              R    +      +V    G   L+  Y D+     +    +      +  E+  + +
Sbjct: 361 GTWRLRDGLGAATQGDV----GDARLLQAYSDALESLNVPGSTSLGTGAFSFGEHVGDFV 416

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +   R  +      S      + E   +  GV+   EL  ++++EQ Y  + ++I   
Sbjct: 417 SAVSTARVRADGQQSFSNAQNTALKELELSA-GVDTDAELQEMLRIEQHYAANARVITTV 475

Query: 469 DKMLQTLLEG 478
           D+++QTLL  
Sbjct: 476 DELMQTLLSI 485


>gi|330447910|ref|ZP_08311558.1| flagellar hook-associated protein FlgK [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492101|dbj|GAA06055.1| flagellar hook-associated protein FlgK [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 455

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 70/483 (14%), Positives = 160/483 (33%), Gaps = 37/483 (7%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT--------ISPENVTVVTQR 56
            + N   +  N           N+ N +   Y R+  M +         +   V V + R
Sbjct: 2   NMINIGLSGLNANKTALDVTAHNVANVNTVGYSRQQAMMSALAGRELFSAGSGVEVDSIR 61

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
             +     K + A +S         +   + E +   + +N   +  +  L  +L   + 
Sbjct: 62  RVSDQFIVKQMWAATSQQAASNANLANMTMLESLLGGEGFN--ISAGLDSLFSALNDATL 119

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
                   + +I+ A+ + + FNT +  +         +    I +    +S +  +N  
Sbjct: 120 KPESTPNRQQIINEAKALSRRFNTLSESLHGQGNRISDKATASIEHANSLMSNIADINHR 179

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           +    A+  +    +D+RDVL++++SE++ IS+  + N  + V  + G  L         
Sbjct: 180 VVETQATGGNPSQLIDERDVLIKQLSEVVEISSTQQPNGSLQVTLASGQPLILGSDAAQL 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
                      ++  I   G   +    +    G++ A      + +   Q  L+EMA  
Sbjct: 240 KATPIVNEPFIQNIEIDFAGQTFAV---TGEFGGQLGAYDDYLKNTLKPTQQVLNEMAEN 296

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           L   F++      +    PG  +     +                         L     
Sbjct: 297 LASEFNQVLASGFDLNGDPGQALFSFAPNSPAAS--------------------LDITAI 336

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
              +   +     G  D +    +   K    + +     NV+L +   + +G       
Sbjct: 337 TPAELALSSDGTPGNSDTLQALINLSTKPMAINGL----GNVSLNDAFASMVGKTAIETR 392

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +      ++ + +  + +  N   VN  EE + L+    +Y  + K+I   +++  ++L
Sbjct: 393 QAAVDQKAAETLSSQANAARDNLSAVNSDEEAANLMTFTNAYQANMKVISTANELFDSVL 452

Query: 477 EGV 479
             +
Sbjct: 453 RLL 455


>gi|126738558|ref|ZP_01754263.1| flagellar hook-associated protein K [Roseobacter sp. SK209-2-6]
 gi|126720357|gb|EBA17063.1| flagellar hook-associated protein K [Roseobacter sp. SK209-2-6]
          Length = 484

 Score =  206 bits (524), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 79/483 (16%), Positives = 174/483 (36%), Gaps = 8/483 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--PENVTVVTQRSE 58
           M++ +  N A +     ++    +  N+ NA    Y  +    + +       V      
Sbjct: 1   MTITSAINSAMSGLTANARSSQVVSENLANALTPGYSAQRLNLSTNSYTGGTKVDGVERL 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
                        +         +F +    +      + S +  +S    +L       
Sbjct: 61  IDPALQASARTAEAEHSAAETYANFYSRMSSLVGVVDDDTSISAQVSNFDSALIEAVSRP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
                   +   A+ VV+    +A  +  +R +A+  I  ++  L   L E+  +N  I 
Sbjct: 121 DSTERLHQLSVQADLVVKTITHAADGLNALRVEAETSINSQVRTLNNSLKEIEKLNARIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
              A+        DQRD L+ ++++II ++ + R+   + +Y+  G  L +    +I F+
Sbjct: 181 VSEAAGTSTTAMQDQRDKLIDEVNKIIPVNVLSRSQGRVALYSEGGVALIDGRASEITFD 240

Query: 239 KMNSYTVTSE-----SNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            + +            N + ++G ++ ++    +  G + A   IRDS     QN LD +
Sbjct: 241 ALQTIEPHMTLDNGLLNGLEVNGKLIDTSADGPLRGGTLAAQFDIRDSAAVEAQNDLDAL 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A+ L+  F +    A       G+F   G    +      +  +  +      + S   +
Sbjct: 301 AQDLVERFQDPALDATLGATDAGIFTDAGGFFDNTVPANTVGLSARLELNSSVSLSGAAE 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                       +   G   L+  Y D   +              +L   + + +    +
Sbjct: 361 TWRFRDGINAASQGDPGNASLLTAYSDRLAETRSVSTTKLGAITGSLNTLSASVMSRFAR 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           +   ++     +   F+ +S++     GV+   EL  L+ +E++Y  + K++   D+M+Q
Sbjct: 421 DSDTANSTMSFAAASFSEMSKAKLAL-GVDSDAELQNLMIIERAYAANAKMLEAVDEMMQ 479

Query: 474 TLL 476
           TLL
Sbjct: 480 TLL 482


>gi|268317787|ref|YP_003291506.1| flagellar hook-associated protein FlgK [Rhodothermus marinus DSM
           4252]
 gi|262335321|gb|ACY49118.1| flagellar hook-associated protein FlgK [Rhodothermus marinus DSM
           4252]
          Length = 464

 Score =  206 bits (524), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 71/495 (14%), Positives = 166/495 (33%), Gaps = 48/495 (9%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT----------------- 43
           MSL  +F+  +           ++ +N+ NA+ + Y RR                     
Sbjct: 1   MSLNQLFSLTRRSFQTIQAAMNTVGQNVANANTEGYARRRVTLQAVNIRDTGIYTALPPR 60

Query: 44  TISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
           + +   V+V T      ++ D       +++G          + E + A D  +      
Sbjct: 61  SATGLGVSVATYERLRDHLLDVAAWDARASLGAADEETRIYQVLESLLAAD-DDTGLAAL 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           ++   +     + N ++  + + +   A+ ++  F+  AR++  +     + +   +   
Sbjct: 120 LNDFWNRWSDLADNPTDTGVREALRGQAQTLIDTFHRLARDLDTLTIQTTETLRDAVDQA 179

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
              L EL  +N  I+      +      D+RD L+ +++E++ +      +    +    
Sbjct: 180 NSLLEELASLNATIQAARQKGNPDLVAEDRRDQLVHELAELLPVQVHALEDGSYQLTVGG 239

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              +       +  +        +  N                   G+I A L++    +
Sbjct: 240 MALVQGDQVMPLTLDLSGGTPSLTFGNTGIAFRAPEG-------QDGRIGAQLRMLTQTI 292

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
           P  + +LD +A  L+   + +       + + G    D               TI ++  
Sbjct: 293 PDVRQRLDTLAATLVNEVNSRHASGYGLDGLTGRAFFDPAGTTA--------STIALSAD 344

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
             ++   +                 +G P        +     + D +       T   Y
Sbjct: 345 VLADSRAIA---------------ASGDPTAPGDNSVALQIAGLRDALLFNGGTETAETY 389

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
           A N  G +     D+     +S+   +H+       +GV+L EEL+ +I+ +Q+Y  + +
Sbjct: 390 AINLAGIIGAAAKDATGRLERSRATIDHLDALQQGVMGVSLDEELTNMIRFQQAYAATAR 449

Query: 464 LIMFTDKMLQTLLEG 478
           ++     M+ TLL  
Sbjct: 450 VLDTARSMMDTLLNL 464


>gi|329928727|ref|ZP_08282576.1| flagellar hook-associated protein FlgK [Paenibacillus sp. HGF5]
 gi|328937508|gb|EGG33926.1| flagellar hook-associated protein FlgK [Paenibacillus sp. HGF5]
          Length = 523

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 62/517 (11%), Positives = 160/517 (30%), Gaps = 42/517 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S   +    +           +   N+ NA+   Y R+ T                    
Sbjct: 3   STFHLLEIGKRGLIAQQAALNTAGHNVTNANTPGYSRQTTRLVAANPIAFPGLQRSQAAG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +     + D      ++ +    + Q   +  E +  ++  ++S +  I
Sbjct: 63  QLGMGVEAESIQRVRDFLLDIEYRNQNTNLSTWSVQQETLSNIEGIF-NEPSDSSLSASI 121

Query: 105 SKLRDSLESYSKNLSED--ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
           ++   + ++ SKN S+        V   A  + + FN    ++  +  +    I+ +++ 
Sbjct: 122 AEFWTAWQTLSKNPSDTDLSARMAVQQKAIALTETFNHIYSQLDTLSNNLTSRIDTKVAE 181

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
              ++ ++  +  +IK       +A+D  D+RD+L+ ++S +  ++     +    V   
Sbjct: 182 ANNYIEQVAELTQSIKRIEGLGDNANDLRDKRDLLVDQLSLLGNVNVTETGDVYQ-VTFG 240

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
           +   + +     I      + T    +  +    V V              A  ++  ++
Sbjct: 241 NQVVVDDMTFTPITNAIAGALTGGEIAGYVTSRDVHVQGYITQLNIMANTLATGKVEVTL 300

Query: 283 VPIFQ-----------------NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK- 324
                                  +L E  +  +   +    +               +  
Sbjct: 301 PAGTILPPGVNIPNAVMDANNPRKLAEDTKHTVDGLNGLHKLGYTLNEPATTGGDFFVSA 360

Query: 325 ---DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDS 381
               +     +             ++                 +K   G   LI    + 
Sbjct: 361 NGGPITAGNMRLSQTIQSDLKNIGASLRTEMKTNPDGTTSEVVLKGNGGMALLIAGLSER 420

Query: 382 FNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVG 441
                  +    +        Y ++ I  L  + S++  +     ++  H      +   
Sbjct: 421 TFSFNPNNSNGAVTDITNFEGYLQSVISKLGTDSSNAIKMVENGTLLVEHADTLRLSISS 480

Query: 442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
           V+L EE+S LI+ + +Y+ S++++   D+ML  L+ G
Sbjct: 481 VSLDEEMSDLIRFQHAYSASSRVVTTIDEMLDKLING 517


>gi|327441344|dbj|BAK17709.1| flagellar hook-associated protein [Solibacillus silvestris StLB046]
          Length = 562

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 68/556 (12%), Positives = 167/556 (30%), Gaps = 79/556 (14%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       ++           +   NI NA+   Y R+      +               
Sbjct: 3   STFMGLEASKRGLYTQQSALYTTGHNISNANTLGYSRQRVNMETTPGFPGAGLNSGKTAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   + +       D+     ++ +G  +      +  E + + +          
Sbjct: 63  HIGTGVQASSVQRIRDEFVDRQYRQETNKLGYWQSTTQSISQMEDVMS-EPTEFGINQAF 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           ++   S+E    N  +    + +I   + + ++FN    ++++I+ +   EI +  S + 
Sbjct: 122 TEFWKSMEDVVTNPKDTAARQVMISKGQSLAESFNYMDTQLKQIQGNIGNEINVVTSEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L ++  +N  ++    + +  +D  D RDVLL K++++I +S     +    +  ++G
Sbjct: 182 SLLKQIADINKQVQAIEPNGYMPNDLYDARDVLLDKLNDLIPVSISFEKSGGNALAIAEG 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGK------------I 272
           +      P + +   +      +E + +   G  V  +       G             +
Sbjct: 242 SMTVTFKPVNGDPIILVHSKNYAELSTMDSKGKPVDGDVDEDDTAGYASFSGIVVKGSIL 301

Query: 273 KALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ 332
           K      D+      ++                    +S+      I        +    
Sbjct: 302 KEENPNYDATTNPTVSKYLYKIDANPTGKEVAYNQLEDSKGKLAALIDAYGYVEKDSTGT 361

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPD--LINHYCDSFNKNFIFDP 390
            I +           P  L+    ++ +F+     +  Y +  + N   +          
Sbjct: 362 VIVDGNGKPIVKGIYPEMLQKLDKLASEFINAFNGMHAYSEDPVTNAVINQAYNLKGDKA 421

Query: 391 VAGINTNV-----------------------------------------------TLLEY 403
               +                                                  T   +
Sbjct: 422 GNFFDGTTAKNMKVLDGMKPEDIAASNVLGEEGNNKNILALSALQSAVQGNLQGGTFQSF 481

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
            ++ IG L      +  L   S  +   I  + ++   V+L EE++ +I  +Q+YN + +
Sbjct: 482 YKSLIGELGVKGQQALTLEYNSTTLLLQIENNRASHNSVSLDEEMTNMITFQQAYNANAR 541

Query: 464 LIMFTDKMLQTLLEGV 479
           +I   D+ L  ++ G+
Sbjct: 542 MITVIDETLDKIINGM 557


>gi|255263716|ref|ZP_05343058.1| flagellar hook-associated protein FlgK [Thalassiobium sp. R2A62]
 gi|255106051|gb|EET48725.1| flagellar hook-associated protein FlgK [Thalassiobium sp. R2A62]
          Length = 479

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 88/488 (18%), Positives = 174/488 (35%), Gaps = 21/488 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MS+ +  + A +    AS+    +  N+ N+    Y RR    +          V +   
Sbjct: 1   MSISSSLSNALSGLTAASRAAEIVSSNLANSLTDGYARRRLDLSSQLTGGVGGGVQIDGV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                           + +G      +F    E +        + T  +++L  SL + S
Sbjct: 61  ARLVDRGVLADRRISDANLGFADTSVAFFRNLERVMGVPGDPGTLTDRLTQLETSLIAAS 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
              S +     V  +   +    N     +Q  R  AD  I   +  L   L+ +  ++D
Sbjct: 121 IQPSSEQRLDAVGQSFLGITAELNRLTDSIQTDRERADASIAANVDELNASLALIDKLSD 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     S  D    LDQR + +  +S+II +  + R+NN + + ++ G TL+++ P   
Sbjct: 181 DITTIRISGADISALLDQRQLAIDAVSKIIPVQEVSRDNNQIALVSAGGGTLYDSQPAIF 240

Query: 236 NFEKMNSYTVT----SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
           +FEK ++ T      +    +  +G  V+  + +    G ++    +RD      Q +LD
Sbjct: 241 SFEKTSTITGELSVINGLGHLKFNGTSVNFLENNPFDGGILEGHFDVRDEFAVQAQTELD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP-QYRSNPSF 350
           E+A  LI  F   D     ++ +    +               +            + S 
Sbjct: 301 EIAASLIDRFQGDDVDPTQTDVLGIPALGIFTDGGQAFSSGNEAGVAGRISINELVDVSQ 360

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                           +  G P  I ++  + +       +A           A +    
Sbjct: 361 DGKSQLFRDGLYDEGGSELGDPTQIQNWLGALSTPLSDSALAE----------ATDVFSK 410

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +   R  S          +  + ++  +  GV+  +E+  L+ +EQ+Y+ + K+I   D+
Sbjct: 411 IGSRRLISERNFSFENARYETLKQAELSD-GVDTDQEMQNLLLIEQAYSANAKVIQTVDE 469

Query: 471 MLQTLLEG 478
           M+QTLL  
Sbjct: 470 MMQTLLRL 477


>gi|159045918|ref|YP_001534712.1| flagellar hook-associated protein FlgK [Dinoroseobacter shibae DFL
           12]
 gi|157913678|gb|ABV95111.1| flagellar hook-associated protein FlgK [Dinoroseobacter shibae DFL
           12]
          Length = 485

 Score =  206 bits (523), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 102/487 (20%), Positives = 181/487 (37%), Gaps = 15/487 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MS+ +    A +    AS+  + +  NI NA  + Y  R   TT          V VV+ 
Sbjct: 1   MSVTSTLGNALSGLTAASKAASVVSSNIANATTEGYGVRQVQTTSVSLNGQGSGVQVVSV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                        A  +A  Q   L SF    E          S +   S+   +L    
Sbjct: 61  SRNVNEGVLADRRAADAAYAQAATLASFYGSVEGAIGLPGDEGSLSSEFSQFEAALVEAG 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                D     V+  AE +    N  + ++Q  R +A+KEI  ++ NL   L+++  +N 
Sbjct: 121 SRPDSDARLANVVRAAESLAGTLNDLSADIQSERLEAEKEIARQVDNLNTSLAQIQDLNG 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I+ + A+ +D    +DQR VL+ +I+ I+ +S + R+   + + T  G  L +    +I
Sbjct: 181 DIRLQIAAGNDPLGLMDQRQVLIDQIATIVPVSVVDRDFGQVALITESGGVLLDGTAAEI 240

Query: 236 NF------EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
           +F          +               V S++  + +  G + AL +IRD +    Q  
Sbjct: 241 SFRDVGLITPDMTVASGGLYQVEINGSPVDSTSPNNPLKGGSLDALFEIRDELAVSAQGD 300

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           +D +AR LI  F         S   PGLF   G           +     +    R +P+
Sbjct: 301 VDAVARDLIERFQNSAIDPTLSAGEPGLFTDAGALVDPANE---VGLAGRIELNARVDPA 357

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
              +   V            G   +I    D+ ++  +    +  +   T    A + + 
Sbjct: 358 KGGEVWRVRTGLGATSPGDPGAGGIILALSDALSEPKVVASGSFSSIPRTAAALASDLLS 417

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +   R  S +    +   +  +        GV+   EL  L+ +E +Y  + ++I   D
Sbjct: 418 TIGAARQASENEVSYTAAKWETLRSLELEG-GVDTDAELQKLLMIETAYAANARVIQTVD 476

Query: 470 KMLQTLL 476
           +ML  LL
Sbjct: 477 EMLDLLL 483


>gi|319790356|ref|YP_004151989.1| flagellar hook-associated protein FlgK [Thermovibrio ammonificans
           HB-1]
 gi|317114858|gb|ADU97348.1| flagellar hook-associated protein FlgK [Thermovibrio ammonificans
           HB-1]
          Length = 449

 Score =  206 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 77/480 (16%), Positives = 171/480 (35%), Gaps = 35/480 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           M+L    + A     +      +  RN+ N +   Y R + +        VTV T R   
Sbjct: 1   MALFGALSLASQALLSQQIAVNTTNRNLSNVNTDGYSREEPVFADIPGGGVTVATLRRVF 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            ++  K   + +      +      +  E +  +D   +  +  I+     +   + N +
Sbjct: 61  SSVLFKRFISENQNNAYLKAKSEVLSQVESLF-NDQMGSGLSQAINDFFSVMNDVAVNPA 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +    + ++  A+ +V     S   +Q+I++   K++   +SNL + L +L  +N  I  
Sbjct: 120 DLAARQELLSKAQVLVGRIRDSYSALQEIKSTYSKQVAESVSNLNQLLEKLADINRNIPL 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
              S    + +LD+RD  +++IS II       ++  + +YT+ G  L       +  ++
Sbjct: 180 FADSPDRLNQYLDERDRTIKEISSIIDAKVQFNSDGTVNLYTAKGFAL-------VLGDR 232

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
               TV +  + + +       +  S +  G +  L+   + VV     +L+ +   +  
Sbjct: 233 TFKVTVKNTDSGVKVLADGR--DITSDLSGGSVGGLVSALN-VVESAMERLNTLTSTIAN 289

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
             + +     N     G+ +                          ++   L        
Sbjct: 290 EVNAQHEQGYNLYGETGIDLFASDNGQP----------------IDASNIVLAFNDPKKF 333

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR-NSIGWLEKNRSDS 418
               +   L      +       +K +           ++  EY       W+ +    +
Sbjct: 334 AAASDPNYLDSDNGNVKALMALADKTYTQL------NGLSFAEYYGTQITSWIGQEVESN 387

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            +L   S    + I +      GVN  EEL  L + +++Y  + +++  TD++LQT+L  
Sbjct: 388 DNLLKNSDFQLDAIKQKVEELSGVNTDEELVNLTRYQRAYQAAARVVTVTDELLQTILNM 447


>gi|13472593|ref|NP_104160.1| flagellar hook-associated protein FlgK [Mesorhizobium loti
           MAFF303099]
 gi|14023339|dbj|BAB49946.1| flagellar hook-associated protein 1; FlgK [Mesorhizobium loti
           MAFF303099]
          Length = 484

 Score =  206 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 161/483 (33%), Positives = 249/483 (51%), Gaps = 4/483 (0%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  + AQ+   + ++Q + + RN+ +A N +Y RR  + T +      V  +    
Sbjct: 1   MSLSSALSIAQSALMSTARQTSVVTRNVSDASNPDYARRIAVVTSTAPGARSVDIQRVAN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           ++  +      SA   Q  L S     ++        +SP+  I+ L+ +L+ Y+ + S 
Sbjct: 61  DLLFRQNLGALSAYSGQNALYSGMDQLDVSVNGVDNASSPSTAIANLQQALQLYATSPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +VID A++VV++ N  ++ +Q  R   D +I+  + +L   L +    N A+   
Sbjct: 121 QNLGSSVIDAAKQVVRSLNEGSKAIQDFRTQTDGQIDTAVKDLNSLLGQFQDANQAVISG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T S  D  D LDQRD LL+KI++ I IST  R +NDMV+ T DGTTLFET+PR ++F   
Sbjct: 181 TRSGTDVSDALDQRDALLKKIADYIPISTFTRGDNDMVITTGDGTTLFETIPRTVSFTPA 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             Y   +  N I+ID V VS+   G+    GK+  LLQ+RD V    Q+QLDE AR LI 
Sbjct: 241 AGYAAGAPGNTIYIDNVPVSAGSGGNTTASGKLAGLLQLRDGVASTMQSQLDETARGLIT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIK---DLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           +F+E  P   N+  +     A  +     L N L   IS    ++P    NP+ LRDGG+
Sbjct: 301 AFAETAPAMPNAAGLFTWSGAPAVPAAGTLVNGLAGTISINAAMDPSAGGNPTLLRDGGA 360

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
               ++ N      Y  L+  Y D  +K   FDP AGI+   ++ +YA NSIGWL+  R 
Sbjct: 361 NGAAYVANTTGGPSYSSLLIAYGDRLDKPMTFDPAAGISATSSVSDYAANSIGWLQSMRQ 420

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +       + +    SE+ SN  GVN+ +E+S ++ +E +Y  S +++   D ML  LL
Sbjct: 421 QASTAADAKEALAQRSSEALSNATGVNVDQEMSLMLDLEHTYQASARMMKTVDDMLTALL 480

Query: 477 EGV 479
             V
Sbjct: 481 NAV 483


>gi|89067518|ref|ZP_01155031.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
 gi|89047087|gb|EAR53141.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
          Length = 478

 Score =  206 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 88/485 (18%), Positives = 171/485 (35%), Gaps = 14/485 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRD-TMTTISPENVTVVTQRSEN 59
           MS+      A +    AS++   +  NI NA  + Y RR   +++     V         
Sbjct: 1   MSIATSIGSALSGLEVASRRAEIVSGNIANALTEGYGRRSLAVSSTMLGGVRADGVIRHA 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                    +  + +             + +  +     + +  ++ +  +L S + + S
Sbjct: 61  DRGIAADRRSAEADMEANAAQSDILDRLQRLFGEPGEPGALSSRLTAVEQALVSAAADPS 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
            DI    V D    +    N +   +Q++R +AD+ I  ++++L R L  +  +N  I  
Sbjct: 121 SDIRLGHVADRLTALTGALNHAGDSLQEMRTEADRSIATQVASLNRQLERVETLNGEITS 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
             A   D    LD+R   +  IS ++ +  IVR N+ + + T  G TL +   R+I F  
Sbjct: 181 LRARGVDVSPLLDERQKAVDGISALVPVREIVRENDAIALMTLSGATLLDGKAREIGFSP 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEM 293
           +N  T         + G+ ++ +  +          G++ +   IRD+++P     LD  
Sbjct: 241 VNLVTADMTHASGALSGLTIAGDPVTGSTAYGKLGGGRLGSTFDIRDTILPDVSTGLDAF 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           AR L   F++       +   PGL    G            S           N   L  
Sbjct: 301 ARDLADRFADPATDPTLAAGAPGLLTDAGAALDPLDTPGLASRIALNPTVDPGNGGSLAR 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    I  + D+   +   D      +  +   +  + +  +  
Sbjct: 361 LRD---GLGETSSAPVGSSTQIERWLDALQDSRRTD---LGGSAASASGHMASLLADVGS 414

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R             +  +  +     GV+   EL  L+ +EQ+Y  + K++   + +L 
Sbjct: 415 RRYAIEQDLAFETARWEVLKSAELAN-GVDTDRELQELLLIEQAYAANAKVLQTVNSVLT 473

Query: 474 TLLEG 478
            LLE 
Sbjct: 474 RLLEI 478


>gi|325289234|ref|YP_004265415.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964635|gb|ADY55414.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 507

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 76/505 (15%), Positives = 170/505 (33%), Gaps = 36/505 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVT 51
           S  A    A +  + +  Q  +   NI NAD   YVR+  + T                 
Sbjct: 3   SSFAGIATATSGLSVSQSQLNTTGHNISNADTAGYVRQQVVQTDASYLKSGQYQVGTGTR 62

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           + T R       D++     S +   ++  S     E    D   +      + +   + 
Sbjct: 63  IETIRQIRSVFLDRMYRNEQSTLSYWQIRSSTVESIEAAMNDLADDGGVQTALDEFFAAW 122

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           E   K+        +++  A  +V+ FN    ++ +I+ + D++I   + ++     ++ 
Sbjct: 123 EEVGKDPESSSARASLLGYAGSLVELFNQLETQLDQIQTNLDEQIVSMVEDINTIAGQVA 182

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N  I     +   A+D+ D+ + LL  +S+ + I+    +N    V     + +  T 
Sbjct: 183 ALNKIIARCEVNGDRANDYRDEVNSLLDTLSQYVKINVTTDSNGMYNVSVGGVSLVNGTS 242

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF--QNQ 289
             +++          + +N  F      +S     +  G + +L++ R  V         
Sbjct: 243 VSELSC-------AANLANGSFHTVFWANSGLEPDLKSGMLLSLMEARGDVDGSAGSAGN 295

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS--N 347
              +         + D    +        IA+    L+  +     +   ++        
Sbjct: 296 GSPLESGAEEEDVDADAAVYDFTGESENLIAELRSGLNIMVSLLTRKINALHSGGEGLDG 355

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGI------------- 394
            + +     + +   + + N+   P L      + +     +  A               
Sbjct: 356 STGIDFFVKIDEDLPFEIGNIQVNPQLEETDLIAASSIGGGNDGAVAAEIAAFAETEYFH 415

Query: 395 --NTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLI 452
                +T+  Y     GWL     ++       + +      S  +   V++ EEL+ L+
Sbjct: 416 CDGLAMTISAYYSELAGWLGTEGEEAESAAANQETLVEQAESSRESLSAVSMDEELANLL 475

Query: 453 KVEQSYNISNKLIMFTDKMLQTLLE 477
           K + +YN S +++   D ML  L+E
Sbjct: 476 KYQHAYNASARVMSMIDGMLGRLIE 500


>gi|157373201|ref|YP_001471801.1| flagellar hook-associated protein FlgK [Shewanella sediminis
           HAW-EB3]
 gi|157315575|gb|ABV34673.1| flagellar hook-associated protein FlgK [Shewanella sediminis
           HAW-EB3]
          Length = 457

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 80/486 (16%), Positives = 160/486 (32%), Gaps = 36/486 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-------VTVV 53
           MS+    N   +  N +     +   N+ NA    Y R+  M +            V V 
Sbjct: 1   MSM---LNIGMSGLNASMAALNTTSNNVANAMVPGYSRQQVMMSSVGSGTYGGGAGVMVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +S +G  ++  S+    E +       N+ +  +  L  SL S
Sbjct: 58  GVRRISDQYEVAQLWNTTSDVGFSKVQASYYGQVEQIFG--SDGNNISQGLDLLFASLNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +E    + V++ A  +   FN+ +  V    +  + ++   +  +   L  +   
Sbjct: 116 AMEQPNEIAYRQGVLNEARALTHRFNSISEGVNAQLSQIEGQLGASVKEVNAQLQTIASF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+    + +     LD RD  +  ++ I+ I+ +  +N  + +  + G  L      
Sbjct: 176 NAEIQASGNNGNVPSSLLDARDAAVDDLAAIVDINVVEDSNGMLNISLAQGQPLLAGTTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +          I         ++ +    G + ALL  RD+ +      +DE+
Sbjct: 236 STLSVSPDPGNPGMSKISIQFGQSSFPVDESA---GGSLGALLDYRDNSLMDSIAFIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A  +   F+       +                       ++                  
Sbjct: 293 AMTIADEFNAVLAGGTDLNGNTPTQDLFTYDPNSPAGSLKLTSGFTAEMLAFGQ------ 346

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    +    +  NK+F F+    I  + T+ +   + IG L  
Sbjct: 347 ------------DGTPGDNSNLKELVELANKSFTFNS---IGADTTMGDAFASKIGELGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      S  +       +++T GVN+ EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAQVNADTSVKLQMEAQSQWASTSGVNMDEEAVNLIIYQQSYQANAKVISTADQLFQ 451

Query: 474 TLLEGV 479
           T+L  +
Sbjct: 452 TILNSI 457


>gi|90577350|ref|ZP_01233161.1| putative flagellar hook-associated protein [Vibrio angustum S14]
 gi|90440436|gb|EAS65616.1| putative flagellar hook-associated protein [Vibrio angustum S14]
          Length = 455

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/483 (14%), Positives = 155/483 (32%), Gaps = 37/483 (7%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT--------ISPENVTVVTQR 56
            + N      N           NI N +   + R+  M           +   V + + R
Sbjct: 2   NMINIGLTGLNANKTALDVTAHNIANVNTPGFSRQQAMMNALAGNDILSAGSGVEIASIR 61

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
             +     K   A +S             + E +   + +N   +  +  L  +L   + 
Sbjct: 62  RISDQFIVKQTWAATSQQAASNANLDNMTMLESLLGGEGFN--ISAGLDSLYSALNDATL 119

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
                   + +I+ A+ + + FNT +  +         +    I +    ++ +  +N  
Sbjct: 120 KPESTPNRQQIINEAKALSRRFNTLSESLHGQGKRIGDKATASIEHANSLMNNIADINHR 179

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           +    A+  +    +D+RDVL++++SE++ IS+  + +  + V  + G  L         
Sbjct: 180 VVETQATGGNPSQLIDERDVLIKQLSEVVEISSTQQPDGSLQVTLASGQPLILGSDAAQL 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
                      ++  I   G   +    +    G++ A        +   Q  LDEMA+ 
Sbjct: 240 KSTPIVNEPFIKNIDIDFSGQTFAV---TGELGGQLGAFDNYLKDTLKPTQQVLDEMAQN 296

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           L   F++      +     G  +     +                         L     
Sbjct: 297 LATEFNQVLATGFDLNGNRGQALFSFDPNSPAAS--------------------LDITAI 336

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
              +   +     G  D +    D   K      +     +VTL +   + +G       
Sbjct: 337 TPAELALSSDRTPGNSDTLQALIDLSTKPMAITGL----GSVTLNDAFASMVGKTAIETR 392

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +      ++ +F+  + +  N   VN  EE + L+    +Y  + K+I   +++  ++L
Sbjct: 393 QAAVDQKAAETLFSQANAARDNLSAVNSDEEAANLMTFTNAYQANMKVISTANELFDSVL 452

Query: 477 EGV 479
             +
Sbjct: 453 RLL 455


>gi|170748124|ref|YP_001754384.1| flagellar hook-associated protein FlgK [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654646|gb|ACB23701.1| flagellar hook-associated protein FlgK [Methylobacterium
           radiotolerans JCM 2831]
          Length = 485

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 134/486 (27%), Positives = 229/486 (47%), Gaps = 7/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L    N A+      + Q   + RN+  A + +Y R+      +   V VV  R+ + 
Sbjct: 1   MGLSVALNAARGSLQANAIQTDVVSRNVAGAYDPSYSRKIASVITTDGPVRVVINRASST 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
            +FD+++ + S   G Q +L    +L++ +  D     S    +  L  +L   +   ++
Sbjct: 61  ALFDRMMGSTSELAGYQAVLDGLTSLEDTV-GDTDAGRSIAAKVGALNIALGDAAGEPND 119

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L K  +  A ++ +  N ++ ++Q  R +AD EI   ++ +   L +    N A+   
Sbjct: 120 INLAKAAVAAARDLARALNQASSKIQATRLNADHEIRTSVTTINDLLRKFDAANSAVVLG 179

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D LD RD +L ++S+ IGISTIVR NNDM +Y  +G+ LFE  PR + FE  
Sbjct: 180 TVRGEDISDALDNRDKILAQLSQEIGISTIVRENNDMAIYADNGSPLFERGPRTVTFEST 239

Query: 241 NSYTVTSESNPIFIDGVVVSS-NQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            ++   +    +F+DGV V+       +  G+I   + +RD +   +Q QLD +A  LI 
Sbjct: 240 AAFVPGTAGKAVFVDGVQVTGHGSVMPLQTGRIVGQMTVRDDLTVTYQKQLDAIAGGLIA 299

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETI----CVNPQYRSNPSFLRDGG 355
           + +E D  +     + GL    G   L      G++ TI      +P+   NP  LRDGG
Sbjct: 300 ALAETDSTSLGGTPLAGLLTYPGGPALPAAGTVGLAGTIRVNPAADPEQGGNPFTLRDGG 359

Query: 356 -SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
            +   ++ +N  N A + + +     +      F P + +    TL   A  S  WLE  
Sbjct: 360 MNAGPQYAYNTTNAAAFAEHLRALRAALGAERTFLPDSELPHAATLQVAAETSASWLEAT 419

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
           R  +     +   + +  S + SN  GVN  +E++ ++++E+SY  S KLI   + MLQ+
Sbjct: 420 RQGASKQVDRESALLDSASTALSNATGVNRDDEVATMLQLEKSYAASAKLIATVNAMLQS 479

Query: 475 LLEGVK 480
           LL+ V+
Sbjct: 480 LLDAVR 485


>gi|145297460|ref|YP_001140301.1| lateral flagellar hook-associated protein [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850232|gb|ABO88553.1| lateral flagellar hook-associated protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 439

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 59/486 (12%), Positives = 149/486 (30%), Gaps = 56/486 (11%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------SPENVTV 52
           MS+    N   +  N A        +NI N +   Y R++ M           +   V V
Sbjct: 1   MSM---LNIGLSGLNAAQIALNVTAQNIANVNTIGYSRQEAMMGSLSGFGRLDNGMGVEV 57

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              R    +          S+ G       +    E +   +  N      +     SL 
Sbjct: 58  TGVRRITDDYLVSQHWRSRSSTGASYSFHQYINTTEQLLGSESMN--IAKGLDSFFASLS 115

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   +         ++ +A  +   F      +       D ++   +S +  +L ++  
Sbjct: 116 AALDSPETPAQRSQIVSSAGALANRFGQLNESMLTQEKQIDDQLNSTVSQVNSYLKQVAE 175

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I  + +   +     D R+ +++++S  + +    +++    +    G  L     
Sbjct: 176 LNTQISEQASKGVNTSVLEDSREQIVRELSTFMEVRVNRQSDGSFSLSLPQGQPLVLAGS 235

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                   +S +++              S     +  G +  +++ R +V+   +++L++
Sbjct: 236 SSTLSLAGDSLSLS----------FGPQSFDVPKLHGGSLAGVIEYRTTVLRPLRDELNQ 285

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           +A+ L   F+ K     +    PG  +        +                      + 
Sbjct: 286 IAKKLADDFNAKQSGGVDLHGNPGKSLFTYDPLNPSGTL------------------KIA 327

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DG +            +G    +       +  +               +     +G + 
Sbjct: 328 DGFTGDDLAFAKAGGGSGDNRNLQELLTIKDSQY---------------DAYSALLGRMA 372

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
                +         +   ++   S+  GVN  EE   ++   ++Y  + K+I  +D++ 
Sbjct: 373 VQSGQAKATMEADANMEKQLATKLSSVSGVNTDEEGVKIMAYTKAYQANAKVISTSDQLF 432

Query: 473 QTLLEG 478
            ++L  
Sbjct: 433 NSILNM 438


>gi|110632639|ref|YP_672847.1| flagellar hook-associated protein FlgK [Mesorhizobium sp. BNC1]
 gi|110283623|gb|ABG61682.1| flagellar hook-associated protein FlgK [Chelativorans sp. BNC1]
          Length = 487

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 245/487 (50%), Gaps = 7/487 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQ+   N S+Q + + RNI  A N +Y RR      +     +   R    
Sbjct: 1   MSLTSALNIAQSALFNTSRQTSIVSRNISEASNPDYARRAASLVSTNSGAQIGDIRRATD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
            +  +   A  S+   Q  L       ++        +SP   +SKLR++L++Y+   S 
Sbjct: 61  EVLFRQNLAAQSSWNGQSFLSRGLDRLQINVNGVDNASSPATALSKLREALQTYAATPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  ++ A ++V + N+    +Q  R D D+EI   + +L R L+E   VN  I   
Sbjct: 121 RTLAENAVEAARQMVLSLNSGTAAIQSFRTDIDQEISASVDDLNRLLAEFETVNTQIVSG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +  D  D LD+RD LL++IS  + +STI R NNDMV+ T+ G TLFETVPR ++F   
Sbjct: 181 TRTGRDVSDMLDRRDALLKQISAYLPVSTITRANNDMVLTTTGGVTLFETVPRPVSFTAN 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP--KGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           N+Y   +  N +++DGV +S   G       G + A LQ+RD +    Q QLDE+AR L+
Sbjct: 241 NAYAAGTLGNAVYVDGVPLSPGAGGGNTTASGSLAANLQLRDEIAVQMQRQLDEIARGLV 300

Query: 299 GSFSEKDPIAGNSE-----NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
             F+E DP    S+       PG         L + L   IS    ++ +   +P  LRD
Sbjct: 301 SVFAESDPSGTLSDAAGLFTWPGGPALPADGILVDGLAGRISVNPAMDSRAGGDPELLRD 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG+    +L N    A Y  L+N + +      +FDP  G+ ++ +L  ++  +IGWLE 
Sbjct: 361 GGANGTAYLHNTTGAASYSGLLNSFVERLETPQLFDPATGLGSSQSLFSFSVETIGWLEG 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  S       + + +H + + +NT GVN+ EE++ L+++E SY  S +L+   D+ML 
Sbjct: 421 LRQQSASGMAAKEALASHTATALANTTGVNIDEEMALLLELEHSYQASARLMSVIDEMLA 480

Query: 474 TLLEGVK 480
            L+E  +
Sbjct: 481 NLMEVAR 487


>gi|27381968|ref|NP_773497.1| flagellar hook-associated protein FlgK [Bradyrhizobium japonicum
           USDA 110]
 gi|27355138|dbj|BAC52122.1| flgK [Bradyrhizobium japonicum USDA 110]
          Length = 491

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 142/489 (29%), Positives = 243/489 (49%), Gaps = 10/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSE- 58
           MSL A  + A+     +  Q ++I RNI  A    Y R+  +        V V + +   
Sbjct: 1   MSLTAALDSARASLMASGIQSSTISRNIAGASAAGYSRKIAVLDNLPGAGVYVASIQRAA 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  +++ VL A SS+  Q  +    + +      D   + SPT  ++ L+ +L+ Y+   
Sbjct: 61  SSGLYNNVLTATSSSAKQGAIYDGLQKIASATVDDTELDQSPTAQLNALKKALQQYANAP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
               L +  I +A+++    N +   VQ +R  AD ++   ++N+ + L++   VN+A+ 
Sbjct: 121 DNTTLAQAAITSAKDMATALNQATNTVQSVREGADADMATSVANINQLLTQFDKVNNAVV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +  D  D+LDQRD ++ K+S+ +G+S  +R N D  +YT  G  LF+   R ++F 
Sbjct: 181 RGTIAGDDVTDYLDQRDSIVSKLSQEVGVSMSIRANGDAALYTDSGVVLFDKTARTVSFT 240

Query: 239 KMNSYTVTSESNPIFIDGVVVSS-NQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             N YT  +  N ++IDGV V+  N    +  GK+  L Q+RD     +Q+QLDE+AR L
Sbjct: 241 ATNIYTAGTTGNAVYIDGVPVTGANSVMPLKSGKLAGLAQLRDQDSVTYQSQLDEIARGL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG------ISETICVNPQYRSNPSFL 351
           I +F E D  A    +VPGLF   G   +             IS    V+P    NP+ L
Sbjct: 301 INTFRESDQTAAALPDVPGLFTYPGAPAIPASATVSVGLAGLISVAASVDPAQGGNPNLL 360

Query: 352 RDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDG  S +  + +N    AGY   +       + +  FD       + +L+++A +S  W
Sbjct: 361 RDGAISGNVAYRYNTAGNAGYSARLQQLIGGMDASQPFDVTTQGKPSGSLIDFASSSTSW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +E  R  +       + + +  + + SN  GVN+ +E+S +++VE++Y+ S+K+I   D+
Sbjct: 421 IENQRKTADSNVTYQKTLLDRSTAALSNVSGVNMDDEMSLMLQVERTYSASSKIISTVDQ 480

Query: 471 MLQTLLEGV 479
           MLQ+LL  V
Sbjct: 481 MLQSLLAAV 489


>gi|149189842|ref|ZP_01868122.1| putative flagellar hook-associated protein [Vibrio shilonii AK1]
 gi|148836328|gb|EDL53285.1| putative flagellar hook-associated protein [Vibrio shilonii AK1]
          Length = 457

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 74/481 (15%), Positives = 152/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGMNANRVALDVTAQNVANINTPGYSRQQAVMASLAGGKYDKTNPGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +SA        S  +  E M        S +  +  L  +L   +  
Sbjct: 65  VTDQYLVKQTWSTASAANYASGYTSAMSQLENMLG--ADGFSLSAGLDSLFAALNDATTK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                L + VI+ +E + + FNT    +     D   +    IS+    +S +  VN  I
Sbjct: 123 PESTPLRQQVINESEALARRFNTLTESLHNQHKDVHDQRNAAISHANSLMSNIAEVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RD L+ ++S+++ + T  + +  + V  + G  L       +  
Sbjct: 183 VEMQGTGGNPAQLMDTRDALVGELSKVMEVKTTDQADGSIQVSLASGQPLVMGSDASVIK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          I       ++        GK+ +L   +  V+  +Q+ +D+MAR L
Sbjct: 243 AIPDPSDPYLADIHIEFGNQTFAAKGD---LGGKLGSLHDYQVDVLKPYQDAIDDMARSL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
               +       +     G  +                               L      
Sbjct: 300 ADEVNAVLAAGQDLNGNAGKALFSYDPANPAAS--------------------LTITDIK 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           S +  ++     G  D +       NK            +++L +     +G        
Sbjct: 340 SDELAFSSDGNPGNSDNLKDLIAISNKPVTI----TGFGSLSLNDAFTAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +   Q +F     +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADSDYQAKQSMFEQSVAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|254973892|ref|ZP_05270364.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-66c26]
 gi|255091277|ref|ZP_05320755.1| putative flagellar hook-associated protein [Clostridium difficile
           CIP 107932]
 gi|255312936|ref|ZP_05354519.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-76w55]
 gi|255515695|ref|ZP_05383371.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-97b34]
 gi|255648789|ref|ZP_05395691.1| putative flagellar hook-associated protein [Clostridium difficile
           QCD-37x79]
 gi|260682009|ref|YP_003213294.1| putative flagellar hook-associated protein [Clostridium difficile
           CD196]
 gi|260685607|ref|YP_003216740.1| putative flagellar hook-associated protein [Clostridium difficile
           R20291]
 gi|260208172|emb|CBA60493.1| putative flagellar hook-associated protein [Clostridium difficile
           CD196]
 gi|260211623|emb|CBE01861.1| putative flagellar hook-associated protein [Clostridium difficile
           R20291]
          Length = 436

 Score =  204 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 80/495 (16%), Positives = 171/495 (34%), Gaps = 79/495 (15%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
            L ++ N A +  N   +   +I  NI N D   Y R+ T    +               
Sbjct: 3   GLFSILNTANSGMNAHQKAIQTISHNISNLDTDGYSRQRTEFATNSPMYMPSLSNSIARG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V        + +D    A +   G       +    E +  ++  +   +  I
Sbjct: 63  QLGTGVHVTDVTRARNSFYDYQFRAEAHKYGNTVSKYDYYNTIETI-INEPSDYGISAGI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                  ES +K+++ D     V++NA  +    + S +++ K++ D D  I  EI  + 
Sbjct: 122 DDFFKGWESLAKDINSDSKKSLVVENASNLATLISESYKKLNKLKGDIDDNINSEIKQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L  L  +N +I   + S    +D LD+RD +L  +S  + +      N          
Sbjct: 182 DMLKSLEDLNKSIDVISGSGSTPNDLLDERDRILDDLSFKLDLENSDVKNMLSD------ 235

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                                      + ++ +  +         G ++ L ++    + 
Sbjct: 236 -------------------------GKLELNELKNADGTWKTGVSGTLQGLFEMH-GKID 269

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            +++ L +++  L    ++    +              + D          + I VNP  
Sbjct: 270 TYKSDLKDVSDGLAKQINDVYNTSAGIT----------VTDFFITSNVDGEDIIKVNPAI 319

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           +SNP+ L+     + K                    +  K+   D         T+ ++ 
Sbjct: 320 KSNPNELKLTADEASKI-------------------AKLKDEKIDIGVAGGKVSTISDHY 360

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           +     +  +    +   +  + + N+I  S  +  GV+L EE++ LIK+++SY  S K+
Sbjct: 361 KAFAESVGLDSQKVNQDEVNQRKIINNIDNSRMSVSGVSLDEEMTELIKIQRSYQASAKV 420

Query: 465 IMFTDKMLQTLLEGV 479
           +    ++L  ++ G+
Sbjct: 421 MSTAVQLLDVVINGI 435


>gi|319781664|ref|YP_004141140.1| flagellar hook-associated protein FlgK [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167552|gb|ADV11090.1| flagellar hook-associated protein FlgK [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 484

 Score =  204 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 155/483 (32%), Positives = 243/483 (50%), Gaps = 4/483 (0%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    + AQ+   N ++Q + + RN+ +A N +Y RR  + T +      V  +    
Sbjct: 1   MSLSTALSIAQSALMNTARQTSVVSRNVADASNPDYSRRQAVVTSTAPGARSVDIQRAAN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
            +  +   A  SA   Q  L +      +        +SP+  I+ L+ +L+ Y+ + S 
Sbjct: 61  ELLFRQNLAALSAWSGQNALYNGMDQLGVAVNGVDNASSPSTAIANLQQALQLYATSPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +VID A++V+++ N  ++ VQ  R   D +I   + +L   L +    N A+   
Sbjct: 121 QNLGASVIDAAKQVMRSLNEGSKAVQDFRTQTDGQIATAVDDLNSLLGQFQDANTAVMSG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T S  D  D LDQRD LL+KIS  + +ST  R +NDMV+ T DGTTLFET+PR + F   
Sbjct: 181 TRSGTDVSDALDQRDALLKKISNYVPVSTFTRGDNDMVITTGDGTTLFETIPRTVTFAAS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             YT  +  N ++ID V +S+   G+    G +  LLQ+RD V    Q+QLDE AR LI 
Sbjct: 241 AGYTAGAAGNAVYIDNVPISAGAGGNTSASGTLAGLLQLRDGVASTMQSQLDETARGLIT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLD---NKLCQGISETICVNPQYRSNPSFLRDGGS 356
           +F+E  P   N+  +     A  +       N L   IS    ++P    NP  LRDGG+
Sbjct: 301 AFAETAPSMANAAGLFTWSGAPAVPAAGTLVNGLAASISVNAAMDPSTGGNPMLLRDGGA 360

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
               ++ N    A Y  L+  Y D  ++   FDP AG++   ++ +YA +SIGW E  R 
Sbjct: 361 NGAAYVANTGGGASYSTLLVAYGDRLDQPMTFDPAAGVSATSSVSDYAASSIGWFEGVRQ 420

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +       + + +  +E+ SN  GVN+ +E+S L+ +E +Y  S +++   D M+  LL
Sbjct: 421 QASTASDAKEALASRSAEALSNATGVNVDQEMSLLLDLEHTYQASARMMKTVDDMMTALL 480

Query: 477 EGV 479
             V
Sbjct: 481 NAV 483


>gi|315122285|ref|YP_004062774.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495687|gb|ADR52286.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 481

 Score =  204 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 334/481 (69%), Positives = 397/481 (82%), Gaps = 1/481 (0%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL AVFNKAQNI +NAS+QF +IV+NIEN+ NKNYVR+D +T  + +    V QRSEN+
Sbjct: 1   MSLSAVFNKAQNIFSNASEQFFTIVKNIENSGNKNYVRQDIITVNTGDMTVAVKQRSENQ 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           NMF+K+L A SSAIGQQRLL+SFE+LK++M A++ YNNSP+HY++KLRDSL  YS N S 
Sbjct: 61  NMFEKLLDAKSSAIGQQRLLESFESLKDIMGAENKYNNSPSHYMAKLRDSLSVYSNNPST 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           DI GK +I +A  +V N NTS++E+QKIRA ADKEI++E+S LR FLSELTVVND IKFK
Sbjct: 121 DIFGKQIISDANALVYNLNTSSKEIQKIRAGADKEIDIEVSKLRGFLSELTVVNDQIKFK 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +KHD H+ LD+RD LLQ ISE IGISTI+RNNND+++YTSDGTTLFETVPR+INFEKM
Sbjct: 181 TVAKHDTHELLDKRDALLQNISEEIGISTIIRNNNDIIIYTSDGTTLFETVPRNINFEKM 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + Y+ TSES  + IDGV VS  +Q    PKG+IKALL IRD+V+P+FQNQLDE++R LI 
Sbjct: 241 DLYSATSESKSVVIDGVKVSIPDQTHTAPKGRIKALLHIRDNVIPMFQNQLDEISRSLIS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            FSEKDP+AG S++V GLFIADG+KD  NKL +G+SE I VNPQY+SNP FLRDGGSVSK
Sbjct: 301 GFSEKDPVAGRSQDVLGLFIADGLKDPGNKLYKGMSEIIRVNPQYQSNPFFLRDGGSVSK 360

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             LWNVK  A Y  LINHYCDSFN  F FD   GI TNV+LLEYA+NSIGWLEKNRS SH
Sbjct: 361 NHLWNVKGFAEYSGLINHYCDSFNAMFSFDSATGIGTNVSLLEYAKNSIGWLEKNRSTSH 420

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           D  MK+QVVFNHISESYSNT GVNLQ+ELSFLIKVEQSYNISNKL+M  ++ML TLLEG+
Sbjct: 421 DSRMKNQVVFNHISESYSNTTGVNLQDELSFLIKVEQSYNISNKLMMSINRMLNTLLEGI 480

Query: 480 K 480
           K
Sbjct: 481 K 481


>gi|83595981|gb|ABC25341.1| flagellar hook associated protein [uncultured marine bacterium
           Ant24C4]
          Length = 478

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 85/485 (17%), Positives = 176/485 (36%), Gaps = 14/485 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           M++ + FN A    + +++    +  N+ N+  + Y RR+   +      V +       
Sbjct: 1   MTISSAFNNATGGLSASARMAEVVSSNLSNSLTEGYGRREVNLSSGLLGGVVLDGISRVV 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                +      + +G ++      +  E         +     ++ L  SL S S   S
Sbjct: 61  DPGILRDRRTADADVGSKQRGAQVLSQLEQAFGPVGDPSGVVGRLAALEQSLISASSRPS 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
            D     V    E V    ++    +Q  R DADK I  ++  L   L ++  +N  +  
Sbjct: 121 SDQRLNIVFSGLEGVTTALHSDDDAIQIQRQDADKAITADVKTLNSTLLQIEKLNADVSR 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
              S +D     D R   + +++ I+ ++ I R    + +YT  G  L +  P    F  
Sbjct: 181 LIGSGNDPSPVFDARQNAIDRLTSIVPLTEINRGRGQVALYTRSGVALIDGAPATFGFAH 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQ------GSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
             +           + GV ++            +  G ++A   +RD  +   Q  LD++
Sbjct: 241 TGTIVAEMTLVLGALSGVTLNGEPLDLANGYGRMKGGSLEAAFTLRDQTLVGLQANLDKV 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A  L+  F         +   PGLF+       D     G+S  I VN     +P     
Sbjct: 301 AADLVKRFERPVTDPTLTLGDPGLFLD-HNGAFDPLNIDGLSSRITVNTSV--DPREGGA 357

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
              +            G    +  +  + +       ++      + +E+  + +  + +
Sbjct: 358 LSRLRHGVNATASGPTGDNSQLQRWLSALDDP---IALSVGGMARSAIEHGSDQVATVGR 414

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R ++ +        ++ +  +  +  GV+  +EL  L+++EQSY  + ++I   D M+ 
Sbjct: 415 LRLNAEESLGFEIARYDSLKSAELSG-GVDSDQELQRLLRIEQSYAANARVIQTLDAMMS 473

Query: 474 TLLEG 478
            LL+ 
Sbjct: 474 RLLDI 478


>gi|115523194|ref|YP_780105.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
 gi|115517141|gb|ABJ05125.1| flagellar hook-associated protein FlgK [Rhodopseudomonas palustris
           BisA53]
          Length = 490

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 153/490 (31%), Positives = 251/490 (51%), Gaps = 10/490 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           M+L    N A++       Q +++ RNI  AD   Y R++ +        + V   +   
Sbjct: 1   MTLTVALNSARSSLMATGTQASAVSRNIAGADQDGYSRKNALLATMPGSGIYVSGIQRAT 60

Query: 60  KN-MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
              +F+ VL A S++  Q  +    + +      D   + SPT  ++KL+ +L+ Y+   
Sbjct: 61  SAGLFNNVLKAVSTSAQQDTIFNGLQKIAAATVDDPELDQSPTAQLAKLKTALQQYATAP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
               L +  +  A+ V  + N + + VQ +RADAD ++   ++ + + L++   VN  I 
Sbjct: 121 DNVTLAQAAVTAAKGVAASLNDATKTVQAVRADADSDLSTSVTTINQLLAQFETVNTTIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +K D  D+LD RD +L K+S+ +G++   R NNDMVVYT  G TLFE   R + F 
Sbjct: 181 KGTMAKADVTDYLDLRDSILSKLSQEVGVTVATRANNDMVVYTDSGVTLFERSARSVTFV 240

Query: 239 KMNSYTVTSESNPIFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             N Y+  +  N ++IDGV V  ++    V  GKI  L  +RD     +QNQLDE+AR L
Sbjct: 241 PTNGYSAATVGNAVYIDGVPVIGASAVMPVHSGKIAGLAALRDDATVTYQNQLDEIARGL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ------GISETICVNPQYRSNPSFL 351
           I +F+E D  A +  +V GLF   G   +             I+ +  V+     NPS L
Sbjct: 301 IETFAESDQTASSLPDVAGLFTYPGAPAIPASGTISAGLAGTIAVSASVDQSVGGNPSLL 360

Query: 352 RDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDGG S    +++N    AG+ + +    D    +  FDP A    +  L+++A +S+ W
Sbjct: 361 RDGGISGGAAYVYNTTGAAGFSNRLQQLVDGVATSRPFDPAALAKPDANLIDFAGSSVSW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           LE  R  + +    SQ +    +E+ SN  GVN+++E+SF+++VE++++ S+KLI   D 
Sbjct: 421 LESQRKTASEQSTYSQTLLERSAEALSNVNGVNMEDEMSFMLQVERTFSASSKLIATVDA 480

Query: 471 MLQTLLEGVK 480
           ML+ LL  V+
Sbjct: 481 MLKELLAAVR 490


>gi|304321121|ref|YP_003854764.1| flagellar hook-associated protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300023|gb|ADM09622.1| flagellar hook-associated protein [Parvularcula bermudensis
           HTCC2503]
          Length = 481

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 92/489 (18%), Positives = 184/489 (37%), Gaps = 20/489 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----ISPENVTVVTQ 55
           MS  +  + A +    AS +  +   NI NA  + Y RRD + +      +   V+VV  
Sbjct: 1   MSFSSALSIANSGLAAASIRAQTTASNIANATVEGYSRRDVVLSERVVGSTGIGVSVVGT 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                 +         +A                +  +    N      ++   SL   +
Sbjct: 61  ERVTSPVLTSTRIRLEAADSFATQTADTAKSLTQIVGEPGAQNGLFGAYNRFEASLRDAA 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                 I    V D+A+ +++ F  ++++   +R DAD+EI   ++ +   L  L  +N 
Sbjct: 121 ATPESSIFQAEVADSAQNLIRVFANASQDANDLRRDADQEIGRLVNEVNEKLERLEDING 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
                      + + LD+R  L+ +I+EII ++   R     ++    G  L +T  R+I
Sbjct: 181 L-----PEARISPEILDERQKLVDEINEIIPVTAQNRGGQLKLIS-EGGQFLLDTTAREI 234

Query: 236 NFEKMN----SYTVTSESNPIFIDGVVVSSNQGSAV--PKGKIKALLQIRDSVVPIFQNQ 289
           +F        +  + +  + + ++GV ++    +A     G+I AL + RD  VP  Q++
Sbjct: 235 SFSTTGAIGRTAVLGAPLSGLTVNGVDITPTGSAAHKSSGGRIGALFEARDVTVPGLQDK 294

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           LD +A  L+  F+       +              +        +     +      +P 
Sbjct: 295 LDGLAFDLVSRFAG---DTVDPTIASTDAGLFTDGNTTAPTASYVGIAEALELNAAVDPD 351

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
              +   +           +G  D +N   D+F       P  GIN N + ++       
Sbjct: 352 EGGELYRIQAGIGATAPAPSGNGDQLNRLIDAFGAERAAPPALGINGNASAVDLVAEVNA 411

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            + +  +++ D  + +        E     +GV+   EL  L+ +EQ+Y  + ++I   D
Sbjct: 412 AVTEADAEAQDDALYASTRAQLAREEEQAIIGVDTDRELQQLLLIEQAYGANARVIQTID 471

Query: 470 KMLQTLLEG 478
           +ML  L+  
Sbjct: 472 EMLDILMRL 480


>gi|30248328|ref|NP_840398.1| flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
 gi|30138214|emb|CAD84222.1| Flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
          Length = 466

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 74/485 (15%), Positives = 165/485 (34%), Gaps = 35/485 (7%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVV 53
             + N   +    A     +   NI NA    Y R+  + + S             V + 
Sbjct: 3   NGIMNVGVSGLRAAQVALLTTSHNISNATTPGYNRQQAIQSASTPLANSDGFIGRGVQIT 62

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
           T +               S   Q     +     + + AD       T  +    ++++ 
Sbjct: 63  TVQRIYNQHLVSQSLQAQSQSSQLDSHYNEIKQIDNLLADTTS--GLTPALHNFFNAVQD 120

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
            + N +     + ++ NAE +   F    + + ++R   + +I   ++ +     ++  +
Sbjct: 121 VASNPASISSRQAMLSNAEALTARFQQMDQRLSEMREGVNSQITGSVTEINSLAQQIAGL 180

Query: 174 NDAI--KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           N  I     +A+   A+D LDQRD L++ +S II +  + +NN    V+  +G +L    
Sbjct: 181 NMNIQAVESSANGQPANDLLDQRDALVRDLSRIINVDVVRQNNGHYNVFIGNGQSLVVGS 240

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                    +S         +   G  +       +  G +  LL  R   +   QN  D
Sbjct: 241 SAMTLKAVPSSSDPQRLVVAMDQQGGEI-VLPEHQLQGGSLGGLLAFRSETLDSVQNSFD 299

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           ++A  +  +F+ +  +  + ++V G    +G                       S+PS  
Sbjct: 300 QLAWGIADTFNTQHQVGFDLQSVAGSNFFEGTDP--------------------SDPSQA 339

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
                V+      +         + +  ++     +           +        +  +
Sbjct: 340 ARNIRVAISDPAKIAAADNNDGGVTNNINALKLAGLQTENTLQGGTASYQSAYARLVSQV 399

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
                +        + + N   ++  +  GVNL+EE + L++ +Q +  S+K+I   + +
Sbjct: 400 GNKTRELEVTSKAQESMLNQTDQALQSLSGVNLEEEAANLLRYQQMFQASSKVIEIGNSL 459

Query: 472 LQTLL 476
             +LL
Sbjct: 460 FDSLL 464


>gi|194015655|ref|ZP_03054271.1| flagellar hook-associated protein FlgK [Bacillus pumilus ATCC 7061]
 gi|194013059|gb|EDW22625.1| flagellar hook-associated protein FlgK [Bacillus pumilus ATCC 7061]
          Length = 506

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 71/500 (14%), Positives = 153/500 (30%), Gaps = 23/500 (4%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+               N+ NA+   Y R+                      
Sbjct: 3   STFMGLETAKRGITAQRAGLYVTSNNVSNANTDGYSRQRVTFKADNPYPVISVYDGKTYG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V T      +  D     H++ +          +  E +  +D  +       
Sbjct: 63  QMGTGVQVGTVERIRDSFLDLQFRDHNNNLSYYSTKSDALSQMEGVM-NDLTDEGLNRAF 121

Query: 105 SKLRDSLESYS--KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
             L  SL+  S  KN         V  +A+ +V  F      +  I+ +   E++    N
Sbjct: 122 DNLWKSLQVLSETKNADTASARTVVKTSAQALVDQFRLLNSSLTTIQKNLKTELDSTAKN 181

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           +   LS++  VN  I     + +  +D  D RD L+ ++S ++ I      +    +  +
Sbjct: 182 VNTILSQIDEVNKQIAAVEPNGYLPNDLYDTRDALVDQLSSLVDIKVSYNPSGGNALKIA 241

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
           +GT   + +  +          +T+E + + I     +    S        A  Q++ + 
Sbjct: 242 EGTVNIDIIGANGQSAGTILNGITNEKSELQISYDNTTGLVNSLQFGTTTIAADQLQVNG 301

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP 342
                 +               D +A   E                    G S     + 
Sbjct: 302 KVKALVEAYGYMSNGAEKGMYPDMLAELDEVAQVFMDTFNDVHKQGYTLNGTSGQDFFDI 361

Query: 343 QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGI---NTNVT 399
           +  ++ +            +    +             S            +       T
Sbjct: 362 ENNNDLNKGLAARIKVSDVILASTDNIAASLNQTKGDGSNATKLAGIQDLKVPIGGNTTT 421

Query: 400 LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYN 459
           + +Y +N I  +      +  L   S  + N  +E   +T  V++ EE++ +I+ + +YN
Sbjct: 422 IQDYYQNVIAEMGIQGKKNITLESSSAALVNSANERRMSTSAVSIDEEMTNMIQFQHAYN 481

Query: 460 ISNKLIMFTDKMLQTLLEGV 479
            + +++   D++L  ++ G+
Sbjct: 482 AAARVVTLQDEILDKVINGM 501


>gi|167464316|ref|ZP_02329405.1| flagellar hook-associated protein FlgK [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 519

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 77/514 (14%), Positives = 166/514 (32%), Gaps = 40/514 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S    F  A+     +      I  NI N     Y R+                      
Sbjct: 3   SSFFGFETAKRSMLASQNVLNIIGHNISNQHIPGYSRQRVNLNASMPIEYPGIGHTTIPG 62

Query: 46  -SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V + +         D+        +G   + +      E +   +  +      +
Sbjct: 63  QMGTGVDMHSITRIRDRFLDEQFRNEYKNLGNWEIQKDTLDKLEGIF-PEPSDTGLRKVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               DS   +SK+  ++   K +  NA  + +  N ++++++ I    DK + ++I ++ 
Sbjct: 122 ENFWDSWAEFSKDSDKNTGRKLIRQNAIALTEAINQASKQIKDISQGLDKSLNMKIEDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNN----NDMVVY 220
             L  ++ +N+ I         A+D  D+RD +  ++S+++ I+          +   V 
Sbjct: 182 SILKTISTLNNEITRVEKMGDHANDLRDERDRMTDELSKMMNITVSEGPEGYNISMGKVN 241

Query: 221 TSDGTTLFETVPRDI----------------NFEKMNSYTVTSESNPIFIDGVVVSSNQG 264
              GT +       I                     ++Y    +     I   + +    
Sbjct: 242 LLSGTEVNPVTKESIEESFKSGDLSSGELAGLITSRDTYVHDYKKQLDDIANTIANGEIT 301

Query: 265 SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK 324
             +PKG +     + D V     N+       +           G     P         
Sbjct: 302 ITIPKGSVLPEGTVLDGVTYTGANRTLTEDLTVTVKGLNGLHQLGYINGNPPEAGGPFFT 361

Query: 325 DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNK 384
             D       +E IC+NP   ++P+ +      ++    + K ++G   L        + 
Sbjct: 362 TKDGSDVI-TAENICLNPDIINDPNKIAS-SMATEGTGADEKLISGNNTLAKLMAQLKDT 419

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
            F F       TN T+ ++  + +G L     ++   +     +        ++  GV  
Sbjct: 420 KFTFSGAGRGITNSTINDFYGSLVGQLGVQSKEATRQYENEGKLVVQADTRRTSVSGVVE 479

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            EE+  ++K   S+N + + +   D++L  L+ G
Sbjct: 480 LEEMMEMVKYNHSFNAAARFMTTYDEILNKLING 513


>gi|74101664|gb|AAZ99754.1| FlgKL [Aeromonas hydrophila]
          Length = 437

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 57/480 (11%), Positives = 146/480 (30%), Gaps = 53/480 (11%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------SPENVTVVTQRSE 58
            N   +  N A        +NI N +   Y R++ M           +   V V   R  
Sbjct: 2   LNIGFSGLNAAQIALNVTAQNIANVNTIGYSRQEAMMGSLSGFGRLDNGMGVEVTGVRRI 61

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
             +          S+ G       +    E +   +  N      +     SL +   + 
Sbjct: 62  TDDYLVSQHWRSRSSTGASYSFHQYINTTEQLLGSESMN--IAKGLDSFFASLSAALDSP 119

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
                   ++ +A  +   F      +       D ++   +S +  +L ++  +N  I 
Sbjct: 120 ETPAQRSQIVSSAGALANRFGQLNESMLTQEKQIDDQLNSTVSQVNSYLKQVAELNTQIS 179

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
            + +   +     D R+ +++++S  + +    +++    +    G  L           
Sbjct: 180 EQASKGVNTSVLEDSREQIVRELSTFMEVRVNRQSDGSFSLSLPQGQPLVLAGSSSTLSL 239

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +S +++              S     +  G +  +++ R +V+   +++L+++A+ L 
Sbjct: 240 AGDSLSLS----------FGPQSFDVPKLHGGSLAGVIEYRTTVLRPLRDELNQIAKKLA 289

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F+ K     +    PG  +        +                      + DG +  
Sbjct: 290 DDFNAKQSGGVDLHGNPGKSLFTYDPLNPSGTL------------------KIADGFTGD 331

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                     +G    +       +  +               +     +G +      +
Sbjct: 332 DLAFAKAGGGSGDNRNLQELLTIKDSQY---------------DAYSALLGRMAVQSGQA 376

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                    +   ++   S+  GVN  EE   ++   ++Y  + K+I  +D++  ++L  
Sbjct: 377 KATMEADANMEKQLATKLSSVSGVNTDEEGVKIMAYTKAYQANAKVISTSDQLFNSILNM 436


>gi|319898657|ref|YP_004158750.1| flagellar hook-associated protein FlgK [Bartonella clarridgeiae 73]
 gi|319402621|emb|CBI76166.1| Flagellar hook-associated protein FlgK [Bartonella clarridgeiae 73]
          Length = 456

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 112/481 (23%), Positives = 217/481 (45%), Gaps = 26/481 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N A+N     + +  ++ RNI  A + NY RR +     P     V  R +  
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNIVRAGDPNYTRRTSYLESGPGGAVHVVVRRDGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +S       L +       +   D ++NSP+  + + + +L+ Y+ +  +
Sbjct: 61  IHLLNNYLVKASEAAAAGSLSNGLNRLSDIYGADKFSNSPSKLLGEFQKALQLYANDPQQ 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
              G   +D A ++ +  NT + E++K+  D + +I+  +  +   L +   ++  +  +
Sbjct: 121 RSNGDAAVDRARDLAKGLNTGSYEIEKLYNDVNSDIQDSVDYINDLLQKFHELDQLVVRE 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
             +  D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+  
Sbjct: 181 RNANRDDSVYMDQRDAILKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKMPRTVSFQFS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            S         +FIDGV +  +   +    G +  LL++RD +VP +Q QLDE+A  L+ 
Sbjct: 241 ASLPPGISGKQVFIDGVPLGHSSFLNPNGGGNLGGLLKLRDDIVPQYQKQLDEIANALMH 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F     +  + +   G                                   R   +   
Sbjct: 301 MFPGPPSLFLDGDQPSGQIGPLEGLAG-------------------------RIQLNPIF 335

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                      + D +    D+FN    F    G++ + ++ ++++NS+GWLE  RS++ 
Sbjct: 336 DSKTEGGGPEHFGDNLQALVDAFNGKQQFGTGTGLDPDQSIKDFSKNSVGWLEGLRSNAD 395

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  V
Sbjct: 396 KEAKYQGTMFLHAAEALSNATGVNADDELALMLQLEQTYGATSRIISTVGKMLDDLLAAV 455

Query: 480 K 480
           +
Sbjct: 456 R 456


>gi|323341352|ref|ZP_08081596.1| hypothetical protein HMPREF0542_12027 [Lactobacillus ruminis ATCC
           25644]
 gi|323091229|gb|EFZ33857.1| hypothetical protein HMPREF0542_12027 [Lactobacillus ruminis ATCC
           25644]
          Length = 514

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 76/512 (14%), Positives = 161/512 (31%), Gaps = 37/512 (7%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----------SPE 48
           MS L      A +          +   NI N +   Y R+    T               
Sbjct: 1   MSGLFGTLGTATSGITANQVALQTTAHNIANTNTDGYSRQRVHMTTKPPYVIAGTGTIGT 60

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V V        +     +   +S               E +   +  ++     ++ L 
Sbjct: 61  GVNVTGVERVVDDFVRSQIREANSKYTYNTQKSDTLGQLEDIL-HEPSDDGVIKSLNTLT 119

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           DS +  ++N         V++NA     + +  A ++ ++  D+   ++  + +    + 
Sbjct: 120 DSWQKLAENPELGTSKTLVVENANSFADSIHQMATQINQLHKDSISNLQKSVLDFNEKID 179

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N  +   T+     +D LDQRD LL+ IS ++ I+T         +   DG T+ 
Sbjct: 180 QLADINKKVFTLTSRGETPNDLLDQRDTLLKDISGLVNINTEFDEYGRTTLSV-DGQTIL 238

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVV---------------------SSNQGSAV 267
           +      N   +   T  + +  +   G                         +   +  
Sbjct: 239 DFKNETHNTLSVVVGTDANGNALVSDRGDSSKANVALGRQAEVGTVMLTKKDDAGNTAYS 298

Query: 268 PKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD 327
                +  +             +DE+   +       + +    +N    F   G     
Sbjct: 299 EIKTSEGDMGGYQESAKEILEHMDELNDFIAKIGKATNMVMTGGQNKLDGFFTLGNDPSR 358

Query: 328 NKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFI 387
             L   +++ I  +P        L   GS          + A          D+    + 
Sbjct: 359 YALDFKVNDAIAKDPSKIPAGKALDGTGSAGDGSRALAVSWAMKTKFKTPVRDADLDAYD 418

Query: 388 FDPVAGI--NTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQ 445
              +         T  E   N +     ++  + ++    +VV N++     +  GVN+ 
Sbjct: 419 ESTMKFNESQDGQTFAETFNNIVTKNGISKQKADNMAAAQKVVLNNLENKNESMSGVNIN 478

Query: 446 EELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           EE+S +IK +Q +  + +++    +ML TL+ 
Sbjct: 479 EEMSDVIKFQQGFQANTRVLSVIAEMLDTLVN 510


>gi|89056665|ref|YP_512116.1| flagellar hook-associated protein FlgK [Jannaschia sp. CCS1]
 gi|88866214|gb|ABD57091.1| flagellar hook-associated protein FlgK putative [Jannaschia sp.
           CCS1]
          Length = 487

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 74/487 (15%), Positives = 156/487 (32%), Gaps = 15/487 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MS+ +  + A +    +++    +  N+ NA  + Y  R               V +V  
Sbjct: 1   MSISSTLSSALSGLTASARAADIVSSNLANAMTEGYAVRRLDLAARQTGNDGAGVRIVGV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
             +   +        ++ +G  +    F    E M        S +  ++     L + +
Sbjct: 61  TRQEDTILIGQRRLATADLGANQANADFMTRLEAMLGAPDDPGSLSARLADFEGKLIAAA 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                       +  A  +    N  +  +Q  R  AD  I + +  +   L  L  +N 
Sbjct: 121 NAPWNTTNLTGAVQGASAIADTLNELSSGIQTERKRADASIGIAVDQINGALESLAELNA 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     S  D    +D ++ L+ +++  + + T   NN  + VY+ DG  L      ++
Sbjct: 181 RILSVGYSGGDTAALVDAQNQLVDQVAPYVPLQTRRDNNGLLNVYSDDGHVLVNYRAAEL 240

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSS------NQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            F    +           + G+ +         +  A   G+++AL  +RDS  P  Q +
Sbjct: 241 GFVAKPTMDPYQSIGNGTLSGLTLDGRALRMDGEYPAFAGGQLRALFDVRDSQAPEAQTR 300

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           LD +A  L       D    +     G         +       +     +       P+
Sbjct: 301 LDGIALDLAER---FDAAGLDPSIAAGSPSLFTDAGILVDGSNELGLASRIRVNAAVVPN 357

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                  +       V+   G    +    +  +        A      ++ E    ++ 
Sbjct: 358 EGGAVWRLRDGLGAAVEGPTGNATFLTAQIERLSTTQTTTSTAFSGAQRSMSELISENLS 417

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +   R  +      +      +  +     GV+   EL  L+++EQ Y  + ++I    
Sbjct: 418 IVGLGRVTAETNLSSASAQNTALKTAELAG-GVDSDAELQRLLQIEQMYAANARVINVAG 476

Query: 470 KMLQTLL 476
           +M+  LL
Sbjct: 477 QMMDELL 483


>gi|157693942|ref|YP_001488404.1| flagellar hook-associated protein FlgK [Bacillus pumilus SAFR-032]
 gi|157682700|gb|ABV63844.1| flagellar hook-associated protein 1 [Bacillus pumilus SAFR-032]
          Length = 506

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 75/500 (15%), Positives = 156/500 (31%), Gaps = 23/500 (4%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+               N+ NA+   Y R+                      
Sbjct: 3   STFMGLETAKRGITAQRAGLYVTSNNVSNANTDGYSRQRVTFKAENPYPVISVYDGKTYG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V T      +  D     H++ +          +  E +  +D  +       
Sbjct: 63  QMGTGVQVGTVERIRDSFLDLQFRDHNNNLSYYSAKSDALSQMEGVM-NDLTDEGLNRAF 121

Query: 105 SKLRDSLESYS--KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
             L  SL+  S  KN         V  +A+ +V  F      +  I+ +   E++    N
Sbjct: 122 DNLWKSLQVLSETKNADTASARTVVKTSAQALVDQFRLLNSSLTTIQKNLKTELDSTAKN 181

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           +   LS++  VN  I     + +  +D  D RD L+ ++S  + I      +    +  +
Sbjct: 182 VNTILSQIDEVNKQIAAVEPNGYLPNDLYDTRDALVDQLSSFVDIKVSYNPSGGNALKIA 241

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDS 281
           +GT   + +  +          +T+E + + I     +    S       I A     + 
Sbjct: 242 EGTVNIDIIGANGQSAGTILNGITNEKSELQISYDNTTGLVNSLQFGTTTIAADQLQVNG 301

Query: 282 VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN 341
            V         M+         +     +      +   + +      L     +     
Sbjct: 302 KVKALVEAYGYMSNGTEKGMYPEMLAELDEVAQVFMDTFNDVHKQGYTLNGTSGQDFFDI 361

Query: 342 PQYRSNPSFLRDGGSVSKKFLWNVKNLAG--YPDLINHYCDSFNKNFIFDPVAGINTNVT 399
                    L     VS   L +  N+A        +    +   N     +       T
Sbjct: 362 ENNNELNKGLAARIKVSDVILASTDNIAASLNQTQGDGSNATKLANIQDLKLPIGGNTTT 421

Query: 400 LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYN 459
           + +Y +N I  +      +  L   S  + N  +E   +T  V++ EE++ +I+ + +YN
Sbjct: 422 IQDYYQNVIAEMGIQGKKNMTLESSSAALVNSANERRMSTSAVSIDEEMTNMIQFQHAYN 481

Query: 460 ISNKLIMFTDKMLQTLLEGV 479
            + +++   D++L  ++ G+
Sbjct: 482 AAARVVTLQDEILDKVINGM 501


>gi|328545490|ref|YP_004305599.1| flagellar hook-associated protein K [polymorphum gilvum
           SL003B-26A1]
 gi|326415231|gb|ADZ72294.1| Flagellar hook-associated protein K [Polymorphum gilvum
           SL003B-26A1]
          Length = 496

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 147/496 (29%), Positives = 239/496 (48%), Gaps = 16/496 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP------ENVTVVT 54
           MSL      AQ+       + A++ RNI  A +  Y R+  + +           V V  
Sbjct: 1   MSLSVALQVAQSALAARQTETATVSRNIAGAQDPGYTRKSVVLSTVVSASGQTGGVRVDG 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
                 +     L   +S    Q+ +           +D     SP   + KL  S+++Y
Sbjct: 61  IARTTDSALYNSLVRATSVATSQQAIVEGLDKLNQTVSDTELELSPAAALGKLEISIQNY 120

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +    IL +T++D A+++    N     VQ +RA+AD ++   +  +   LS+L  +N
Sbjct: 121 ASDPGNAILAQTMLDAAKDMATTLNEYTALVQNVRAEADADMASSVKTINNLLSQLESLN 180

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I   T    D  D LD RD +L  +SE IGIST+ R++  +VVYT  G TLFET  R 
Sbjct: 181 TIIVKGTQGGADVSDALDARDRVLLSLSEEIGISTLTRSDGGVVVYTDGGVTLFETTART 240

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
           ++F   N+Y+  +  N ++IDGV V+ +N    +  G++  L ++RD +   +Q+QLDE+
Sbjct: 241 VSFTPTNTYSAATVGNAVYIDGVPVTGANAIMPISSGRLHGLSELRDDIAVTYQSQLDEI 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC------QGISETICVNPQYRSN 347
           AR LI +F+E D   G   +  GLF   G   +             I  +  V+P    N
Sbjct: 301 ARGLIEAFAESDQSGGGGPDQAGLFTYAGAPAVPAASTLVAGLAGDIRISASVDPDQGGN 360

Query: 348 PSFLRDGGSV---SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
              LRDGG     +  + +N  +LAGY D +  + ++FN+  +FD    ++   TL  +A
Sbjct: 361 LDLLRDGGISDPLNPDYDYNPGDLAGYSDRLQQFLNAFNQPRVFDGGVELDPTDTLKGFA 420

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
            +S  WL++ R  +        V+    +ES SN  GVNL EE++ L+ +E++Y  + KL
Sbjct: 421 SSSASWLQRERQTATSNLEVQAVIVTRTAESLSNATGVNLDEEMTRLLDIERAYAAAAKL 480

Query: 465 IMFTDKMLQTLLEGVK 480
           I   D+ML+ LL   +
Sbjct: 481 IAAVDRMLEDLLTAAR 496


>gi|240137258|ref|YP_002961727.1| FlgK protein [Methylobacterium extorquens AM1]
 gi|240007224|gb|ACS38450.1| FlgK protein [Methylobacterium extorquens AM1]
          Length = 487

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 124/487 (25%), Positives = 204/487 (41%), Gaps = 7/487 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L    N A+      S Q A   RN+  A++  Y R+             VT      
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS   +   L +          D     +P   ++  + +L++ +     
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVGDTDDPTAPAARLTTFQAALQAAANQPDN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+   
Sbjct: 121 AQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFDAANRAVTKT 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F   
Sbjct: 181 TALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSAT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + +   +    + IDGV V+       +  G+I  L+ +RD     ++ QLD +A  LI 
Sbjct: 241 SVFAAGTVGGGVRIDGVPVTGATSPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGLID 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG-----ISETICVNPQYRSNPSFLRDG 354
           +F+E D +  +S    GLF A G   L     +      IS    V+P    + + LR G
Sbjct: 301 AFAESDAVGLDSGPRAGLFTAGGSGILPPAAGRTGLAASISVNAAVDPARGGSVALLRSG 360

Query: 355 GSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           G     +              +     +       DP  G+ T+  L + A +S GWLE 
Sbjct: 361 GMNGSDYADPAAGGDAAYAGRLRGLLTALTAARPVDPALGLGTSAGLPDLATSSAGWLEA 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +L+
Sbjct: 421 QRKDASTEASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISVVNDLLK 480

Query: 474 TLLEGVK 480
           TLL+ V+
Sbjct: 481 TLLDAVR 487


>gi|300024587|ref|YP_003757198.1| flagellar hook-associated protein FlgK [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526408|gb|ADJ24877.1| flagellar hook-associated protein FlgK [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 487

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 129/486 (26%), Positives = 224/486 (46%), Gaps = 7/486 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE-NVTVVTQRSEN 59
           MSL    + A++     S+Q + + RNI    + +  R+       P   V+V      +
Sbjct: 1   MSLTLSTDTARSSLQATSEQISVVSRNIARVHDADATRKIATLVSGPGVGVSVPRIDRTS 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
             +        +SA   Q  + S     +    D    +SP   I+KL  +L++YS N  
Sbjct: 61  DQLLFNTYLTANSASQAQTSITSALGQLQSTVDDTDQEHSPAALIAKLSATLQTYSGNPQ 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              +  +V+  A+ V    N+++  V ++R  AD +I   ++N+   LS+   +N+ +  
Sbjct: 121 NPAVAASVVSAAKNVSNALNSASATVTQVRQQADADIATSVANINDLLSQFENLNNQVIR 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            +++  D  D LD RD +L+++S  +GI T+ R N DM +YT  G TLF+  PR + FE+
Sbjct: 181 GSSNGRDVTDVLDARDAVLKQLSTEVGIRTVSRANGDMAIYTDSGVTLFDRAPRAVTFEQ 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGS-AVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +    +    ++ DGV ++       +  GK+  L+ +RD +   +Q+QLDEMAR LI
Sbjct: 241 TQNLAAGAPGGAVYADGVPIAGTSHILEIQSGKLAGLMSVRDDIAVTYQSQLDEMARGLI 300

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ-----GISETICVNPQYRSNPSFLRD 353
            +F+E D  A  +                           I     V+P    N   +RD
Sbjct: 301 NAFAETDQSATPTLPAATGLFTYSGGPAIPASAMAGLASSIKINASVDPGQGGNAELIRD 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           GG     + +N  N   + D I     S N    FD    +  + ++++YA+NS+ WLE 
Sbjct: 361 GGISGASYKYNSANAPAFTDRIQSLISSLNTGQTFDASTQLPASSSVMDYAKNSVSWLEA 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R  +         V    + S S   GVNL EE++ L+ +E+++  S++LI   ++ML 
Sbjct: 421 LRQSATAEADYRSTVAQRATTSLSQATGVNLDEEMTNLLDLERTFQASSRLINTVNEMLS 480

Query: 474 TLLEGV 479
           TL++ +
Sbjct: 481 TLIQSL 486


>gi|262396029|ref|YP_003287882.1| flagellar hook-associated protein FlgK [Vibrio sp. Ex25]
 gi|262339623|gb|ACY53417.1| flagellar hook-associated protein FlgK [Vibrio sp. Ex25]
          Length = 457

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 63/481 (13%), Positives = 144/481 (29%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVVTQRS 57
           N A +             +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGLGANRVALDVTAQNVANVNTVGYSRQQALMASVDDGKANRLSPGLGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLIKQTWSTNSMAAYASGYTSNMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D   +    +++    +  +  VN  +
Sbjct: 123 PESIPYRQQIINESEALARRFNTLTESLHNQHKDMSDQRNAALNHANSLMENIAKVNKQL 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S+ I I T  + +  + V  + G  L          
Sbjct: 183 VEMQGTGGNPSQLMDERDKLIGELSQTIEIRTTEQPDGSVQVTLTSGQPLVMGTDHGKLA 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  L++MA+ L
Sbjct: 243 AVPDPSDPYVADLHVTFSSQSFAIGDS---LGGKLGAINDYQTDVLKPNQLALNDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +    PG  +                               L      
Sbjct: 300 ADEYNAVLATGQDLNGNPGKPLFSYDPANPAAS--------------------LDITELT 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
             +  ++     G  D++    +  NK         +    +L +   + +G        
Sbjct: 340 PGELAFSSDGTPGNADVLQSLINLSNKPVSVTGYGFV----SLNDAFSSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLAMNKQAHAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|91224193|ref|ZP_01259456.1| putative flagellar hook-associated protein [Vibrio alginolyticus
           12G01]
 gi|91191104|gb|EAS77370.1| putative flagellar hook-associated protein [Vibrio alginolyticus
           12G01]
          Length = 457

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 65/481 (13%), Positives = 146/481 (30%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVVTQRS 57
           N A +             +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGLGANRVALDVTAQNVANVNTVGYSRQQALMASVDDGKANRLSPGLGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLIKQTWSTNSMAAYASGYTSNMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D   +    +++    +  +  VN  +
Sbjct: 123 PESIPYRQQIINESEALARRFNTLTESLYNQHKDMSDQRNAALNHANSLMENIAKVNKQL 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S+ I I T  +++  + V  + G  L          
Sbjct: 183 VEMQGTGGNPSQLMDERDRLIGELSQTIEIKTTQQHDGSVQVTLTSGQPLVMGTDHGKLE 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  L++MA+ L
Sbjct: 243 AIPDPSDPYLADLHVTFSNQSFAIGDS---LGGKLGAINDYQTEVLKPNQLALNDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +    PG  +                 T                    
Sbjct: 300 ADEYNAVLATGKDLNGNPGKPLFSYDPANPAASLDITKLTPDE----------------- 342

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
                ++     G  D +    +  NK            +V+L +   + +G        
Sbjct: 343 ---LAFSSDGTPGNADALQSLIELSNKPVAVSG----YGSVSLNDAFSSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           ++  +     +      +  N   VN  EE + L+    ++N + K+I   +++L ++L+
Sbjct: 396 ANADYQAKLAMNKQAHAARDNVSSVNSDEEAANLMMFANAHNANMKVISTANQLLDSILQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|254559269|ref|YP_003066364.1| FlgK protein [Methylobacterium extorquens DM4]
 gi|254266547|emb|CAX22311.1| FlgK protein [Methylobacterium extorquens DM4]
          Length = 487

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 123/487 (25%), Positives = 203/487 (41%), Gaps = 7/487 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L    N A+      S Q A   RN+  A++  Y R+             VT      
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS   +   L +          D     +P   ++  + +L++ +     
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVGDTDDPTAPAARLTTFQAALQAAANQPDN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+   
Sbjct: 121 AQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFEAANRAVTKT 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F   
Sbjct: 181 TALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSAT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + +   +    + IDGV V+       +  G+I  L+ +RD     ++ QLD +A  LI 
Sbjct: 241 SVFAAGTVGGGVRIDGVPVTGATSPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGLID 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG-----ISETICVNPQYRSNPSFLRDG 354
           +F+E D +  +S    GLF   G   L     +      IS    V+P    + + LR G
Sbjct: 301 AFAESDAVGFDSGPRAGLFTVGGSGILPTGAGRTGLAASISVNAAVDPARGGSVALLRSG 360

Query: 355 GSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           G     +              +     +       DP  G+ T+  L + A +S GWLE 
Sbjct: 361 GMNGSDYADPAAGGDAAYAGRLRGLLTALTAARPVDPDLGLGTSAGLPDLATSSAGWLEA 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +L+
Sbjct: 421 QRKDASTDASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISVVNDLLK 480

Query: 474 TLLEGVK 480
           TLL+ V+
Sbjct: 481 TLLDAVR 487


>gi|153831692|ref|ZP_01984359.1| flagellar hook-associated protein FlgK [Vibrio harveyi HY01]
 gi|148872202|gb|EDL71019.1| flagellar hook-associated protein FlgK [Vibrio harveyi HY01]
          Length = 457

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 71/481 (14%), Positives = 151/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP----------ENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +T                V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGYSRQQALTASVGDGKYNKLSPGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         +  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYSAGYTTAMSQLENTLG--ADGFSVSAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D   +    +S+    ++ +  VN  I
Sbjct: 123 PESIPYRQQIINESEALARRFNTLTESLHNQHKDMSDQRNAALSHANSLMANIAQVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RDVL+ ++S+I+ I T  + +  M V  + G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTRDVLIGELSQIVEIKTTDQPDGSMQVTLASGQPLVMGSDYGQLA 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            K +          +         +       GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AKRDPSDPYLADLSVEFASQSFVID---HSVGGKLGAINDYQTEVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +    PG  +                               L      
Sbjct: 300 ADEYNAVLATGQDLNGNPGKPLFSYDPANPAAS--------------------LTITDIS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  D++N      NK            +++L +     +G        
Sbjct: 340 AEELAFSSDGTPGNADVLNDLIQLSNKPVSV----TGYGSLSLNDAFTAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 AEADYEAKAAMNKQAHAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|149203101|ref|ZP_01880072.1| flagellar hook-associated protein K [Roseovarius sp. TM1035]
 gi|149143647|gb|EDM31683.1| flagellar hook-associated protein K [Roseovarius sp. TM1035]
          Length = 482

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 87/484 (17%), Positives = 164/484 (33%), Gaps = 12/484 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--PENVTVVTQRSE 58
           MSL +  + A +     ++    I  N+ NA  + +  R+     +     V V     +
Sbjct: 1   MSLGSALSSALSGLAANTRAVDVISGNLANALTEGFAPREVTLAATRDGRGVQVTGIVRQ 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
                        SA     +  +F    E         NS T  ++ L  +LE+ +   
Sbjct: 61  VDLGLLSDRRLADSARAASEVQAAFARAVESSVGTPDAPNSLTGRLATLEVALETAATRP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
            +      V+  A+++    N +A ++ ++R  AD++I   +  L   L E+  +N  I 
Sbjct: 121 EDTNRLDAVLSAAQDLTAGINDAAADIARLRTAADRDIATTVQELNAGLQEVAALNVQIT 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
              +   D     DQR   +  +S I+ +  + R +  + + T+ G  L +     + F 
Sbjct: 181 TGQSRGTDITALEDQRQRTIDTLSLIVPLRQVPRGDASVALVTTAGGMLLDGRAVKLTFA 240

Query: 239 KMNSYTVTSE-----SNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                T          + I IDG  V        +  G++ ALL IRD       ++LD 
Sbjct: 241 ATPLVTPHMTHKEAQLSGIAIDGADVPIGADRGPLQGGRLGALLDIRDRAAVEANSKLDA 300

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           +AR L+           ++   PG            +    +     +      +PS   
Sbjct: 301 LARDLVER---FQAPGLDATRAPGAPGLLTDAGAIFEAGNALGLAGRIAVTRLVDPSQGG 357

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
               +            G   L+     +  +  +           +   +A   I  L 
Sbjct: 358 ALFRLRDGLGATDGGPPGAGALLGALSHALTQTSVLPSGLLGGAARSAANHAATLISSLS 417

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           + R  +      +               GV+   EL  L+ VEQ++  + ++I   D +L
Sbjct: 418 QERVTTEARLSFATGQSAEFRAQELA-TGVDSDAELQRLLLVEQAFGANARMIQTIDDLL 476

Query: 473 QTLL 476
            TLL
Sbjct: 477 DTLL 480


>gi|163850124|ref|YP_001638167.1| flagellar hook-associated protein FlgK [Methylobacterium extorquens
           PA1]
 gi|163661729|gb|ABY29096.1| flagellar hook-associated protein FlgK [Methylobacterium extorquens
           PA1]
          Length = 487

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 124/487 (25%), Positives = 205/487 (42%), Gaps = 7/487 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L    N A+      S Q A   RN+  A++  Y R+             VT      
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS   +   L +          D     +P   ++  + +L++ +     
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVGDTDDPTAPAARLTTFQAALQAAANQPDN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+   
Sbjct: 121 AQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFDAANRAVTKT 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F   
Sbjct: 181 TALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSAT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + +   +    + IDGV V+       +  G+I  L+ +RD     ++ QLD +A  LI 
Sbjct: 241 SVFAAGTVGGGVRIDGVPVTGATSPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGLID 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG-----ISETICVNPQYRSNPSFLRDG 354
           +F+E D +  +S    GLF A G   L     +      IS    V+P    + + LR G
Sbjct: 301 AFAESDAVGFDSGPRAGLFTAGGSGTLPTAAGRTGLAASISVNAAVDPARGGSVALLRSG 360

Query: 355 GSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           G     +              +     + +     DP  G+ T+  L + A +S GWLE 
Sbjct: 361 GMNGSDYADPAAGGDAAYAGRLRGLLTALSAARPVDPALGLGTSAGLPDLAASSAGWLEA 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +L+
Sbjct: 421 QRKDASTDASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISVVNDLLK 480

Query: 474 TLLEGVK 480
           TLL+ V+
Sbjct: 481 TLLDAVR 487


>gi|319405422|emb|CBI79041.1| Flagellar hook-associated protein FlgK [Bartonella sp. AR 15-3]
          Length = 456

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 115/481 (23%), Positives = 218/481 (45%), Gaps = 26/481 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N A+N     + +  ++ RN+  A + NY RR +     P     V  R +  
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNVVRAGDPNYTRRTSYLESGPGGAVHVVVRRDGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +S       L +       +   D ++NSP+  + + + +L+ Y+ +  +
Sbjct: 61  IHLLNNYLVKASEAAASGTLSNGLNRLSDIYGADKFSNSPSKLLGEFQKALQLYANDPQQ 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
              G+  +D A ++ +  N  +RE++K+  D + +IE  ++ +   L +   ++  +  +
Sbjct: 121 RSNGEAAVDRARDLAKGLNAGSREIEKLCNDVNSDIEDSVNYINGLLQKFHELDQLVVRE 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
             +  D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+  
Sbjct: 181 RNANRDDSVYMDQRDAVLKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKIPRTVSFQFS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            S         IFIDGV +  +        G +  LLQ+ D ++P +Q QLDE+A  LI 
Sbjct: 241 TSLPPGISGKQIFIDGVPLGHSSFIDPNGGGNLGGLLQLCDDIIPQYQKQLDEIANALIQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F     +  + +   G   A                               R   +   
Sbjct: 301 MFPGPPSLFLDGDQPSGQISALEGLAG-------------------------RIQLNPIF 335

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                      + D +    D+FNK   F    G++T  +++++ +NS+ WLE  RS++ 
Sbjct: 336 DSKTEGGGPEHFNDNLQELVDAFNKKQKFGTGTGLDTEQSIMDFGKNSVSWLEGLRSNAD 395

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  V
Sbjct: 396 KETRYQGAMFLHAAEALSNATGVNTDDELALMLQLEQTYGATSRIISTVGKMLDDLLAAV 455

Query: 480 K 480
           +
Sbjct: 456 R 456


>gi|269960122|ref|ZP_06174498.1| putative flagellar hook-associated protein 1 [Vibrio harveyi 1DA3]
 gi|269835093|gb|EEZ89176.1| putative flagellar hook-associated protein 1 [Vibrio harveyi 1DA3]
          Length = 457

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 70/481 (14%), Positives = 151/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP----------ENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +T                V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGYSRQQALTASVGDGKYNKLSPGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         +  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYSAGYTTAMSQLENTLG--ADGFSVSAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D   +    +++    ++ +  VN  I
Sbjct: 123 PESIPYRQQIINESEALARRFNTLTESLHNQHKDMSDQRTAALNHANSLMANIADVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RDVL+ ++S+I+ I T  + +  M V  + G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTRDVLIGELSQIVEIKTTDQPDGSMQVTLASGQPLVMGSDYGQLT 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            K +          +         +       GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AKPDPSDPYLADLSVDFASQSFVID---HSVGGKLGAINDYQTDVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +    PG  +                               L      
Sbjct: 300 ADEYNAVLATGQDLNGNPGKPLFSYDPANPAAS--------------------LTITDIS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  D++N      NK            +++L +     +G        
Sbjct: 340 AEELAFSSDGTPGNADVLNDLIQLSNKPVSV----TGYGSLSLNDAFTAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 AEADYEAKAAMNKQAHAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|254488055|ref|ZP_05101260.1| flagellar hook-associated protein FlgK [Roseobacter sp. GAI101]
 gi|214044924|gb|EEB85562.1| flagellar hook-associated protein FlgK [Roseobacter sp. GAI101]
          Length = 490

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 95/489 (19%), Positives = 186/489 (38%), Gaps = 20/489 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP----ENVTVVTQR 56
           MS+    + A      A +    I  N+ NA    Y  R    +         V +    
Sbjct: 7   MSISGALSSAMQGLRAAGRGSEVIASNLSNALTPGYGVRSLELSADTTATHGGVKIDGVS 66

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
                          +       +       E +        S +   ++L  +L + + 
Sbjct: 67  RLVNESIVHDKRIAEAGQANASAILDLYIKIEDLLGAPDDPASLSAQTAQLEKNLITAAS 126

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
                    TV+ +A  +   FN ++  +QK+R  AD+ IEL++  L   L ++  +N  
Sbjct: 127 RPDAPERLSTVVASARILANTFNEASDGLQKVRTTADRTIELQVDQLNNALLQVQELNAQ 186

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I       +++   LD R  ++ +IS ++ + T+ R+N  + +Y++ G  L +++  +I 
Sbjct: 187 ITKTQVQGNNSSGLLDLRQRVIDEISVLVPVRTVARDNGQVAIYSTGGAVLLDSLAAEIG 246

Query: 237 FEKMNSYTVTSESNPIFIDGVVV------SSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
           FE+ N  T     +   + G+ +      + +    +  G I A  +IRD +    Q Q+
Sbjct: 247 FERSNLVTPYMSESAGTLSGLTINGIAFRTGSSSGVLSGGSIAAQFEIRDEIAVEAQAQI 306

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD---NKLCQGISETICVNPQYRSN 347
           D +AR L+  F +     G +    GLF  +G        N L Q +     V+P     
Sbjct: 307 DALARDLVERFQDPAVDPGLAIGDAGLFTDEGNFFDPANENGLAQRLVLNAAVDPDQGGE 366

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              LRD                G   L+N+   + +   +         + + ++     
Sbjct: 367 TWRLRD------GINAAGPGDVGDATLLNNMISALSTGRVSSSGIFSGGSYSTIDLTSTL 420

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
                  R ++  +   S      ++E   +  GV+  +EL  L+ VEQ++  + +++  
Sbjct: 421 TSHYGAERLNAEQIQSFSATQVTELTERLLSE-GVDSDQELQKLLLVEQAFAANARMVQA 479

Query: 468 TDKMLQTLL 476
            D+M+QTLL
Sbjct: 480 VDEMMQTLL 488


>gi|219670203|ref|YP_002460638.1| flagellar hook-associated protein FlgK [Desulfitobacterium
           hafniense DCB-2]
 gi|219540463|gb|ACL22202.1| flagellar hook-associated protein FlgK [Desulfitobacterium
           hafniense DCB-2]
          Length = 583

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 64/578 (11%), Positives = 166/578 (28%), Gaps = 101/578 (17%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------P 47
           S  +    A+    +      +   NI NA+   Y R+      +               
Sbjct: 3   STFSGLELARRALESQQIALDTTGHNIANANTIGYTRQVVNLQATSPDSIPGMGHYLSIG 62

Query: 48  ENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL 107
             VTV +         D+     +S        ++  A  E +  ++  +NS ++ +++ 
Sbjct: 63  TGVTVQSIERARDIFIDRQFRWENSKQEYWATRENTLAQIEGLL-NEPSDNSLSNDLTQF 121

Query: 108 RDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
             +    + N         +++ A  +    +   +++ + +   D  + ++I  +  + 
Sbjct: 122 WSAWSVLANNPENLGARSVILERAATLADTLHHIDQQITEAQKSLDSSVRVQIDQINSYA 181

Query: 168 SELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD---- 223
           +++  +N  IK    +  + +D LD+RD L+  +S+++ +  +   + +      +    
Sbjct: 182 NQIQELNFQIKKVQITGDNPNDLLDKRDALIDDLSKLVNVRVVESRDPNFTDREVNIFKL 241

Query: 224 --------GTTLFETVPRDINFEKMNSYTVTSESNPIFI--DGVVVSSNQGSAVPKGKIK 273
                      L +            +         +          ++      +G+++
Sbjct: 242 YIGNEKATNQILVDDTKAYQLATPETTDADGLPFAEVKWAAGHPQAGASVDLGEGQGELQ 301

Query: 274 ALLQIRDSV-------------VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIA 320
           + + +R S              +   ++Q +++AR +  + +       + E   G    
Sbjct: 302 SSILMRGSGFEYSAGDTKATAHLAYLRDQFNQLARGIAEALNAIHRTGIDKEGNFGEDFF 361

Query: 321 DGIKDLDNKLCQGISET--------ICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP 372
                                    I        +    +   S++  +          P
Sbjct: 362 TSADGNPISAGNIKVNQDLIDDPWKIATGKDNFGDGEIAKALSSLATGWTGLTDLYLKNP 421

Query: 373 DLINHYCDSFNKNFIFDPVAG------------------------------INTNVTLLE 402
                  D        D  AG                                  +T   
Sbjct: 422 AGNTVLIDPATGAITTDTAAGRPMAWATSADTPLKYPVGHPLEGDPILIDPATGTITTDT 481

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHI---------------------SESYSNTVG 441
                +   +     +  +          +                          + VG
Sbjct: 482 AIGKPVVLAQTPPLSASSIGDYYGAALAELGVDAQQATRMKESQAVLVTHMYNQRQSVVG 541

Query: 442 VNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           VN+ EE++ LIK ++SY  + +++   D ML T++ G+
Sbjct: 542 VNMDEEITNLIKFQKSYTAAARIVTMLDSMLDTIVNGM 579


>gi|251799725|ref|YP_003014456.1| flagellar hook-associated protein FlgK [Paenibacillus sp. JDR-2]
 gi|247547351|gb|ACT04370.1| flagellar hook-associated protein FlgK [Paenibacillus sp. JDR-2]
          Length = 518

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 77/520 (14%), Positives = 172/520 (33%), Gaps = 51/520 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       A+           +   NI NA+   Y R+    T +               
Sbjct: 3   STFHGLETAKRSIFTTQTALNTTGHNISNANTSGYSRQRVNFTAARPIEAYGYSHSTAAG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V   +         D   ++    +G   +        E +  ++  +      I
Sbjct: 63  QLGTGVEASSITRVRDKFLDSQFYSEYKWLGNYTVQSDTLEKLETI-VNEPSDTGLQTVI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           S   +S    SK          +++  + ++  FN +++++  +++D  +  ++ + NL+
Sbjct: 122 SNFWNSWSDLSKTPESADGRAVLVEQTKAMMDAFNYTSKQLADLKSDLTENAQINLDNLK 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
              S +  +N  I+       DA+D  DQRD L+ ++S +  I     ++    +   + 
Sbjct: 182 SISSTIANLNGQIQRIEGIGDDANDLRDQRDALVDELSGLANIKVSDLSDGY-TITMGNV 240

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS--- 281
           + +            ++  T   E+  +    +  +        +G +  L Q+ ++   
Sbjct: 241 SLVAGKSAEGSQGLTLDDMTAAIENGDLNNGAIYGTMQSRDKYVQGYMDQLNQMANTIAN 300

Query: 282 ----------------------VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFI 319
                                         L E   V +   +    +        G  +
Sbjct: 301 GDIQVTIPKGSVLPEGTVLNGVTYAGANRTLAEDLTVTVQGLNGLHQLGYTMNGEQGEPL 360

Query: 320 ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYC 379
                D +       +  I +NP+  ++P+ L     V+         +AG   +     
Sbjct: 361 FT---DANGNTDNLTAANIQLNPKIAADPTLLATSMKVTFNDDGTETVVAGNNSMAVLMS 417

Query: 380 DSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNT 439
            + +  F FD       N T+  + R  +G L     +   L    Q + + +     + 
Sbjct: 418 QARDTKFAFDA----TDNNTISGFFRAVVGQLGVQSKEMQRLQTNQQTIVDQVDSRRMSV 473

Query: 440 VGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            GV+L EE+S L+K + +YN S +++   D+ L  ++  +
Sbjct: 474 SGVSLDEEMSDLVKFQHAYNASARVMTVIDETLDRIINSM 513


>gi|320353947|ref|YP_004195286.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
 gi|320122449|gb|ADW17995.1| flagellar hook-associated protein FlgK [Desulfobulbus propionicus
           DSM 2032]
          Length = 465

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/487 (17%), Positives = 154/487 (31%), Gaps = 34/487 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVT 51
           SL+       +    +         NI NA  + Y R+    T S               
Sbjct: 3   SLITSLYTGASGIFTSQTAIQVTGNNITNAATEGYSRQTAHVTSSTPLTQGGLTYGTGSA 62

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           V      N     + L A S+  GQ     +   L ++    D  +      I    D+ 
Sbjct: 63  VDAIDRANDAFITRQLMAQSATYGQYEAAST--PLADIERILDIGDTGLASAIDSFFDAW 120

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           E  S N S     + V+  A ++  + N  A+++ ++ +  +  IE  I +L   L ++ 
Sbjct: 121 EELSTNPSGVAERQQVVQEAADLAYHCNQIAQQLDEVVSGINTSIESAIPDLNDQLRQIA 180

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N +I     +  DA+   DQRD+L+Q+ SE  G +    +N  + +   +G  L    
Sbjct: 181 DLNQSIMRTELAGGDANTLRDQRDLLVQQASETCGAAAYTDDNGMVCLQLQNGLPL---- 236

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
               N     S         I +     + +       G +K  L++RD  +P   + LD
Sbjct: 237 -VTGNVAASFSTAQVDGLTQISLTSAGTTFSLDDQDFGGALKGWLEVRDVTLPELHSDLD 295

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
            +A  +    ++     G  +      IA               +    +     +   L
Sbjct: 296 RLAYTIATDVNDLISTMGGLDQNGNAAIALFSLVAPTNPLANAWDGAAASIAAAFDDPTL 355

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
              G                        +S                 T  E         
Sbjct: 356 IAAGITGTTAD-----------------NSLCLEIAALRDTTSINGATYAEEYARIAANA 398

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
               S +  L   S  + + ++       GV+  EE+  LI+ +  Y  ++  I    +M
Sbjct: 399 GLLVSSNEQLLSSSGDLLDALNSKRDAVSGVSTDEEMVLLIQYQAGYEAASNYISVVKEM 458

Query: 472 LQTLLEG 478
           L TLL  
Sbjct: 459 LDTLLRM 465


>gi|218528728|ref|YP_002419544.1| flagellar hook-associated protein FlgK [Methylobacterium
           chloromethanicum CM4]
 gi|218521031|gb|ACK81616.1| flagellar hook-associated protein FlgK [Methylobacterium
           chloromethanicum CM4]
          Length = 487

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 123/487 (25%), Positives = 203/487 (41%), Gaps = 7/487 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L    N A+      S Q A   RN+  A++  Y R+             VT      
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSTGGATVTITRAGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS   +   L +          D     +P   ++  + +L++ +     
Sbjct: 61  PALYARTLNASSDAARGDALLTGLTKLAQTVGDTDDPTAPAARLTTFQAALQAAANQPDN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  +++A+ +  + + +A  +   RA+AD  I   +S +   L      N A+   
Sbjct: 121 AQLARDAVESAKALAGSLSQAADAIHAARAEADAGIAASVSRINDLLVRFDAANRAVTKT 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   DA D LD RD +L  +S+ IG+  + R   DM +YT  G TLFE  PR + F   
Sbjct: 181 TALGGDATDALDDRDRILTALSQEIGVHAVAREGGDMALYTDGGVTLFERGPRAVTFSAT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + +   +    + IDGV V+       +  G+I  L+ +RD     ++ QLD +A  LI 
Sbjct: 241 SVFAAGTVGGGVRIDGVPVTGATSPMPLNSGRIAGLVALRDGAAVQYEAQLDALAGGLID 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG-----ISETICVNPQYRSNPSFLRDG 354
           +F+E D +  +S     LF A G   L     +      IS    V+P    + + LR G
Sbjct: 301 AFAESDAVGFDSGPRAALFTAGGSGTLPTAAGRTGLAASISVNAAVDPARGGSVALLRSG 360

Query: 355 GSVSKKFLWNVKNLAGYPDL-INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
           G     +              +     +       DP  G+ T+  L + A +S GWLE 
Sbjct: 361 GMNGSDYADPAAGGDAAYAGRLRGLLTALTAARPVDPALGLGTSAGLPDLAASSAGWLEA 420

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +L+
Sbjct: 421 QRKDASTDASYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLISIVNDLLK 480

Query: 474 TLLEGVK 480
           TLL+ V+
Sbjct: 481 TLLDAVR 487


>gi|28900128|ref|NP_799783.1| putative flagellar hook-associated protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260365778|ref|ZP_05778274.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           K5030]
 gi|260880700|ref|ZP_05893055.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           AN-5034]
 gi|260897694|ref|ZP_05906190.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           Peru-466]
 gi|28808411|dbj|BAC61616.1| putative flagellar hook-associated protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308086274|gb|EFO35969.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           Peru-466]
 gi|308092694|gb|EFO42389.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           AN-5034]
 gi|308114946|gb|EFO52486.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           K5030]
          Length = 457

 Score =  198 bits (503), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 68/481 (14%), Positives = 153/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +             S   V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANVNTPGYSRQQALMATVGDGKSNRLSSGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYAAGYTSNMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT  + +     D + +    +++    +S +  VN  I
Sbjct: 123 PESMPYRQQIINESEALARRFNTLTQSLHNQHKDMNDQRTAALTHANSLMSNIAHVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D R+ L+ ++S++I + T  + +  M V    G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTREKLIGELSQVIEVKTTDQPDGSMQVTLVSGQPLVMGSDFGQLS 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AIPDPSDPYLADLHVNFANQSFAIGDS---VGGKLGAINDYQTEVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       + +   G  + +   D                         L      
Sbjct: 300 ADEYNAVLATGKDLKGNAGKPLFNYDPDNPAAS--------------------LTITDLS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  +++    D  NK            +V+L +   + +G        
Sbjct: 340 AEELAFSSDGTPGNANVLKSLIDLSNKPV----AVTGYGSVSLNDAFTSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLAMSKQAHTARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|92114092|ref|YP_574020.1| flagellar hook-associated protein [Chromohalobacter salexigens DSM
           3043]
 gi|91797182|gb|ABE59321.1| Flagellar hook-associated protein [Chromohalobacter salexigens DSM
           3043]
          Length = 539

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 71/539 (13%), Positives = 172/539 (31%), Gaps = 67/539 (12%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT------ISPENVTVVTQRSE 58
           ++F+   +  + A    ++   N+ N   + Y R+ T+         +   V+V   + +
Sbjct: 2   SIFSIGLSGLSAAQSALSTTSNNLSNVYTEGYNRQLTILGESYSNGSTGTGVSVDEVQRQ 61

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
             +   +  +  +S        QS  +  + + AD   +      +     SL+  +   
Sbjct: 62  FNSYVTEQYNDANSQKSALESYQSQVSQIDDLLAD--SDAGLAPLVQDFFSSLDDLTGAA 119

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           S+    + V+ +A  +   F +    +  +R+  + ++E  ++++    +++  +ND I 
Sbjct: 120 SDPAARQGVLGSASSMAAQFRSFDSYLGDMRSSLNGQLESTVTDINNTATQIAKLNDQIT 179

Query: 179 FKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              A S  + +  LD+RD L+  ++E++G    +++ +   +   +G  L          
Sbjct: 180 QARAKSGEEPNSLLDKRDKLVSDLNELVGADLNIQDGDTYNINLENGQPLVSGTQSYDLE 239

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              ++   +            V+    SA   G++  LL  R   +   QNQL  M  VL
Sbjct: 240 AVESNEDPSRTVIAYRDAAGNVNQIDDSAFENGELGGLLSFRSETLDSVQNQLGRMTVVL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQ------------------------- 332
              F+       +     G    +          Q                         
Sbjct: 300 GSEFNAVHENGVDLNGDAGEAFFEIGSPRVMSNSQNDGDGAISAEYSDVNQLTSSDYRIT 359

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD--- 389
                         + + L   GS          N++G     + +     +        
Sbjct: 360 YTGGEYQAERLSDGDTTTLTPDGSGDVDLDGMTLNISGTAQEGDTFMLQPTRTASQGFEV 419

Query: 390 ------------------------------PVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                                             +    ++ +   + +  +    + + 
Sbjct: 420 AITEGAEIAAASSGGGSGNNENALDLLDLQSEKMVGGTSSISDAYASLVNEVGNTTNITQ 479

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                   +   + E   +  GVNL EE + L++ +Q Y  + ++I    ++L ++L+ 
Sbjct: 480 VNLDAQSGLTEQLREYQQSESGVNLDEEYANLVRYQQYYQANARVIDVGSQVLDSVLQL 538


>gi|328958295|ref|YP_004375681.1| flagellar hook-associated protein FlgK [Carnobacterium sp. 17-4]
 gi|328674619|gb|AEB30665.1| flagellar hook-associated protein FlgK [Carnobacterium sp. 17-4]
          Length = 472

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 69/489 (14%), Positives = 160/489 (32%), Gaps = 33/489 (6%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------TISPE 48
           MS L    N A    N       +   NI NA+   Y R+                    
Sbjct: 1   MSGLFGTLNNATKGLNVQQAALQTTSHNISNANTVGYSRQKVTMVADNPYTLGGIGQLGT 60

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V + +         +K L   +S++             E +  ++       + +SK+ 
Sbjct: 61  GVRISSIDRIVDPYVNKQLRNENSSLEMYGKKSDILGQLEGIF-NEPSTTGLNNNLSKVF 119

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
            S      N         V  N+E      +  ++++  +     ++IE  + +    + 
Sbjct: 120 SSWTYLGSNPELATAKTMVAQNSETFTDTLHHMSKQIDSLHEGTVQDIEKNVLDFNAKVE 179

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           +L  +N  I   T+     +D LDQ+D +L +++ I G+       N + +     + L 
Sbjct: 180 QLDSLNKQIFNMTSQGQAPNDLLDQQDKILSELTGIAGVEASYDKFNRVSITVGGESVLT 239

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           E     ++    +             DG +V +    A+  G IK   +     +   + 
Sbjct: 240 EDSISKMSVAPDS-------------DGQLVVNETNIAITSGNIKGSQEALTE-IDTKKQ 285

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
           +L+++A     + +E     G      G+      +  D      +++ I  +    +  
Sbjct: 286 ELNDIAFTFATAMNEVHSDGG-----AGIPFFTLGEGGDYAASIQVNKEILDDVSKINAG 340

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             + D                      +      + +     +       T+     +S+
Sbjct: 341 KDINDV-VGGDGTRAQAIAALQNTKFGDPVDIKGDYDPDTMTIKNKEGGSTVAGSYNDSV 399

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +   +  S ++      + + +     +  GV++ EE++  I  + ++  ++++I   
Sbjct: 400 TQMGIVKQQSDNMVDSQGSLVSLLEARRDSVSGVSINEEVTNTIAYQSAFEANSRIISVV 459

Query: 469 DKMLQTLLE 477
            +ML TL+ 
Sbjct: 460 SEMLDTLIN 468


>gi|156976147|ref|YP_001447053.1| flagellar hook-associated protein [Vibrio harveyi ATCC BAA-1116]
 gi|156527741|gb|ABU72826.1| hypothetical protein VIBHAR_04918 [Vibrio harveyi ATCC BAA-1116]
          Length = 457

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 71/481 (14%), Positives = 150/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP----------ENVTVVTQRS 57
           N A +  N          +N+ N     Y R+  + T               V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANIITPGYSRQQALMTSVGDGKYNKLSPGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         +  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYSAGYTTAMSQIENTLG--ADGFSVSAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D   +    +S+    ++ +  VN  I
Sbjct: 123 PESIPYRQQIINESEALARRFNTLTESLHNQHKDMSDQRNAALSHANSLMANIAQVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RDVL+ ++S+I+ I T  + +  M V  + G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTRDVLIGELSQIVEIKTTDQPDGSMQVTLASGQPLVMGSDYGQLA 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            K +          +         +       GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AKPDPSDPYLADLSVEFASQSFVID---HSVGGKLGAINDYQTEVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +    PG  +                               L      
Sbjct: 300 ADEYNAVLATGQDLNGNPGKPLFSYDPANPAAS--------------------LTITDIS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  D++N      NK            +++L +     +G        
Sbjct: 340 AEELAFSSDGTPGNADVLNDLIQLSNKPVSV----TGYGSLSLNDAFTAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 AEADYEAKAAMNKQAHAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|153837083|ref|ZP_01989750.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           AQ3810]
 gi|149749671|gb|EDM60416.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           AQ3810]
          Length = 457

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 68/481 (14%), Positives = 152/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +             S   V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANVNTPGYSRQQALMATVGDGKSNRLSSGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYAAGYTSNMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT  + +     D + +    + +    +S +  VN  I
Sbjct: 123 PESMPYRQQIINESEALARRFNTLTQSLHNQHKDMNDQRTAALIHANSLMSNIAHVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D R+ L+ ++S++I + T  + +  M V    G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTREKLIGELSQVIEVKTTDQPDGSMQVTLVSGQPLVMGSDFGQLS 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AIPDPSDPYLADLHVNFANQSFAIGDS---VGGKLGAINDYQTDVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       + +   G  + +   D                         L      
Sbjct: 300 ADEYNAVLATGKDLKGNAGKPLFNYDPDNPAAS--------------------LTITDLS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  +++    D  NK            +V+L +   + +G        
Sbjct: 340 AEELAFSSDGTPGNANVLKSLIDLSNKPV----AVTGYGSVSLNDAFTSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLAMSKQAHTARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|290474980|ref|YP_003467864.1| flagellar hook-filament junction protein 1 [Xenorhabdus bovienii
           SS-2004]
 gi|289174297|emb|CBJ81087.1| flagellar biosynthesis; hook-filament junction protein 1
           [Xenorhabdus bovienii SS-2004]
          Length = 546

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 80/548 (14%), Positives = 174/548 (31%), Gaps = 73/548 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           MS  ++ N A +  N A      +  NI N+ N  Y R+ T+ T +             V
Sbjct: 1   MS-NSLMNTAMSGINAAQVAMGVVGNNIANSKNVGYNRQTTVLTQNNGTLSPAGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V +   E     ++   +  +                 + AD   + S ++ I +   S
Sbjct: 60  AVSSINREYSEFINQQHSSAQTKHAALTAYNQQITKINDLLAD--KDTSLSNSIEEFFKS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L +   N  +     TV+  AE +V  F  +   +++I    + +IE     + ++  E+
Sbjct: 118 LGAAESNAEDSAARTTVLGKAEGLVSRFKEADEFLRQIDNSINSQIEQNAREINKYAEEV 177

Query: 171 TVVNDAIKFKTASK-HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N+ I     +   +    LD+RD  + K+++++ ++   ++     V    G +L  
Sbjct: 178 ATLNNEITRMRGTGTGEPLALLDKRDEAVNKLNQLVDVNVTQQDGGVYNVSFGGGMSLVS 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      +S   +  +       V         + +G +   LQ+R  VV   +NQ
Sbjct: 238 GSKSYRLEAISSSTDSSRITLGYNNGTVGTKEIDERFISQGTLGGALQVRREVVDSSRNQ 297

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG---------------I 334
           L+++A V+   F++      + +  PG+   +  K                        +
Sbjct: 298 LNQLALVMADQFNQVQNGGFDLKGKPGVDFFNFTKPDVISNSNNKGTADIKVEYADTTKV 357

Query: 335 SETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP---------------------- 372
             +         +    R     +     N   L                          
Sbjct: 358 KNSDYTLKYEGGDWKVQRVSDKAAVPVTKNGNALEFDGLKVEIDAAHSQDHDTYTLKTVS 417

Query: 373 ----DLINHYCDSFNKNFIFDPVAG------------------INTNVTLLEYARNSIGW 410
                L  +  DS       D  AG                  I+   +      + +  
Sbjct: 418 NVVATLEVNLQDSSQLATAGDKDAGPSDNRNAKKFLALQDQRLIDGKSSFAGAYASLVSQ 477

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +++         + + +  +  +  GVN+ EE   + +++Q Y  + ++I     
Sbjct: 478 VGSKANEAQVSVETQGHIVDKLYATRESISGVNMDEEYGAMQRLQQYYLANARVIQTAAT 537

Query: 471 MLQTLLEG 478
           +   +L  
Sbjct: 538 LFDAILGI 545


>gi|319406995|emb|CBI80632.1| Flagellar hook-associated protein FlgK [Bartonella sp. 1-1C]
          Length = 456

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 113/481 (23%), Positives = 218/481 (45%), Gaps = 26/481 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N A+N     + +  ++ RN+  A + NY RR +     P     V  R ++ 
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNVVKAGDPNYTRRTSYLEAGPGGAVHVVVRRDSD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +S       L +       +   D ++NSP+  + + + +L+ Y+ +  +
Sbjct: 61  IHLLNNYLVKASEAAAAGSLSNGLNRLSDIYGSDRFSNSPSKLLGEFQKALQLYANDPQQ 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
              G   +D A ++ +  N  +RE++K+  D + +I+  +  +   L +   ++  +  +
Sbjct: 121 RSNGDAAVDRARDLAKGLNAGSREIEKLYNDVNSDIQDSVDYINDLLQKFHELDQLVVRE 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
             ++ D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+  
Sbjct: 181 RNARRDDSVYMDQRDAVLKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKMPRTVSFQFS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            S         IFIDGV +  +        G +  LL++RD ++P +Q QLDEMA  L+ 
Sbjct: 241 TSLPSGISGKQIFIDGVPLGHSSFIDPNGGGNLGGLLKLRDDIIPQYQRQLDEMANALMQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F     +  +     G   A                               R   +   
Sbjct: 301 MFLGPPSLFLDGNQPSGQIGALEGLAG-------------------------RIQLNPIF 335

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                      + D +    DSFN+   F    G++   +++++ +NS+GWL+  RS++ 
Sbjct: 336 DSKTEGGGPEHFGDKLQELVDSFNEKQKFGTGTGLDPEQSIMDFGKNSVGWLQGLRSNAD 395

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  V
Sbjct: 396 KEARYKGTMFLHAAEALSNATGVNTDDELALMLQLEQTYGATSRIISTVGKMLDDLLAAV 455

Query: 480 K 480
           +
Sbjct: 456 R 456


>gi|163803175|ref|ZP_02197058.1| putative flagellar hook-associated protein [Vibrio sp. AND4]
 gi|159173075|gb|EDP57908.1| putative flagellar hook-associated protein [Vibrio sp. AND4]
          Length = 457

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 69/481 (14%), Positives = 149/481 (30%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP----------ENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGYSRQQALMASVGDGKYNKLSPGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         +     E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYSAGYVTAMDQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +++ +E + + FNT    +     D   +    +S+    ++ +  VN  I
Sbjct: 123 PESIPYRQQIVNESEALARRFNTLTESLHNQHKDMSDQRNAALSHANSLMANIAQVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RD+L+ ++S+I+ I T  +++  M V  S G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTRDLLIGELSQIVEIKTTDQSDGSMQVTLSSGQPLVMGGDYGQLT 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            K N          +         +       GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AKPNPSDPYLADLSVDFASQSFIID---HSVGGKLGAINDYQTQVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +     G  +                               L      
Sbjct: 300 ADEYNAVLATGQDLNGNSGKPLFSYDPANPAAS--------------------LTITNIG 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  D++N      NK            +++L +     +G        
Sbjct: 340 AEELAFSSDGTPGNADVLNDLIQLSNKPISV----TGYGSLSLNDAFTAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 AEADYEAKAAMNKQAHAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|254227989|ref|ZP_04921419.1| flagellar hook-associated protein FlgK [Vibrio sp. Ex25]
 gi|151939485|gb|EDN58313.1| flagellar hook-associated protein FlgK [Vibrio sp. Ex25]
          Length = 457

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 63/481 (13%), Positives = 144/481 (29%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVVTQRS 57
           N A +             +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGLGANRVALDVTAQNVANVNTVGYSRQQALMASVDDGKANRLSPGLGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLIKQTWSTNSMAAYASGYTSNMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT    +     D   +    +++    +  +  VN  +
Sbjct: 123 RESIPYRQQIINESEALARRFNTLTESLHNQHKDMSDQRNAALNHANSLMENIAKVNKQL 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S+ I I T  + +  + V  + G  L          
Sbjct: 183 VEMQGTGGNPSQLMDERDKLIGELSQTIEIRTTEQPDGSVQVTLTSGQPLVMGTDHGKLA 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  L++MA+ L
Sbjct: 243 AVPDPSDPYVADLHVTFSSQSFAIGDS---LGGKLGAINDYQTDVLKPNQLALNDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       +    PG  +                               L      
Sbjct: 300 ADEYNAVLATGQDLNGNPGKPLFSYDPANPAAS--------------------LDITELT 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
             +  ++     G  D++    +  NK         +    +L +   + +G        
Sbjct: 340 PGELAFSSDGTPGNADVLQSLINLSNKPVSVTGYGFV----SLNDAFSSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLAMNKQAHAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|260899395|ref|ZP_05907790.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           AQ4037]
 gi|308109296|gb|EFO46836.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           AQ4037]
          Length = 457

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 68/481 (14%), Positives = 153/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +             S   V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANVNTPGYSRQQALMATVGDGKSNRLSSGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYAAGYTSNMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT  + +     D + +    +++    +S +  VN  I
Sbjct: 123 PESMPYRQQIINESEALARRFNTLTQSLHNQHKDMNDQRTAALTHANSLMSNIAHVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D R+ L+ ++S++I + T  + +  M V    G  L          
Sbjct: 183 VEMQGTGGNPAQLMDTREKLIGELSQVIEVKTTDQPDGSMQVTLVSGQPLVMGSDFGQLS 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AIPDPSDPYLADLHVNFANQSFAIGDS---VGGKLGAINDYQTDVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       + +   G  + +   D                         L      
Sbjct: 300 ADEYNAVLATGKDLKGNAGKPLFNYDPDNPAAS--------------------LTITDLS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  +++    D  NK            +V+L +   + +G        
Sbjct: 340 AEELAFSSDGTPGNANVLKSLIDLSNKPV----AVTGYGSVSLNDAFTSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLAMSKQAHTARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|260767929|ref|ZP_05876863.1| flagellar hook-associated protein FlgK [Vibrio furnissii CIP
           102972]
 gi|260615959|gb|EEX41144.1| flagellar hook-associated protein FlgK [Vibrio furnissii CIP
           102972]
 gi|315179632|gb|ADT86546.1| flagellar hook-associated protein [Vibrio furnissii NCTC 11218]
          Length = 457

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 66/481 (13%), Positives = 152/481 (31%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVTQRS 57
           N A +  N          +N+ N +   Y R+  +                 V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVANINTPGYSRQQALMASVGGAKYDNLSAGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   +  S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTGSVASYASRYTSSMSYLENTLG--ADGFSLSAGLDNLFAALHDATSK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                L + +I+ AE + + FNT    +     D + +    ++     ++ +  VN  I
Sbjct: 123 PESVPLRQQIINEAEALSRRFNTLTESMYNQHKDMNDQRTAAVAQANSVMANIAEVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D RD L+ ++++I+ + T  + +  M V  + G  L          
Sbjct: 183 VELKGTGGNPAQLMDTRDALVGELAKIVEVKTTDQADGSMQVTLTSGQPLVMGSEHGTLK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +       +  +       +         G++ A+ + +  V+  +   L++MA+ +
Sbjct: 243 AIPDPSDAYLATMQVEFGKQSFAIPGD---LGGELGAINEYQTDVLKPYMTALNDMAQSM 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
             SF+ +  +  +   +PG  +                             S L      
Sbjct: 300 ADSFNTELALGLDLNGLPGKALFSYDPANP--------------------SSSLTITDIT 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
             +   +     G  D +       N+ F          +++L +     +G +      
Sbjct: 340 PNELALSGDGNPGNSDNLTALIAISNQAFSISGF----GSLSLNDAFTGMVGEVAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADSDYQAKNSMNEQAVAARDNISAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|110677962|ref|YP_680969.1| flagellar hook-associated protein FlgK [Roseobacter denitrificans
           OCh 114]
 gi|109454078|gb|ABG30283.1| flagellar hook-associated protein FlgK [Roseobacter denitrificans
           OCh 114]
          Length = 481

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 96/486 (19%), Positives = 180/486 (37%), Gaps = 17/486 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           MS+    + A      A +    I  N+ NA    Y  R+   + S    V +       
Sbjct: 1   MSISGALSNAMTGLRAAGRTSEVISANLANAMTPGYGVRNLSLSSSQLGGVAIDGVMRNV 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                  L    ++ G       F    E +       NS    +++   +L + +    
Sbjct: 61  DPSLLADLRLADASFGNANNRTKFLNDFENLLGTPEEANSLAGRMAEFERTLITAASRPD 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                 +V+D A ++    + ++  VQ+ R+DAD+ I+++I  L   L  +  +N  I  
Sbjct: 121 APERLNSVVDAARDIATLISKASDGVQQARSDADRAIQVQIDRLNTSLQSVKELNSQITR 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
             ++  DA    D R  ++ +I+ I+ +  + R+N  + +Y++ G  L +    +I F  
Sbjct: 181 TISTGSDASALFDNRQAIVDEINAIVPVRLVPRDNGQIALYSTGGAILIDGGVAEIEFNA 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEM 293
           +N  T         + G+ V+               G + A  +IRD +    Q QLD  
Sbjct: 241 VNQVTPFMTLGGGTLSGLSVNGYPVRTDSARGALGGGTLGAHFEIRDELGTSAQTQLDAF 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIAD---GIKDLDNKLCQGISETICVNPQYRSNPSF 350
           AR LI  F +    A  +   PG+F           +  L   +S    V+ +       
Sbjct: 301 ARDLIERFQDPAVDASLAVGDPGIFTDAGLAFDPVNEIGLSARLSVNAAVDERQGGESWR 360

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           +RD                G   LI    D+ +               + +         
Sbjct: 361 IRD------GVNALTPGDVGDARLIQALSDTLSAKRAPASGDFGAGAFSAMNLISTFTSQ 414

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +  +RS +      +   F+ +++      GV+  +EL  L+ VEQ+Y  + ++I   D+
Sbjct: 415 VGADRSRAEQTLSFASSQFDELTQQVLAN-GVDSDQELQRLLIVEQAYAANARMIEAADE 473

Query: 471 MLQTLL 476
           M+QT+L
Sbjct: 474 MMQTIL 479


>gi|126697802|ref|YP_001086699.1| putative flagellar hook-associated protein [Clostridium difficile
           630]
 gi|115249239|emb|CAJ67052.1| Flagellar hook-associated protein FlgK (or HAP1) [Clostridium
           difficile]
          Length = 436

 Score =  197 bits (500), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 79/495 (15%), Positives = 172/495 (34%), Gaps = 79/495 (15%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
            L ++ N A +  N   +   +I  NI N D   Y R+ T    +               
Sbjct: 3   GLFSILNTANSGMNAHQKSIQTISHNISNLDTDGYSRQRTEFATNSPMYMPSLSNSIGRG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V        + +D    A +   G       +    E +  ++  +   +  I
Sbjct: 63  QLGTGVHVTDVTRARNSFYDYQFRAEAHKYGNTVSKYDYYNTIETIL-NEPSDYGISAGI 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                  ES SK+++ D     V++NA  +    + S +++ K++ D D  I+ EI  + 
Sbjct: 122 DDFFKGWESLSKDINSDNKKSLVVENASNLATLISESYKKLDKLKGDIDSNIDTEIKQIN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             L  L  +N +I   + S    +D LD+RD +L  +S  + +      N          
Sbjct: 182 DMLKSLEDLNKSIDIISGSGSTPNDLLDERDRILDNLSFKLDLENSDVKNMLSD------ 235

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
                                      + ++ +  +         G ++ L ++    + 
Sbjct: 236 -------------------------GKLELNELKNADGTWKTGISGTLQGLFEMH-GKID 269

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            +++ L +++  L    ++    +              ++D          + I VNP  
Sbjct: 270 TYKSDLKDVSDGLAKQINDVYNSSAGIT----------VRDFFITSNVAGEDIIKVNPAI 319

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
           +SN + L+     + K                    +  K+   D         T+ ++ 
Sbjct: 320 KSNSNELKLTTEEASKI-------------------AKLKDEKIDIGVAGGKVSTISDHY 360

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
           +     +  +    +   +  + + N++  S  +  GV+L EE++ L+KV++SY  S K+
Sbjct: 361 KAFAESVGLDSQKVNQDEVNQRKIINNVDNSRMSVSGVSLDEEMTELMKVQRSYQASAKV 420

Query: 465 IMFTDKMLQTLLEGV 479
           +    ++L  ++ G+
Sbjct: 421 MSTAVQLLDVVINGI 435


>gi|157147096|ref|YP_001454415.1| flagellar hook-associated protein FlgK [Citrobacter koseri ATCC
           BAA-895]
 gi|157084301|gb|ABV13979.1| hypothetical protein CKO_02873 [Citrobacter koseri ATCC BAA-895]
          Length = 461

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 67/488 (13%), Positives = 148/488 (30%), Gaps = 38/488 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------ISPENV 50
           MS+    N A +    A         NI N     Y R+  + +           +   V
Sbjct: 1   MSM---INIAFSGLQAAQVGMNVTSMNIANLLTPGYSRQGIIQSSIGPMGEAGFTAGNGV 57

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V + R  +       +   +S          +    E +   D  + S  + +     +
Sbjct: 58  QVDSIRRISSQYLVNQVWQTNSKASYFETGNQYIGALEQVIGTD--STSLGNGLDDFVSA 115

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L + ++      L + +I+ A  +   FN     +   +   + +    +  +    + +
Sbjct: 116 LSALTQTPESPALRQQLINQAGALATRFNNVNNFISSQKESINTQRNAMVDQINTLSTSI 175

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
              N  I    ++  ++    DQRD L++++S +  +      ++   V  ++G  L   
Sbjct: 176 ADYNKKITDMESTGGNSSVLRDQRDELVKQLSTLADVKVTDDGSSGYTVSMANGQPLVSG 235

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     ++       N         S    +    G++ AL       +   ++ +
Sbjct: 236 KVAGQLSAGQDA-----NGNSTLTLKFSTSEFTLNPSAGGQLGALYDYETGTLQQMKDSV 290

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
             MA  +   F+++     +     G  +          + Q                  
Sbjct: 291 QGMAESVAKLFNDQLAKGYDLNGNSGKPLFTFDPSNPAGMLQVT--------------DL 336

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
             +  ++S     +   + G  D +    +  N+      +     N++L E A   I  
Sbjct: 337 KPEELALSGIQADDGTGVPGNGDNLKALIELKNQKTDIPGL----GNMSLSEGAAAIIST 392

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +      S      +  V +       N   VN  EE   L    Q+Y  + K+I   ++
Sbjct: 393 IGIASKQSKTEMEAASTVRDQAQNQRDNLSAVNQDEEAINLQIYMQAYQSNMKVISTGNQ 452

Query: 471 MLQTLLEG 478
           +   LL  
Sbjct: 453 IFSDLLGM 460


>gi|91794989|ref|YP_564640.1| flagellar hook-associated protein [Shewanella denitrificans OS217]
 gi|91716991|gb|ABE56917.1| Flagellar hook-associated protein [Shewanella denitrificans OS217]
          Length = 457

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 68/481 (14%), Positives = 157/481 (32%), Gaps = 33/481 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTV-------VTQRS 57
            + N  ++    ++    +   N+ NA    Y R+  MT+                  R 
Sbjct: 2   NMLNIGKSGLLASAASLNATSNNVANAMVAGYSRQQVMTSSVGGGAYGGGAGVYVDGVRR 61

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
            +       L   +S +G  ++  S+    E +       N  +  +  +  ++ S  + 
Sbjct: 62  ISDQYEVAQLWKTNSDVGFSKIQTSYLGQAEQVFG--ADGNDISKGLGLVFAAMNSAMEQ 119

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            +     + +I+  + +VQ  ++    +   R   + ++   +  +   L  ++  N  I
Sbjct: 120 PNLIAHRQGIINETKALVQRVHSINESLSSQREQINGQLGSSVKLVNTQLDIISKFNKDI 179

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
           +  +A         D RD  + +++ +I I  +      + +    G  L     +    
Sbjct: 180 RAASAIGTVPAALQDGRDAAINELASLIDIRVVEDAQGLVNISLEKGEPLIAGNTKATLS 239

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +     + +  I       S         G + +L+  RD+ +   Q  +DE+A+ L
Sbjct: 240 TVPDPLNPANSNISIQF---GKSQFVFENSVGGSMGSLMTYRDTQLANSQTYIDELAQHL 296

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+    +  +      +     +  ++      IS                      
Sbjct: 297 ANEFNNTLALGTDLSGAAPVKNFLSVNSVNPAGSLAISSGFTPEDLALG----------- 345

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
                  +    G    +       +K+  F     +   V+L E   + +G L      
Sbjct: 346 -------LDGTQGDNSNLKALAALASKSLGF---TSLGGAVSLGESFSSIVGALGSASRQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +      +  +       +++T GVN  EE   LI  +Q+Y  + K+I   +++ QT+L 
Sbjct: 396 AKADAKTNTDLHTEAKSQWASTSGVNPDEEGVNLIVYQQAYQANAKVITTAERLFQTVLN 455

Query: 478 G 478
            
Sbjct: 456 S 456


>gi|319403979|emb|CBI77567.1| Flagellar hook-associated protein FlgK [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 456

 Score =  197 bits (499), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 113/481 (23%), Positives = 216/481 (44%), Gaps = 26/481 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N A+N     + +  ++ RN+  A + NY RR +     P     V  R +  
Sbjct: 1   MSLNLALNSARNSLKATTGRLDTVSRNVVKAGDPNYTRRTSYLESGPGGAVHVVVRRDGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +S       L +       +   D ++NSP+  + + + +L+ Y+ +  +
Sbjct: 61  IHLLNNYLVKASEAAAAGSLSNGLNRLSDIYGSDRFSNSPSKLLGEFQKALQLYANDPQQ 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
              G   +D A ++ +  N  +RE++K   D + +I+  +  +   L +   ++  +  +
Sbjct: 121 RSNGDAAVDRARDLAKGLNAGSREIEKSYNDVNSDIQDSVDYINDLLQKFHELDQLVARE 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
             +  D   ++DQRD +L+++S+ IGI+T+  ++  M +Y  DG+TL++ +PR ++F+  
Sbjct: 181 RNANRDDSVYMDQRDAILKELSQEIGINTVNHSDGTMSIYGMDGSTLYDKMPRTVSFQFS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            S         IFIDGV +  +        G +  LL++RD ++P +Q QLDE+A  L+ 
Sbjct: 241 TSLPSGISGKQIFIDGVPLGHSSFIDPNGGGNLGGLLKLRDDIIPQYQKQLDEIANALMQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F     +  + E   G   A                               R   +   
Sbjct: 301 MFPGPPSLFLDGEQPSGQIGALEGLAG-------------------------RIQLNPIF 335

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                      + D +    DSFN+   F    G++   +++++ +NS+GWL+  RS++ 
Sbjct: 336 DSKTEGGGPEHFGDKLQELVDSFNEKQKFGTGTGLDLEQSIMDFGKNSVGWLQGLRSNAD 395

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +F H +E+ SN  GVN  +EL+ ++++EQ+Y  ++++I    KML  LL  V
Sbjct: 396 KEARYKGTMFLHAAEALSNATGVNTDDELALMLQLEQTYGATSRIISTVGKMLDDLLAAV 455

Query: 480 K 480
           +
Sbjct: 456 R 456


>gi|188579926|ref|YP_001923371.1| flagellar hook-associated protein FlgK [Methylobacterium populi
           BJ001]
 gi|179343424|gb|ACB78836.1| flagellar hook-associated protein FlgK [Methylobacterium populi
           BJ001]
          Length = 489

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 128/489 (26%), Positives = 206/489 (42%), Gaps = 9/489 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L    N A+      S Q A   RN+  A++  Y R+             VT      
Sbjct: 1   MGLTLALNTARASLLANSNQIAVSARNVAGANDPGYSRKIATLVAGSAGGATVTITRAGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS   +   L +          D    ++P   +S  + +L++ +     
Sbjct: 61  PALYARTLTASSDAARGDALLTGLTKLAQTIGDTDDTSAPAARLSIFQAALQAAANQPDN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  ++ A+ +  + N +A  V  +RA+AD  I   +  +   L      N A+   
Sbjct: 121 TQLARDAVEAAKALAGSLNQAADTVHAVRAEADAGIGDAVGRINDLLGRFDAANRAVVKA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   DA D LD RD +L  +S+ IG++ + R   DM +YT  G TLFE  PR + F   
Sbjct: 181 TALGGDATDALDDRDRILTALSQEIGLTAVSREGGDMALYTDGGVTLFERGPRTVAFSPT 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            ++T  +    + IDGV V+ +     +  G+I  L  +RD     ++ QLD +A  LI 
Sbjct: 241 ATFTAGTVGGSVTIDGVPVTGTASPMPLTSGRIAGLAALRDGTAVAYEAQLDAVAGGLIA 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKL-------CQGISETICVNPQYRSNPSFLR 352
           +F+E D    +     GLF A G   L              ++    V+P    N + LR
Sbjct: 301 AFAESDTSLIDDGPRAGLFTAGGSALLPTASAAGRTGLAASLAINAAVDPNRGGNLALLR 360

Query: 353 DGGSVSKKFLW-NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
            GG     +        A Y   +     + + +   DP  G+ T  +L E A  S GWL
Sbjct: 361 SGGMNGSDYDDPAAGGDAAYAGRLRGLVTALSSSKPVDPALGLGTASSLPELAAASAGWL 420

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
           E  R D+       + +    +E+ SN  GVN  +E +  +++E+SY+ S KLI   + +
Sbjct: 421 EAQRKDAATGAAYQKTLLTRANEALSNVAGVNGDDETALALQLERSYSASAKLIAVVNDL 480

Query: 472 LQTLLEGVK 480
           L+TLL+ V+
Sbjct: 481 LKTLLDAVR 489


>gi|168333624|ref|ZP_02691884.1| flagellar hook-associated protein FlgK [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 544

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 79/540 (14%), Positives = 161/540 (29%), Gaps = 65/540 (12%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----------SPENVTV 52
                 A +    A Q  +    NI N +   Y R++                     TV
Sbjct: 3   FGEITVAMSGLFAAQQGLSVTSSNINNINTPGYSRQEIKQEAWNPLPGGGVGMIGTGTTV 62

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
                      D+ +  +S  +G+  + Q   A+ E +   +  +   T   +   + L+
Sbjct: 63  TGVERVRDPFLDQKIWKYSDMLGEYSIKQEQTAIIENIFG-EPKDEGFTKIYTNFFNGLD 121

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             SK+ +       +          +N  A  + + ++D + ++++ +  +    S +  
Sbjct: 122 DLSKDPNTTEKASALRQYMIGFADYYNEMASGLSETQSDINAQLKITVDQINLMASRVQS 181

Query: 173 VNDAIKFKT-ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-------DG 224
           +N  I+         A++  DQRD  + ++S+ + I       +              +G
Sbjct: 182 LNGQIQNYELHGGKIANELRDQRDHCVDQLSQFVNIEAKEVEMHKPDGSVEKQFQVYVNG 241

Query: 225 TTLFETVP-RDINFEKMNSYTVTSESNPIF--IDGVVVSSNQGSAVPKGKIKALLQIRDS 281
            TL +    R +  E   +     + + ++  +       N  S    GK+K LL +RD 
Sbjct: 242 QTLVDHKDIRLLEVEPRETKKHPRDIDGLYDIVWDDKAVFNTTSEYFSGKLKGLLDVRDG 301

Query: 282 ---------------VVPIFQNQLDEMARVLIGSFSEKDPIA------------GNSENV 314
                           +P FQ++LD   R      +                   +    
Sbjct: 302 QGAGLDPITHKPVYTGIPYFQDRLDRFVRDFSKELNRIYNQGDIIDANGNREQILDDLGN 361

Query: 315 PGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWN---------- 364
           P   +     +  + +          N     N S   +     K    N          
Sbjct: 362 PVYALFSYRDEDTSAIIASNDPNFDYNKMTAENFSTSLEIIESDKNIRTNYEHRMDVIND 421

Query: 365 -----VKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                  N   Y +      D             + +  T  +Y  +    +  N S++ 
Sbjct: 422 PKLDPPYNSEIYYNPNPGNNDLLLDLMDQQNNQDVFSQGTPTDYMISIFSAMGVNASEAQ 481

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   + + I        GV+  EE   LIK   +Y IS K++   D +    +  +
Sbjct: 482 MYAKTQSNIISEIENQRMAVSGVDNNEEFMNLIKYNMAYQISAKVMSTLDNIYDITINRM 541


>gi|284041493|ref|YP_003391833.1| flagellar hook-associated protein FlgK [Conexibacter woesei DSM
           14684]
 gi|283945714|gb|ADB48458.1| flagellar hook-associated protein FlgK [Conexibacter woesei DSM
           14684]
          Length = 443

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 65/500 (13%), Positives = 144/500 (28%), Gaps = 91/500 (18%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S       +        Q   +   N+ NA+   + R++ +                   
Sbjct: 4   SSFMGLQTSLRGLIAHQQALNTTGHNVANANTPGFSRQEAIFGAMSALRLPTNSGTTGLG 63

Query: 47  ---PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                 V V+  R    +  D      +  +G            E+    +  ++     
Sbjct: 64  AQLGTGVDVLGIRRIRDSFLDLQFRGTNMQLGDASARTQSLEQVELSFG-EPSSSGINAL 122

Query: 104 ISKLRDSLESYSKNL-SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADAD---KEIELE 159
           + +  D+  + +            VI+ A  +   F T   ++ ++ A A     EI   
Sbjct: 123 LGRFWDAWSALASAPEEGSAARTAVIEMANTLAGAFQTVHAQLTRVAAQAQGKYDEITGP 182

Query: 160 ISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVV 219
             ++  +  EL  +N  I          +D +D+RD+L+ ++SE+  +S     +  + V
Sbjct: 183 AGDVDIWAQELAQLNRTIAHAVTVGQVPNDLMDRRDLLIDRLSELSQVSVTDVGDGSVRV 242

Query: 220 YTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIR 279
               G TL +                              +  Q      GK+ AL  + 
Sbjct: 243 -EFGGVTLVDPAAA-----------------------GGYTWPQTLTSRDGKLGALRDLA 278

Query: 280 DSVVP--IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISET 337
               P   F+++LD +A  L+   +      G  +                         
Sbjct: 279 SPTGPALSFRDRLDTVAADLVARVNALHRAPGGVDFFAP--------------------- 317

Query: 338 ICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
                                     +  ++      +     +               N
Sbjct: 318 ---------------------AGTTADRISVVATAATVVAGSTADRGRNDVANAIAQLRN 356

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            ++       +  +      +       Q + ++I +   +  GV+  EE++ +I+ ++ 
Sbjct: 357 GSINRTYSALVSEVGSVVRRASSAEAIQQSLVDNIDDRRQSVQGVSPDEEMTNMIRFQRG 416

Query: 458 YNISNKLIMFTDKMLQTLLE 477
           Y  S + +   D+ML TL+ 
Sbjct: 417 YQASARTMSTLDEMLDTLIN 436


>gi|326792656|ref|YP_004310477.1| flagellar hook-associated protein FlgK [Clostridium lentocellum DSM
           5427]
 gi|326543420|gb|ADZ85279.1| flagellar hook-associated protein FlgK [Clostridium lentocellum DSM
           5427]
          Length = 559

 Score =  196 bits (497), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 86/560 (15%), Positives = 186/560 (33%), Gaps = 82/560 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT---------------I 45
           MS ++   KA +    A +       N+ N + + Y R+  + +                
Sbjct: 1   MSSISSITKAVSGLAAAQKGLQVTGHNLSNVNTEGYTRQQLLQSESDYLVIGNRGSRYLQ 60

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
               VT    R     + DK L   +S +   +   S  A  E +  D+ Y    T  ++
Sbjct: 61  VGLGVTQDEIRQIRNELADKRLRTENSVLTYYQTQNSTIAEIEAIL-DEPYGEGVTKLLN 119

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
                 +  +   +     ++ I  A  +++  N  +  + K +A+ +KE+   ++ + +
Sbjct: 120 NFWSQTQKLNTTPNGVEERQSFISAANVLIKKINDISDSLDKFQANTNKEVISSVNRINQ 179

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
            +  +   ND I     +  +A+D+ DQR+ LL ++SE   ++      + +VV   +  
Sbjct: 180 IIEGIKEYNDIISRAEVNGDNANDYRDQRNNLLDELSEYGKVTYHEEVGSKVVVKFENHL 239

Query: 226 TLFETVPRDINFEKMNSYT----VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDS 281
            +       +  E+ ++ +             +     +         GK+KALL  R +
Sbjct: 240 VVDGPFTATMKLEEADTKSVFVKPVWSDTNSDVYRFDETVTSVKGNDTGKLKALLISRGN 299

Query: 282 ---------------------------VVPIFQNQLDEMARVLIGSFSEKDPIA--GNSE 312
                                      ++P  Q  L +   VL+ + +        G+ E
Sbjct: 300 NYVTEDTKWEDIAFNDNFSVDEPGNSFIIPKIQKMLSDFTGVLVETVNSCFDGTGIGSHE 359

Query: 313 NVPGLFIADGIKDL---------------DNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              G+ +   I                  D    +   E      +  +N +       V
Sbjct: 360 GKAGVPVFVPIISTQEYEAAKKNLETVLNDPTSTEDQKEAAQQAYEKAANKAMTTGNIQV 419

Query: 358 SKKFLWNV-------------KNLAGYPDLINHYCDSFNKNFIFDPVAGINTN-----VT 399
           + + L N               N  G    +  +   + K   +              V+
Sbjct: 420 NPELLANGGYNKLGTVSTEGASNNVGDSSKVTEFLSEWGKTREWYSDRSEKGAPNYKKVS 479

Query: 400 LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYN 459
           ++ +    +  +  + S+   +    Q    +I        GV+  EE + ++K + +YN
Sbjct: 480 IISFYSEFVTDIGTDGSNYSAVAKSRQTSILNIQNERQAMGGVSQDEEFANMLKYQYAYN 539

Query: 460 ISNKLIMFTDKMLQTLLEGV 479
            S ++I   D ML T++  +
Sbjct: 540 ASARMITMLDGMLDTIINKM 559


>gi|114762176|ref|ZP_01441644.1| flagellar hook-associated protein K [Pelagibaca bermudensis
           HTCC2601]
 gi|114545200|gb|EAU48203.1| flagellar hook-associated protein K [Roseovarius sp. HTCC2601]
          Length = 486

 Score =  196 bits (497), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 102/491 (20%), Positives = 184/491 (37%), Gaps = 18/491 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----SPENVTVVTQR 56
           MSL    + A +     S+    +  NI NA  ++Y RR    +     +   V +    
Sbjct: 1   MSLSGALSNALSGLTANSRSAGLVASNIANATTESYGRRTLDLSARTLGNSGGVWIDGVT 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
                          +  G    +QSF +  E +        S     +    +L S + 
Sbjct: 61  RNVDPAVLADRRLSDAQSGFADEMQSFASRVETLLGPTDTAGSLVGRYAAFETALLSAAT 120

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           + + D   K V   AE+     N  + E+Q  R DAD+ I  +++     L  ++ +N A
Sbjct: 121 DPASDQRLKLVAQRAEDFTTMLNQISVEIQDARTDADRSIGSQVTRFNTALGRVSELNTA 180

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET----VP 232
           I        D    +DQR  ++  +S+I+ + ++ R N  + +Y + GT L +      P
Sbjct: 181 ISDSLLRGGDPASLMDQRQRVIDDVSDIVPLRSVARENGAVALYAASGTVLLDPDFHSDP 240

Query: 233 RDINFEKMNSYTVT-----SESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQ 287
            +I+F   +  T          + + ++G  V+S+   A+  G + A  QIRD V P  Q
Sbjct: 241 VEISFTPQDPVTADLSIGAGTLSGLEVNGKAVNSSNDGALGGGTLGAQFQIRDIVAPDMQ 300

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
             +D +AR LI  F+   P +      PGLF   G                  +    + 
Sbjct: 301 AAIDGIARDLIERFAPGGPDSTLGATDPGLFTDAGTAFDPLDETGLAGRIALNSLVDPAG 360

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
               R            V+   G   L+  Y D+ +        A  +   +  ++  + 
Sbjct: 361 SGTWRLR----DGLGAAVQGPVGEARLLRGYSDALDALMSPGSAALGSGAQSFAQHVADF 416

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
              +   R  +      S      + E   +  GV+   EL  L+++EQ Y  + ++I  
Sbjct: 417 HAAIAAARLRADGEQSFSSAQNTALKELELSK-GVDTDAELQELLRIEQHYAANARVITT 475

Query: 468 TDKMLQTLLEG 478
            D+++QTL+  
Sbjct: 476 VDELMQTLMNI 486


>gi|307318930|ref|ZP_07598361.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           AK83]
 gi|306895344|gb|EFN26099.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           AK83]
          Length = 472

 Score =  196 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 150/481 (31%), Positives = 244/481 (50%), Gaps = 10/481 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    VV+      
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQVVSIYRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               K      S    Q  L S   + +     + Y +SP+ Y+S  R+SL++++     
Sbjct: 61  EALLKQNLIGISQSSAQSSLLSGLEIMKSALGGNDYESSPSTYLSAFRNSLQTFASTPGN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             +  TV+ +A ++  + + ++  VQ +R D+DK+I  E++NL R L++    N+A++  
Sbjct: 121 ATIAATVVSDASDLANSISKTSAAVQDLRLDSDKKIAEEVANLNRLLAQFETANNAVRQA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  DA   LD RD +L+++SE++GIST+ R NND V+YTS GT LFET+PR++ F   
Sbjct: 181 TAAGTDATAALDDRDKILKQVSELVGISTVTRANNDTVIYTSGGTVLFETLPREVTFAPK 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           ++Y  T   N IFIDGV ++   G     +GK+  LLQ+RD + P FQ+QLDEMAR L+ 
Sbjct: 241 SAYDATVTGNGIFIDGVPLAPGSGADTNAQGKLAGLLQLRDDIAPTFQSQLDEMARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F E                      +             ++    +  +          
Sbjct: 301 LFKE---------GGLPGLFTWSGGTVPAAGAVQPGLAASLSVNPAAKANPFLLRDGGFN 351

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             + N    AGY  L++ +  + + +  FD   G++   +++E+A +SIGW E+ RS + 
Sbjct: 352 GVVSNPDGNAGYTVLLDGFVTAMDGDMAFDGATGLDATSSIMEFAASSIGWFEQIRSGAS 411

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE V
Sbjct: 412 TADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLEAV 471

Query: 480 K 480
           +
Sbjct: 472 R 472


>gi|95929883|ref|ZP_01312624.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95134179|gb|EAT15837.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 552

 Score =  196 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 80/558 (14%), Positives = 181/558 (32%), Gaps = 86/558 (15%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           M L A  N  +     + +       NI N + + Y R++ +                 V
Sbjct: 1   MGLAAALNTGKTSLFASQKSIEVAGNNIANVNTEGYSRQNVVLGDIPSLEFGGFFVGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V     E     ++ L   S  +G +    +  A  E + +    N      I +  D+
Sbjct: 61  RVNNIEREYDVFINQQLLDKSQELGTEDAKSTPLAELERVFSVGDEN--LATEIDRFFDA 118

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  S N S ++    VI   E +  +FN+ AR++  +R++ +  +  EI ++   L+++
Sbjct: 119 WQELSTNPSGEVERDIVIQRGELLASSFNSLARDLDNVRSNINDTVASEIDDVNLKLNQI 178

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N  I+   A+   A+ F DQRD+LLQ+++  +G+ +    N  + +    G  L + 
Sbjct: 179 AELNTQIQNIEANGKSANSFRDQRDLLLQELTYTLGVQSYEEPNGAINIQLPGGLPLVQN 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                         +T     + ++    S         GK   L ++RD  +P  +  L
Sbjct: 239 GTALQLEATPRGEDLT-----LTLNIGESSFEVKGDNLGGKFNGLFELRDEFIPELKQNL 293

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY------ 344
           D  A  ++ + +         +   G+   +   +   +      +    +         
Sbjct: 294 DLTAYEMVQTVNSLHAQGVGLDGSTGVAFFNNPGNHTTQSYVDPDQATAFSAGDLSIEVD 353

Query: 345 ---------RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
                      + + L D  + +   +    N       +         + +    + + 
Sbjct: 354 GVANTVAFAGGSLNDLADTINTAALGVTATVNEQDDGTFVMVLRPDNAGDSVQLDTSAVG 413

Query: 396 TN-----------VTLLEYARNSIGWLEKNRSDSHDLHMKSQVV---------------- 428
            +             L+  +      +    S +   +  +  +                
Sbjct: 414 GSYEAPEFSMPNISDLIAVSIRDTSKVAAGNSSAPGDNTNALAISALKDEDTINGEDTFV 473

Query: 429 ---------------------------FNHISESYSNTVGVNLQEELSFLIKVEQSYNIS 461
                                         +      +VGV+++EE+  LIK ++ +  S
Sbjct: 474 SFYGKMAASVGIEAGQNRLAQSGAEDSLTQLKNLRDGSVGVSIEEEMISLIKFQRGFEAS 533

Query: 462 NKLIMFTDKMLQTLLEGV 479
            KL+   D+++ T++   
Sbjct: 534 AKLLSTVDELMVTVINIK 551


>gi|310644334|ref|YP_003949093.1| flagellar hook-associated protein flgk [Paenibacillus polymyxa SC2]
 gi|309249285|gb|ADO58852.1| Flagellar hook-associated protein FlgK [Paenibacillus polymyxa SC2]
          Length = 522

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 66/519 (12%), Positives = 156/519 (30%), Gaps = 47/519 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+      +    +   NI NA+ + Y R+                      
Sbjct: 3   STFHSIETAKRSLFTQTAALNTTGHNIANANTEGYTRQTVKMKASIPMEAYGINRSNVPG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V         +   D      ++ +G   +  +     + +  ++  +      +
Sbjct: 63  QLGTGVEFDAIERIREKFLDSQYRGENTELGSWTIRSNTLDKLQQIM-NEPSDTGIRKVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                S    SK+         V +NA  +    N  ++++  + AD    +E + S L+
Sbjct: 122 DNFYKSWSDLSKDPESVTARTIVKENALALTDAMNHMSKQLSNLSADLTSNVEAKSSELQ 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD- 223
            +++ +  +N +I        +A+D  DQRD+++ KIS+I+ ++    +    V      
Sbjct: 182 SYVNSIADLNQSITKIEGLGDNANDLRDQRDLIVDKISKIVNVTVTDTDQGYNVNMGGQA 241

Query: 224 ---------------------GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN 262
                                   L       + F +       +       + +   + 
Sbjct: 242 LVTGFEPTTGINGAFLQAAFASNDLQGGEVHGMIFSRDRFVADYTAQMDNLANTLATGNI 301

Query: 263 QGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAG---NSENVPGLFI 319
             +      +     +           L     V +   +    +     + +    +  
Sbjct: 302 TVTLPKGSVLPEGTVLNGVTYTGTNRTLQSDLTVTVKGLNGLHQLGYTQEDKDANGNMVA 361

Query: 320 ADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYC 379
                   N      +  I +N     NP+ +     V        + + G   L +   
Sbjct: 362 GKPFFVTSNNGGTITAGNITLNTAIVDNPNAIAASLRV-TGTAPTEELVKGNNTLASLMS 420

Query: 380 DSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNT 439
           +    NF            T+  +  + +G L     ++      S  + + +     + 
Sbjct: 421 NLKLSNFTSVST---GNTATIDSFFSSMVGQLGIEAQEATRQTQNSTALVSQVETMRQSV 477

Query: 440 VGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            GV+L EE+S +IK + +Y+ + + +   D++L  L+  
Sbjct: 478 SGVSLDEEMSNMIKFQHAYSAAARFMTTFDQLLDKLINS 516


>gi|270262395|ref|ZP_06190666.1| flagellar hook-associated protein FlgK [Serratia odorifera 4Rx13]
 gi|270043079|gb|EFA16172.1| flagellar hook-associated protein FlgK [Serratia odorifera 4Rx13]
          Length = 548

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 79/551 (14%), Positives = 176/551 (31%), Gaps = 77/551 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS  ++ N A +  N A    +++  NI N +   Y R+  +   +             V
Sbjct: 1   MS-NSLINTAMSGLNAAQVALSTVSNNISNYNVAGYNRQTAILAQNGGMSTMSGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           TV +   E        L    S  G Q     FE + ++ +      N+ +  +     +
Sbjct: 60  TVTSVNREYNQFITSQLRGAQSQAGAQN--AYFEKISQIDNLLASKTNTLSTNMQDFFSN 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   +TV+  A  +V  FN + + ++ + +  ++++      +  +  ++
Sbjct: 118 LQNLVSNAGDDAARQTVLGKANGLVNQFNNTDKYLRDMDSGVNQQLSDSAQQINSYSQQI 177

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ I     S  + +  LDQRD L+  +++++G+    ++ +   V  ++G TL + 
Sbjct: 178 AKLNEEITRLRGSGGEPNALLDQRDQLVTDLNKVVGVQVTQQDGDAYTVSFANGLTLVQG 237

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                      S   +  +   +  G   S      +  G +  +L+ R   +   +NQL
Sbjct: 238 NNAYQVAAVPTSGDPSRLTMG-YDRGNGASEIPEGQITGGSVSGVLKFRSESLDSARNQL 296

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGI--------------------------- 323
            ++A  +  SF+++     +     G                                  
Sbjct: 297 GQLALAMADSFNQQHRAGFDLNGDAGTDFFSFGGARAVDNNRNTGDAALSVSYTDTSKVK 356

Query: 324 -------KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLIN 376
                   D  N     + + + VN    ++ +          K   +          + 
Sbjct: 357 ANDYRVEFDGSNWQVSRLPDNVKVNATAGTDAAGNPTLSFDGLKVGIDGTAQKNDSFTVK 416

Query: 377 HYCDSFNKNFIFDPVAGINTNVTLLEYARN-----------------------------S 407
              D      +    +         +  R                               
Sbjct: 417 PVSDVAGSLKVAITDSANIAAAGKDDSGRGDNENAKKLLDLQTQKLVDGKATFSGAYASL 476

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           +  +    + +         +   +     +  GVNL EE   L++ +Q Y  ++K+I  
Sbjct: 477 VSSVGNQTASAKVTATSQGNIVKQLENQQQSISGVNLDEEYGELLRFQQYYMANSKVIQT 536

Query: 468 TDKMLQTLLEG 478
              +  TLL  
Sbjct: 537 ASTLFDTLLNI 547


>gi|126176150|ref|YP_001052299.1| flagellar hook-associated protein FlgK [Shewanella baltica OS155]
 gi|125999355|gb|ABN63430.1| flagellar hook-associated protein FlgK [Shewanella baltica OS155]
          Length = 457

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 77/485 (15%), Positives = 160/485 (32%), Gaps = 36/485 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT-------VV 53
           MS+    N  ++    +     +   N+ NA    Y R+  M +              V 
Sbjct: 1   MSM---LNIGKSGLLASMAALNATSNNVANAMVAGYSRQQVMLSSVGGGAYGSGAGVFVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +SA+G  ++  S+    E +   +   N+ +  + +L  +L S
Sbjct: 58  GVRRISDQYEVAQLWQTTSAVGFSKVQSSYLRQAEQVFGAE--GNNVSKGLDQLFAALNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +     + V++ A+ V Q  N     +   R   + ++   +  +   L+ +   
Sbjct: 116 SMEQPNLIAYRQGVLNEAKAVAQRVNAINDNIDSQRNQINGQLGSSVKEINSQLNIIASF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+  + +        D RD  +  ++ I+ I  +  +   + +  + G  L      
Sbjct: 176 NRDIQAASVTGTIPPALQDSRDAAIDDLAAILDIRVVEDSQGMVNISLARGEPLLTGNTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +     ++   I       + ++ +    G + ALL  RD  +   Q  +DE+
Sbjct: 236 AKLASAPDPANPKNDLVTIQFGSSQFNVDETA---GGSLGALLTYRDVQLADSQEYIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A +L   F+       +             +  +      ++     +            
Sbjct: 293 AVMLATEFNSILASGTDLNGATPSQDLFTYQANNPGGSLSLTAGFTPDKLAFGK------ 346

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    +       NK   F     + +N +L E   + +G L  
Sbjct: 347 ------------DGTQGDNTNLKALVQLANKELSF---TSLGSNTSLAESFSSKVGQLGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      S  +       +++T GVN  EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAISFAKTSVDLQKDAQSQWASTSGVNPDEEGINLIIYQQSYMANAKVISTADQLFQ 451

Query: 474 TLLEG 478
           T+L  
Sbjct: 452 TMLSS 456


>gi|304412502|ref|ZP_07394108.1| flagellar hook-associated protein FlgK [Shewanella baltica OS183]
 gi|307307161|ref|ZP_07586899.1| flagellar hook-associated protein FlgK [Shewanella baltica BA175]
 gi|304349144|gb|EFM13556.1| flagellar hook-associated protein FlgK [Shewanella baltica OS183]
 gi|306910400|gb|EFN40831.1| flagellar hook-associated protein FlgK [Shewanella baltica BA175]
          Length = 457

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/485 (16%), Positives = 161/485 (33%), Gaps = 36/485 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT-------VV 53
           MS+    N  ++    +     +   N+ NA    Y R+  M +              V 
Sbjct: 1   MSM---LNIGKSGLLASMAALNATSNNVANAMVAGYSRQQVMLSSVGGGAYGSGAGVFVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +SA+G  ++  S+    E +   +   N+ +  + +L  +L S
Sbjct: 58  GVRRISDQYEVAQLWQTTSAVGFSKVQSSYLRQAEQVFGAE--GNNVSKGLDQLFAALNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +     + V++ A+ V Q  N     +   R   + ++   +  +   L+ +   
Sbjct: 116 SMEQPNLIAYRQGVLNEAKAVAQRVNAINDNIDSQRNQINGQLGSSVKEINSQLNIIASF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+  +A+        D RD  +  ++ I+ I  +  +   + +  + G  L      
Sbjct: 176 NRDIQAASATGTIPPALQDSRDAAIDDLAAILDIRVVEDSQGMVNISLARGEPLLTGNTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +     ++   I       + ++ +    G + ALL  RD  +   Q  +DE+
Sbjct: 236 AKLASAPDPANPKNDLVTIQFGSSQFNVDETA---GGSLGALLTYRDVQLADSQEYIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A +L   F+       +             +  +      ++     +            
Sbjct: 293 AVMLATEFNSILASGTDLNGATPSQDLFTYQANNPGGSLSLTAGFTPDKLAFGK------ 346

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    +       NK   F     + +N +L E   + +G L  
Sbjct: 347 ------------DGTQGDNTNLKALVQLANKELSF---TSLGSNTSLAESFSSKVGQLGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      S  +       +++T GVN  EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAISFAKTSVDLQKDAQSQWASTSGVNPDEEGINLIIYQQSYMANAKVISTADQLFQ 451

Query: 474 TLLEG 478
           T+L  
Sbjct: 452 TMLSS 456


>gi|212709498|ref|ZP_03317626.1| hypothetical protein PROVALCAL_00540 [Providencia alcalifaciens DSM
           30120]
 gi|212687836|gb|EEB47364.1| hypothetical protein PROVALCAL_00540 [Providencia alcalifaciens DSM
           30120]
          Length = 546

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 77/547 (14%), Positives = 163/547 (29%), Gaps = 74/547 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           L  V N A +  N A    + I  N+ NA    Y R+  +   +                
Sbjct: 2   LNNVMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYF 61

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              R E     +       +  G            + +  +D  +   +  I     +L+
Sbjct: 62  SHVRREFDEFVNAQYSQSRARSGDYEAYVKNCNKVDDLLTNDIED--LSGSIGSFFTALD 119

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           S S + S+  L    +  +  +V  F  + R++Q++  D +++IE ++ ++  +  ++  
Sbjct: 120 SASSDASDKTLIDVFLGQSNALVSQFKEADRQLQEMERDINRQIENKVKDINIYAEKIAG 179

Query: 173 VNDAIKFK-TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           +N  I    + S  + +D LD RD L+ +++ +IG+  I + N +  V  ++G  L    
Sbjct: 180 LNQQIARVRSVSGSEPNDLLDVRDRLVNEVNSVIGVKVIEQ-NGNYNVTFANGLPLVTGE 238

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
             +      +S   +  S         V      A   G++  +L+ R  V+     +++
Sbjct: 239 KANRLEAMPSSKDDSRFSIGFVGANDQVREIPDEAFKGGELSGVLRSRQEVLDPAYQKIN 298

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS-- 349
           ++A V    F+E      +S    G       K           +T         +    
Sbjct: 299 KLALVFATKFNEIHQKGFDSNGETGKDFFAIGKGSVVSNTFNTGKTDFDLSYSDVSQVTG 358

Query: 350 ----------------------------------------FLRDGGSVSKKFLWNVKNLA 369
                                                    +                  
Sbjct: 359 KNYEMRFDGGKWNVTRLPDGVEVKVDTSTPGSLKFEGIELKITTNNPNQGDTFVVKPMNG 418

Query: 370 GYPDLINHYCDSFNKNFIFDPVAGINTN------------------VTLLEYARNSIGWL 411
              ++     DS          AG   N                   T  ++    +  +
Sbjct: 419 VINNMQTLVTDSAQFAKAGSKDAGPGDNENIKELVKLQDQKLIDGGSTFSDFYATLVNDV 478

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
                 +         +            GVN+ EE   + K++Q +N + +++   D +
Sbjct: 479 GSRTKQAQIDSETQNKMTESFYRQEQEISGVNMNEESIQMQKIQQFFNANAQVLKTVDDL 538

Query: 472 LQTLLEG 478
              L+  
Sbjct: 539 FNALMRA 545


>gi|163735544|ref|ZP_02142976.1| flagellar hook-associated protein K [Roseobacter litoralis Och 149]
 gi|161391164|gb|EDQ15501.1| flagellar hook-associated protein K [Roseobacter litoralis Och 149]
          Length = 481

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 93/486 (19%), Positives = 178/486 (36%), Gaps = 17/486 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           MS+    + A      A +    I  N+ NA    Y  R+   + S    V +       
Sbjct: 1   MSISGALSNAMTGLRAAGRTSEVISANLANAMTPGYGVRNLSLSSSQLGGVAIDGVMRSV 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                  L    ++ G       F    E +       +S    +++   +L + +    
Sbjct: 61  DPSLLADLRLADASFGNATDRTKFLNDFENLLGTPDQADSLAGRMAEFETTLITAASRPD 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                  V+D A ++    + ++  VQ+ R+DAD+ I+++I  L   L  +  +N  I  
Sbjct: 121 APERLNGVVDAARDIANLISAASDGVQQARSDADRSIQVQIDRLNTSLQNVKELNSQITR 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
             ++  DA    D R  ++ +I+ I+ +  + R+N  + +Y++ G  L +    +I F  
Sbjct: 181 TISTGSDASALFDSRQAIVDEINAIVPVRLVPRDNGQIALYSTGGAILLDGGVAEIEFNA 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVP------KGKIKALLQIRDSVVPIFQNQLDEM 293
           +N  T         + G+ V+               G + A  +IRD +    Q QLD  
Sbjct: 241 VNQVTPFMTLGNGTLSGLSVNGYPVRTDSARGTLGGGTLGAQFEIRDELGTSAQTQLDAF 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLD---NKLCQGISETICVNPQYRSNPSF 350
           AR L+  F +       +   PG+F   G+         L   +     V+ +       
Sbjct: 301 ARDLVERFQDPAVDPSLAAGDPGIFTDAGVAFDPLNEVGLSARLGINADVDERQGGESWR 360

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           +RD                G   LI    D+               + + +         
Sbjct: 361 IRD------GVNAVTPGDVGDARLIQSLSDTLTAKRTPASGEFGAGSFSAMNLISTLTSQ 414

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +  +RS +      +   F+ +++      GV+  +EL  L+ VEQ+Y  + ++I   D+
Sbjct: 415 VGSDRSRAEQSLSFASSQFDELTQQILAN-GVDSDQELQRLLIVEQAYAANVRMIEAADE 473

Query: 471 MLQTLL 476
           M+QT+L
Sbjct: 474 MMQTIL 479


>gi|10998529|gb|AAG25959.1|AF300968_1 FlgK [Sinorhizobium meliloti]
          Length = 472

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 150/481 (31%), Positives = 246/481 (51%), Gaps = 10/481 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    VV+      
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQVVSIYRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               K      S    Q  L S   + +     + Y +SP+ Y+S  R+SL++++     
Sbjct: 61  EALLKQNLIGISQSSAQSSLLSGLEIMKSALGGNDYESSPSTYLSAFRNSLQTFASTPGN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             +  TV+ +A ++  + + ++  VQ +R D+DK+I  E++NL R L++    N+A++  
Sbjct: 121 TTIAATVVSDASDLANSISKTSAAVQDLRLDSDKKIAEEVANLNRLLAQFETANNAVRQA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  DA   LD RD +L+++SE++GIST+ R NND V+YTS GT LFET+PR++ F   
Sbjct: 181 TAAGTDATAALDDRDKILKQVSELVGISTVTRANNDTVIYTSGGTVLFETLPREVTFAPK 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           ++Y  T   N IFIDGV +++  G+    +GK+  LLQ+RD + P FQ+QLDEMAR L+ 
Sbjct: 241 SAYDATVTGNGIFIDGVPLAAGSGADTSAQGKLAGLLQLRDDIAPTFQSQLDEMARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F E                      +             ++    +  +          
Sbjct: 301 LFKE---------GGLPGLFTWSGGTVPAAGAVQPGLAASLSVNPAAKANPFLLRDGGFN 351

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             + N    AGY  L++ +  + + +  FD   G++   +++E+A +SIGW E+ RS + 
Sbjct: 352 GVVSNPDGNAGYTVLLDGFVTAMDGDMAFDGATGLDATSSIMEFAASSIGWFEQIRSGAS 411

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE V
Sbjct: 412 TADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLEAV 471

Query: 480 K 480
           +
Sbjct: 472 R 472


>gi|150395504|ref|YP_001325971.1| flagellar hook-associated protein FlgK [Sinorhizobium medicae
           WSM419]
 gi|150027019|gb|ABR59136.1| flagellar hook-associated protein FlgK [Sinorhizobium medicae
           WSM419]
          Length = 472

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 147/481 (30%), Positives = 247/481 (51%), Gaps = 10/481 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    +V+      
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQIVSIYRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               K      S    Q  L S   + +     + Y ++P+ Y+S  R+SL++++     
Sbjct: 61  EALLKQNLISISQSSAQSSLLSGLEIMKSALGGNDYESAPSTYLSAFRNSLQTFASTPGN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             +  TV+ +A ++  + + ++  VQ +R D DK+I  +++NL R L++    N+A++  
Sbjct: 121 ATIAATVVSDASDLANSISRTSAAVQDLRLDTDKKIAEDVANLNRLLAQFETANNAVRQA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  DA   LD RD +L+++SE++GIST+ R NND V+YT+ GT LFET+PR++ F   
Sbjct: 181 TAAGTDATAALDDRDRILKQVSELVGISTVTRANNDTVIYTAGGTVLFETLPREVTFAPK 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQG-SAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           ++Y  T   N IFIDGV +++  G     +GK+  LLQ+RD + P FQ QLDEMAR L+ 
Sbjct: 241 SAYDATVTGNGIFIDGVPLAAGNGADTNAQGKLAGLLQLRDDIAPTFQTQLDEMARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F E                     ++             ++    +  +          
Sbjct: 301 LFQE---------GGLPGLFTWSGGNVPAAGAVEAGIAAYLSVNPAAKSNPFLLRDGGFN 351

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             + N  N AG+ DL++ +  + + +  FD  AG++   +++E+A +S+GW E+ RS + 
Sbjct: 352 GIVSNPGNNAGFTDLLDSFVAAMDGDMAFDSAAGLDGTSSIMEFAASSVGWFEQIRSGAS 411

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE V
Sbjct: 412 TADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLEAV 471

Query: 480 K 480
           +
Sbjct: 472 R 472


>gi|15964433|ref|NP_384786.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           1021]
 gi|307311575|ref|ZP_07591216.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           BL225C]
 gi|15073610|emb|CAC45252.1| Putative flagellar hook-associated protein [Sinorhizobium meliloti
           1021]
 gi|306899592|gb|EFN30221.1| flagellar hook-associated protein FlgK [Sinorhizobium meliloti
           BL225C]
          Length = 472

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 150/481 (31%), Positives = 246/481 (51%), Gaps = 10/481 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    AQ+  +  +QQ A++ +NI N+ N +Y RR  M   +P    +V+      
Sbjct: 1   MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQIVSIYRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               K      S    Q  L S   + +     + Y +SP+ Y+S  R+SL++++     
Sbjct: 61  EALLKQNLIGISQSSAQSSLLSGLEIMKSALGGNDYESSPSTYLSAFRNSLQTFASTPGN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             +  TV+ +A ++  + + ++  VQ +R D+DK+I  E++NL R L++    N+A+K  
Sbjct: 121 ATIAATVVSDASDLANSISKTSAAVQDLRLDSDKKIAEEVANLNRLLAQFETANNAVKQA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  DA   LD RD +L+++SE++GIST+ R NND V+YTS GT LFET+PR++ F   
Sbjct: 181 TAAGTDATAALDDRDKILKQVSELVGISTVTRANNDTVIYTSGGTVLFETLPREVTFAPK 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           ++Y  T   N IFIDGV +++  G+    +GK+  LLQ+RD + P FQ+QLDEMAR L+ 
Sbjct: 241 SAYDATVTGNGIFIDGVPLAAGSGADTSAQGKLAGLLQLRDDIAPTFQSQLDEMARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F E                      +             ++    +  +          
Sbjct: 301 LFKE---------GGLPGLFTWSGGTVPAAGAVQPGLAASLSVNPAAKANPFLLRDGGFN 351

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             + N    AGY  L++ +  + + +  FD   G++   +++E+A +SIGW E+ RS + 
Sbjct: 352 GVVSNPDGNAGYTVLLDGFVTAMDGDMAFDGATGLDATSSIMEFAASSIGWFEQIRSGAS 411

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +     E+  +  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE V
Sbjct: 412 TADDNKAALLARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLEAV 471

Query: 480 K 480
           +
Sbjct: 472 R 472


>gi|163744345|ref|ZP_02151705.1| Flagellar hook-associated protein [Oceanibulbus indolifex HEL-45]
 gi|161381163|gb|EDQ05572.1| Flagellar hook-associated protein [Oceanibulbus indolifex HEL-45]
          Length = 468

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/480 (17%), Positives = 179/480 (37%), Gaps = 13/480 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MS+ + FN A++  +    + + +  NI NA  + Y RR+ +       V +     +  
Sbjct: 1   MSISSAFNIARSGLSTTEGRASLVAGNIANAQTEGYARREAVQVTGNNTVDL-RVARQVD 59

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                +    S+ +G   +         +   +     SP   +++ +  L+  + N S+
Sbjct: 60  ERLAGMTRGASAQLGAASVTGEVLGSYLLTLGEPGDEVSPAARLAEFQAGLDLLANNPSD 119

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
                 ++  +E +V + N +A  ++  R  A       +S +   L+++  +N+ ++  
Sbjct: 120 PAAQNDLLSRSETLVNSVNQAAVALEASRVQAGDSFVQSVSEVNEALADIAELNERLRLV 179

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
                     +D+ +  L  +   +   +   ++  + ++T+ GT L             
Sbjct: 180 GGDGTGKAGLMDEMNRRLDALGSQMDFQSRWESDGSLTLHTTGGTELVHGDKAVRLTANR 239

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
            + T+ + +  I         +       G++  L  +  + +P  + QLDE AR L+ S
Sbjct: 240 ETGTLMAGNIDITPGRATARGS-----DSGRLAGLSGLIANDLPQMKLQLDEFARGLVQS 294

Query: 301 FSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
           F   D         +             + L   +S    V+P        LRD      
Sbjct: 295 FEAADASVGAGQPGLFTDAGGAFDATALDGLAGRLSINNSVHPDKGGALWRLRD------ 348

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                ++   G    +N + D       FD   G++T   L ++  + +      R  + 
Sbjct: 349 GAGATIQGEPGDTTQLNAFVDVLETGITFDAATGLSTTARLGDFGADMVSQQNVLRVGAD 408

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                ++V      ++ S+  GVN+  EL  L+++EQ+Y  + +++     ML TLL  V
Sbjct: 409 AQAETARVRLVTFEDNRSSIEGVNIDTELQKLLEIEQAYGANAQVLSSLTDMLDTLLASV 468


>gi|126730122|ref|ZP_01745934.1| flagellar hook-associated protein K [Sagittula stellata E-37]
 gi|126709502|gb|EBA08556.1| flagellar hook-associated protein K [Sagittula stellata E-37]
          Length = 482

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 103/489 (21%), Positives = 178/489 (36%), Gaps = 18/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP----ENVTVVTQR 56
           MSL    N A +     ++  + I  NI NA N+ Y RR              V V    
Sbjct: 1   MSLTGALNAAVSGLKANTRAASLISTNISNATNEAYGRRTLELNALGSGTRGGVLVAGVV 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
            +   +      A  S +     + +F    E +  +   + S T  I+   ++L S S 
Sbjct: 61  RQYDPVLMADRMASDSQLAGGNDMYAFAKRMETLVGESGTSGSLTSRITAFENALLSASS 120

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N +     + V   A ++    N  + EVQ  R  AD  I  ++S L   +S L  +ND 
Sbjct: 121 NPASAQRLELVAVTATDLTNAVNDLSNEVQLARQTADTTIAKQVSTLNAAVSRLAAINDI 180

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           ++   AS  +    LD+R  LL +IS I+ +  + R+   + ++T  G  L +    +I 
Sbjct: 181 VRSAEASGTETASILDERQALLNEISGIVPLRVVERDRGQIAIFTRRGGVLLDGKAYEIG 240

Query: 237 FEKMNSYTVTSE-----SNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
           F    +   ++       + + ++G  ++S+       G + A  ++RD      Q +LD
Sbjct: 241 FSTTGTIDASTTLGSGGLSGLTLNGAPINSSFNGMFAGGSLAAQFELRDVTAVGRQAELD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGI--SETICVNPQYRSNPS 349
            +AR LI       P        PG F  +GI                  +         
Sbjct: 301 GIARDLIERLGPGGPDTTLGATDPGFFTDNGIAFTAANETGIAGRISLNALLAPAGGGTW 360

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
            +RD                G   LI    D+   + +    +  +   T ++       
Sbjct: 361 RIRD------GIGAAAPGEVGDAALIQDIADALGASNVPGSASLPSIARTFIDQVSQFSS 414

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +   R  S +           + E    T GV+  +EL  L++VEQ Y  + K+I   D
Sbjct: 415 SVAGERVRSENAFTFLSAQNRALREMEL-TKGVDTDQELQKLMQVEQYYTANAKVISTVD 473

Query: 470 KMLQTLLEG 478
            + + LL  
Sbjct: 474 DLFERLLSI 482


>gi|296102902|ref|YP_003613048.1| flagellar hook-associated protein FlgK [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057361|gb|ADF62099.1| flagellar hook-associated protein FlgK [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 545

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 73/546 (13%), Positives = 168/546 (30%), Gaps = 72/546 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           + ++ N A +  + A     ++  NI + +   Y R+ T+   S             V V
Sbjct: 1   MSSLINSAMSGLSAAQAALNTVSNNISSYNVAGYTRQTTVLGASNSTLTGGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + + +D    NS +  +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTTRYQQMSKIDDVLSD--STNSLSTTLQDFFKSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    +TV+  A+ +V  F T+ + ++   +  +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQTVLGKADGLVNQFKTNDQYLRDQDSQVNTAIASSVEQINNYAKQIAN 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    +D LDQRD L+ ++++I+G+   V++     V   +G +L + 
Sbjct: 179 LNDQISRLTGVGAGSSPNDLLDQRDQLVSELNQIVGVEVAVQDGGTYNVSFGNGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
              +      +S   T  +     +           V  G +  L   R   +   +N L
Sbjct: 239 SKANQLAAVKSSADPTRTTIAYSDEVSGNVEIPEKMVTTGSLGGLFTFRSEDLDKARNNL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP-------- 342
           +++A     + +++     ++    G  + D          +                  
Sbjct: 299 NQLALAFADAMNKQHEAGFDANGDAGGKLFDFGSPAVVTNSRNTGTAAMTATVADSTKVQ 358

Query: 343 ------QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD------- 389
                 Q+      +      S     +      +  L  +   S N    F        
Sbjct: 359 ATDYKLQFNGTDWTITRSDKTSFTMAPDASGNLSFDGLSVNVTGSANAKDSFIVKPVSDV 418

Query: 390 -------------------------------------PVAGINTNVTLLEYARNSIGWLE 412
                                                    +  N T  +   + +  + 
Sbjct: 419 IVNMELKFKDESKLAMASASNGGESDNRNGQKLLDLQNSKVVGGNKTFNDAYASLVSTVG 478

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            + +           V   +++   +  GVNL EE   L + +Q Y  + +++     + 
Sbjct: 479 SSTAALKTSSETKANVATQLTKQQQSISGVNLDEEYGNLQRYQQYYLANAQVLQTASTLF 538

Query: 473 QTLLEG 478
             ++  
Sbjct: 539 DAIINI 544


>gi|225849064|ref|YP_002729228.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644050|gb|ACN99100.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 483

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 80/491 (16%), Positives = 176/491 (35%), Gaps = 23/491 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSLL + + A        +   S  +NI NA  + Y R   +    P   V +       
Sbjct: 1   MSLLGILSTAGQSLLTFQRGINSTNKNISNATTEGYNREVPVFQDFPRSGVFMNKIIRVF 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                      +  +          +  E M  +D   +  +  ++   +S+        
Sbjct: 61  DRSLFNRSIELNQQLNSDNSFSEILSNIETMF-NDTLGSGFSSDLNNFFNSINDMLIKPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +       + NA+ +V    +    +   + D   ++  ++  + +   +L  +N  IK 
Sbjct: 120 DIAARSQFLANAQTLVGKIRSINDSLDNQKQDITLKVRDQVKQINQITDQLAKLNQTIKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD-INFE 238
           KT      +++L++RD L++++S++I    +   +N + V+T+ G  L   +    ++FE
Sbjct: 180 KTLDIEANNEYLNERDRLIKQLSDLIDTKVVFNEDNTVNVFTAKGYGLVVGIQSTPLSFE 239

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              +     + N +      +++   +    G +K +  I D       N+L++   V  
Sbjct: 240 TDTNGNPVVKWNGV----ADITTEIQNGQLGGNLKGIKSINDQ-----LNKLNDFTTVFA 290

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNK----LCQGISETICVNPQYRSNPSFLRDG 354
             F++        +    L          +         ++ T         N ++L   
Sbjct: 291 TVFNKVHKKGYGLDGSTNLDFFTIDPSKSSTKIDASNIYLNITDPKKVALAQNSTYLNSD 350

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYC------DSFNKNFIFDPVAGINTNVTLLEYARN-S 407
            +  K  L    N+       +          +   +           + T  E+     
Sbjct: 351 NTNGKDLLGLKNNIRVLYTNPSQPVLTPAEEAALQSSLNDSTNYTYIKDHTFAEFYNTKL 410

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           +  +    S        ++ +++ I+E   N  GVN+ EEL  L K+++SY  S ++I  
Sbjct: 411 VADISSTSSYIKQQQQNNKYLYDAITEKMKNIAGVNMDEELINLSKLQRSYQASARIITV 470

Query: 468 TDKMLQTLLEG 478
           TD+++QT+L  
Sbjct: 471 TDELMQTILNL 481


>gi|170744544|ref|YP_001773199.1| flagellar hook-associated protein FlgK [Methylobacterium sp. 4-46]
 gi|168198818|gb|ACA20765.1| flagellar hook-associated protein FlgK [Methylobacterium sp. 4-46]
          Length = 483

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 122/484 (25%), Positives = 209/484 (43%), Gaps = 6/484 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M L      A++    +S Q A   RN+  A +  Y R+          VT V+    + 
Sbjct: 1   MGLSLALATARSSLLASSTQIAVSSRNVAGASSAGYSRKIATLVPGTGGVT-VSITRASD 59

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                 + + +S +   + L       +    D     S    +S L  +L+S +    +
Sbjct: 60  AALYARMISATSDLAGSQQLLRGLQSLQQTVGDPQSTTSAAARLSALAAALQSAANRPDD 119

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             L +  +D A ++  + N +A  V + +ADAD  +   ++ +   LS+  + N A+   
Sbjct: 120 ATLARAALDKARDLAASLNQAAGAVARTQADADAAMGESVTRISDLLSQFDLANKAVMRG 179

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA   D  D LD RD ++ K+SE +G++ + R   D+ +YT  G  L++ +PR ++F   
Sbjct: 180 TALGADVTDALDSRDQIIAKLSEELGVTVVPREGGDVALYTDSGVPLYDRIPRKVSFAAT 239

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +Y   +  N + IDGV V+  N    +  G +  L Q+RD   P +  QLDE+A  LI 
Sbjct: 240 PTYQSGTTGNAVIIDGVAVTGPNSPMPLRSGTLAGLSQLRDVAAPAYAAQLDEIASALIA 299

Query: 300 SFSEKDPIAG-NSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
           +F E     G +   +        +      L   I+    V+PQ   +P+ LRDGG   
Sbjct: 300 TFRETSSSGGADLAGLFRNGSTSALPSSKAGLAAAITLNAAVDPQRGGDPALLRDGGMNG 359

Query: 359 KKFLWNVKNLA---GYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
             +  N         Y   +     + +         G   ++ L EYA  S GWLE  R
Sbjct: 360 AAYRSNPAAAGSGTAYAGRLTALVAALSAKQSLGSAPGPTGSMALAEYAGASAGWLESQR 419

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
             +     +   +    S++ SN  GVN  +E +  +++E+SY  S KL+   D++ +TL
Sbjct: 420 KVASSTVDQQTTLLGRASDALSNVTGVNTDDETALTLQLERSYQASAKLVTLIDELFKTL 479

Query: 476 LEGV 479
           +  V
Sbjct: 480 MNAV 483


>gi|328470107|gb|EGF41018.1| flagellar hook-associated protein FlgK [Vibrio parahaemolyticus
           10329]
          Length = 457

 Score =  194 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 67/481 (13%), Positives = 154/481 (32%), Gaps = 39/481 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRS 57
           N A +  N          +N+ + +   Y R+  +             S   V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVASVNTPGYSRQQALMATVGDGKSNRLSSGMGVEVTSIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  K   + +S         S  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLVKQTWSTNSLAAYAAGYTSSMSQLENTLG--ADGFSISAGLDSLNAALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ +E + + FNT  + +     D + +    +++    +S +  VN  I
Sbjct: 123 PESMPYRQQIINESEALARRFNTLTQSLHNQHKDMNDQRSAALTHANSLMSNIAHVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+R+ L+ ++S++I + T  + +  M V    G  L          
Sbjct: 183 VEMQGTGGNPAQLMDKRENLIGELSQVIEVKTTDQPDGSMQVTLVSGQPLVMGSDFGQLS 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +         GK+ A+   +  V+   Q  LD+MA+ L
Sbjct: 243 AIPDPSDPYLADLHVNFANQSFAIGDS---VGGKLGAINDYQTDVLKPNQVALDDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++       + +   G  + +   D                         L      
Sbjct: 300 ADEYNAVLATGKDLKGNAGKPLFNYDPDNPAAS--------------------LTITDLS 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
           +++  ++     G  +++    D  NK            +V+L +   + +G        
Sbjct: 340 AEELAFSSDGTPGNANVLKSLIDLSNKPV----AVTGYGSVSLNDAFTSMVGQTAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L+
Sbjct: 396 ADADYQAKLAMSKQAHTARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVLQ 455

Query: 478 G 478
            
Sbjct: 456 L 456


>gi|323492332|ref|ZP_08097485.1| flagellar hook-associated protein FlgK [Vibrio brasiliensis LMG
           20546]
 gi|323313379|gb|EGA66490.1| flagellar hook-associated protein FlgK [Vibrio brasiliensis LMG
           20546]
          Length = 457

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 66/479 (13%), Positives = 148/479 (30%), Gaps = 39/479 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN----------VTVVTQRS 57
           N A +  N          +N+ N +   Y R+  M T               V V + R 
Sbjct: 5   NIALSGLNANRVALDVTAQNVSNINTPGYSRQQAMMTSVGAGKYDKLSAGMGVEVASIRR 64

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                  +   + +S         +  +  E          S +  +  L  +L   +  
Sbjct: 65  VTDQFLIQQTWSTNSLSAYATRYTTNMSQLENTLG--ADGFSLSAGLDTLFSALNDATVK 122

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  + +I+ AE + + FNT    +     D   +    +S+    ++ +  VN  I
Sbjct: 123 PESIPYRQQIINEAEALSRRFNTLTESLHNQHKDMSDQRSAAVSHANSLMTNIADVNKQI 182

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
                +  +    +D+RD L+ ++S+++ + T  + +  + V  + G  L          
Sbjct: 183 VEMQGTGGNPAQLMDERDALIGELSKVVEVKTTAQADGSLQVTLASGQPLVMGSDAGQLK 242

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +          +       +    +    G+I A+   +  V+  +Q  +++MA+ L
Sbjct: 243 AVPDPSDAYLADMQVEFGNQSFAI---TGSTGGQIGAINDFQTEVLKPYQVAINDMAKAL 299

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              F+       +     G  +                             S L   G  
Sbjct: 300 ADEFNNVLATGTDLNGNAGSALFSYDPANPA--------------------SSLTVTGID 339

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
             +   +     G  D ++      NK            +++L +     +G        
Sbjct: 340 PDELALSGDGNPGNADTLDALIAISNKAVTV----TGFGSLSLNDAFTAMVGETAIKARQ 395

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           +   +     +      +  N   VN  EE + L+    ++N + K+I   +++  ++L
Sbjct: 396 ADADYQAKLAINQQAIAARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLFDSVL 454


>gi|308071106|ref|YP_003872711.1| flagellar hook-associated protein [Paenibacillus polymyxa E681]
 gi|305860385|gb|ADM72173.1| Flagellar hook-associated protein [Paenibacillus polymyxa E681]
          Length = 526

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 73/523 (13%), Positives = 163/523 (31%), Gaps = 51/523 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-----------------T 44
           S       A+   N  +    +   NI NA+   Y R+                      
Sbjct: 3   STFHGIETAKRSLNTQTAALNTTGHNISNANTAGYSRQVVSMKASDSMEAYGLNRSVVRG 62

Query: 45  ISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V         +   D      SS+ G   +        E +  ++  +      +
Sbjct: 63  QMGTGVEFTAIERVRQTFLDDQYRNESSSQGGWDIRYDTLNKLETIM-NEPSDTGIRKVM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               D+    S++  +    K V +    +    N +++++  + +D    + L+ S + 
Sbjct: 122 DNFWDAWSDLSQDPQDVTNRKIVKETTLALTDAMNQTSKQLDALSSDLTTNVTLKTSEMN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY---- 220
             L  +  +N  I        + +D  DQRD  + K+S++  +     +N   V      
Sbjct: 182 SLLQSVADLNSNIYKLEQLGDNPNDLRDQRDYAVDKLSKLANVQVTQLDNGYQVTVAGQI 241

Query: 221 ----------------------TSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVV 258
                                 T  G  ++  +     +       +   +N +    + 
Sbjct: 242 AVAGTEVTAITAAGLEAAYQGGTLTGGEVYGMILSRDKYVADYKTQMDQLANTLANGNIE 301

Query: 259 VSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL---IGSFSEKDPIAGNSENVP 315
           ++   G+ +P+G +        +V     N    +   L   +   +    +        
Sbjct: 302 ITLPAGTVLPEGTVLNSGVNNAAVTYSNANNNRTLTADLKVTVQGINGLHQLGYTLSGTT 361

Query: 316 GLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLI 375
                      D       +  I +N   + +P+ +     V      N K   G   L 
Sbjct: 362 PQKGGAFFTSKDGAA--ITAGNITLNKDIQDDPNKIASSLRVDGTGTANEKVTVGNNALA 419

Query: 376 NHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
                  N  F F+         T+ ++    +G L     ++      +Q++   +  +
Sbjct: 420 LSMASLKNVKFGFN--TTQAQTTTVDDFFSAIVGQLGVQTQEAERQSQNAQLLTEQVDLN 477

Query: 436 YSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
             +  GV+L EE+S +IK + +Y+ +++ +   D++L  L+ G
Sbjct: 478 RQSVSGVSLDEEMSNMIKFQHAYSAASRFMTTFDQLLDKLING 520


>gi|291326355|ref|ZP_06124197.2| flagellar hook-associated protein FlgK [Providencia rettgeri DSM
           1131]
 gi|291314693|gb|EFE55146.1| flagellar hook-associated protein FlgK [Providencia rettgeri DSM
           1131]
          Length = 562

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 72/548 (13%), Positives = 167/548 (30%), Gaps = 75/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           L  V N A +  N A    + I  N+ NA    Y R+  +   +                
Sbjct: 17  LNNVMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYF 76

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              R E     +       +  G            + +  +D  +   +  I     +L+
Sbjct: 77  SHVRREFDEFINAQYSQSRARSGDYEAYVKNCNKVDDLLTNDIED--ISSNIGSFFTALD 134

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + S + S+  L    + N+  ++  F  + R +Q++  D + +IE ++ ++  +  ++  
Sbjct: 135 AASSDASDKTLIDVFLGNSNALLGQFKEADRRLQEMERDINHQIENKVKDINIYAEKIAG 194

Query: 173 VNDAIKFK-TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           +N  I    + S  + +D LD RD L+ +++ ++G+  I + N +  V  ++G  L    
Sbjct: 195 LNQQISRIRSVSGSEPNDLLDVRDRLVNEVNSLVGVKVIEQ-NGNYNVTFANGLPLVTGE 253

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
             +      +S   +  S                +   G++  +L+ R  V+     +L+
Sbjct: 254 KANRLEAVPSSKDDSRFSIGFVGANGQAREIPDESFRGGELSGILRSRQEVMDPAYQKLN 313

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQG---------------ISE 336
           ++A V    F+E      ++    G    +  K                        ++ 
Sbjct: 314 KLALVFATKFNEVHSKGYDANGNTGKDFFEIGKGSVVSNTHNSGKADFDLSYSDVSKVTG 373

Query: 337 TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNL---------------------------- 368
                    +  +  R    ++     N                                
Sbjct: 374 NNYELRFDGNEWNVTRLPEGINVPVDSNTAGTLKFDGLEIKISNSTGMSKGDSFLVKPVS 433

Query: 369 AGYPDLINHYCDSFNKNFIFDPVAGINTN------------------VTLLEYARNSIGW 410
                +     ++ +        +G   N                   T  ++    +  
Sbjct: 434 GVINGMQTLVSNASDFAAAGSKDSGPGDNENIKQLVKLQDEKLIDGSSTFSDFYATLVND 493

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +      +         +     E      GVN+ EE   + K++Q +N + +++   D 
Sbjct: 494 VGSKTKQAQIDSETQNKMTESFYEQEQAISGVNMNEESIQMQKIQQFFNANAQVLKTVDD 553

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 554 LFNALMRA 561


>gi|257871323|ref|ZP_05650976.1| flagellar hook-associated protein FlgK [Enterococcus gallinarum
           EG2]
 gi|257805487|gb|EEV34309.1| flagellar hook-associated protein FlgK [Enterococcus gallinarum
           EG2]
          Length = 507

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 77/502 (15%), Positives = 154/502 (30%), Gaps = 27/502 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------ISPENV 50
            L      A            +   NI N +   Y R+                     V
Sbjct: 3   GLFGSLGTATRGMTANQAALQTSSHNIANTNTDGYSRQRVNLQAEASYHLAGVGSIGMGV 62

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V +      +     +   +S               E +  ++  +N  +  ++ + DS
Sbjct: 63  KVGSVERIVDDFVIGQVRNANSTYTYYEQKADILGQLESLM-NEPSDNGLSKQLATMFDS 121

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
             + + N   D     V++N+       N   +++ ++++D    IE    +    + +L
Sbjct: 122 WTALANNPELDTSKTLVLENSSTFADTINQMGKQMTQLQSDTLDTIEKSALDFNEKVKQL 181

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ I   T S    +D LD+RD LL+ +S + GI T         V  S  T L   
Sbjct: 182 QSLNEQIYGLTTSGETPNDLLDRRDSLLKDLSGLAGIETKTDQYGRGFVSMSGQTILSAE 241

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI----- 285
               ++     S T    S          +           +       D+         
Sbjct: 242 ERNTLSVVVGQSDTGALVSKDGNALNPAETITGSYPAGTILLTKTTDNGDTAYTELPIKE 301

Query: 286 -FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
                L   +  +    +E +           +    G          G  +T       
Sbjct: 302 GAIGGLQASSGEIGSRLTELNNFTTTIAQAMNMVFTSGASRTSGLFEIGQDDTGTATTIR 361

Query: 345 RS-----NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV----AGIN 395
            S     NPS +  G S +         +A        +  S      FDP     A   
Sbjct: 362 VSQALLDNPSLVAGGTSNTAGDGSRAAAMAKLSSAKLDFPLSEKTIASFDPETLTFANAA 421

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           + +++  Y  + +     ++  + +       + N +     +  GV+L EE+S +I+ +
Sbjct: 422 SGMSVSSYFNSIVTKNGISKQQADNTVSAQLSLLNQLEYKNQSVSGVSLNEEMSDVIRFQ 481

Query: 456 QSYNISNKLIMFTDKMLQTLLE 477
           Q +  + +++    +ML TL+ 
Sbjct: 482 QGFQANARILSVVSEMLDTLIN 503


>gi|302874576|ref|YP_003843209.1| flagellar hook-associated protein FlgK [Clostridium cellulovorans
           743B]
 gi|307690813|ref|ZP_07633259.1| flagellar hook-associated protein FlgK [Clostridium cellulovorans
           743B]
 gi|302577433|gb|ADL51445.1| flagellar hook-associated protein FlgK [Clostridium cellulovorans
           743B]
          Length = 579

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 80/577 (13%), Positives = 172/577 (29%), Gaps = 101/577 (17%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S+L+  N A    N      ++   NI NA+ + Y R+      S               
Sbjct: 3   SILSTLNTANKGINAQQTAISTTSHNIANANTEGYSRQRVNLVTSRPFSSPSFNSAAGPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V +         D  +    S +G Q     + +  E +  ++  + + ++ +
Sbjct: 63  QIGTGVDVASIERIRNTFLDYQVRQEKSNLGNQTTRNQYLSNIESIM-NEPTDTALSNAM 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
            +   + + ++    +      V  NA  V    N +   ++K++ D    I   + ++ 
Sbjct: 122 DRFYSAWQEFANKPEDSNSRTVVAQNALSVSDMLNQTYFSLEKMQNDIHDNIRQNVLDVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKI----------------------- 201
             L+ L  +N  I   + S    +D +D RD+LL ++                       
Sbjct: 182 NLLNSLDSINQQIIQVSVSGQSPNDLMDTRDLLLDQLSENMGITVDRTPDFNGNNILPTE 241

Query: 202 ---------------------SEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
                                S +  I  +  +N  +  Y     T        +     
Sbjct: 242 TNGIGDATLVKSVFNDQVKRYSYVSNIEDLGGSNYKITYYKYGDMTSNANADSFVVKMND 301

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSA-----------------VPKGKIKALLQIRDSVV 283
             Y    +S  I+ +    +    +                     G +  L  I+  V 
Sbjct: 302 AEYKKLDQSRVIWANAQGAAIKNSTDTIKSTDVLNFSELRIFEPSSGDLAGLRTIQADV- 360

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPG-----LFIADGIKDLDNKLCQGISETI 338
             ++++L+  A+ L  S +     + +            F  +      +      +  I
Sbjct: 361 DQYKDKLNRFAKALAFSVNAVHTQSVDGTPSTNVENSIDFFVNNEDTSIDWEKNITAGNI 420

Query: 339 CVNPQYRSNPSFLRDGGSVSKK----------------FLWNVKNLAGYPDLINHYCDSF 382
            VN    S+   +  G                                          S 
Sbjct: 421 TVNKDIISDVMKINSGLKDGGNKDNRIALAIAMLKDVTIKAQDVTSTTDRVDFTSTMASL 480

Query: 383 NKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGV 442
                      ++  +TL  Y ++ +  L      + D       + N +  +  +  GV
Sbjct: 481 TNENSTITFKNVDGGMTLKSYHKDLVAKLGVQNKQAVDDVSTRTSLLNQLQSARDSVSGV 540

Query: 443 NLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           ++ EE++ LI+ + +Y  + K+I   D++L  L+ G+
Sbjct: 541 SIDEEMTNLIQFQHAYVANAKVISTVDQLLDVLVNGL 577


>gi|183598623|ref|ZP_02960116.1| hypothetical protein PROSTU_02024 [Providencia stuartii ATCC 25827]
 gi|188020803|gb|EDU58843.1| hypothetical protein PROSTU_02024 [Providencia stuartii ATCC 25827]
          Length = 559

 Score =  192 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 78/547 (14%), Positives = 171/547 (31%), Gaps = 74/547 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           L  V N A +  N A    + I  N+ NA    Y R+  +   +                
Sbjct: 15  LNNVMNNALSGVNAAQGGLSVISNNLANAGVGYYHRQSAVFGENPGTMTPNGYFGNGTYF 74

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              R E     ++      +  G+        +  + +  +D  +   +  I     +L+
Sbjct: 75  SHVRREFDEFINQQYGQSRARSGEYEAYAKNSSQVDDLLTNDIED--ISSNIGSFFTALD 132

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + S + S+  L    +  +  +V  F  + R +Q++  D +++IE ++ ++  +  ++  
Sbjct: 133 AASSDASDKTLIDVFLGKSNALVGQFKEADRRLQEMERDVNRQIETKVKDINTYAEKIAG 192

Query: 173 VNDAIKFK-TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           +N  I    + S  + +D LD RD L+ +I+ +IG+  I + N +  V  ++G  L    
Sbjct: 193 LNQQIARVRSVSGSEPNDLLDVRDRLVSEINSLIGVKVIEQ-NGNYNVTFANGLPLVTGE 251

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
             +      +S   +  S         V      A   G++  +L+ R  V+     +L+
Sbjct: 252 NANRLEAVPSSQDDSRFSIGFVGANGQVREIADDAFRGGELSGVLRSRKEVIDPAYQKLN 311

Query: 292 EMARVLIG--------------------------------------SFSEKDPIAGNSEN 313
           ++A V                                          F            
Sbjct: 312 KLALVFASKFNEVHKKGFDANGNPGKDFFEIGKGNVVSNTFNRGKAEFDFNYSDVSQVTG 371

Query: 314 VPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPD 373
                  DG +    +L +G + T+  +         +    + +     +   +     
Sbjct: 372 NNYEMRFDGKEWNVTRLPEGFAVTVDRSTPDTLKFDGIELKITQNNVQSGDSFLVKPVNG 431

Query: 374 LINHYCDSFNKNFIFDPVA----------------------GINTNVTLLEYARNSIGWL 411
           +IN      +    F                           I    T  +Y    +  +
Sbjct: 432 VINGMQSLISDAANFAAAGEKGSGPGDNDNLKELVKLQDQKLIGGTSTFSDYYATIVNDV 491

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
                 +         +     +      GVN+ EE   + K++Q +N + +++   D +
Sbjct: 492 GNQTKQAQIDSETQNKMTESFYQQEQAVSGVNMNEESIQMQKIQQFFNANAQVLKTVDDL 551

Query: 472 LQTLLEG 478
              L+  
Sbjct: 552 FNALMRA 558


>gi|119385424|ref|YP_916480.1| flagellar hook-associated protein FlgK [Paracoccus denitrificans
           PD1222]
 gi|119375191|gb|ABL70784.1| flagellar hook-associated protein FlgK [Paracoccus denitrificans
           PD1222]
          Length = 486

 Score =  192 bits (487), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 94/489 (19%), Positives = 179/489 (36%), Gaps = 15/489 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----PENVTVVTQR 56
           MS+ +  + A +    AS+    +  NI NA    + RR+   +         V +    
Sbjct: 1   MSISSAISNAVSGLTAASRGIEIVSSNIANALTPGHARRELDLSSRPSEHGGGVNIDGVS 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
                          + +G  R + +F A  E         +S    ++    +L S + 
Sbjct: 61  RIFTAGLIADNRLAEAGVGSSRTVAAFHAAMEKAFGTGTGISSLGQSLTDFESALTSAAS 120

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
               D+    V+D A  + +  N  +  +Q  R+ A++ IE ++S L   L ++  +N  
Sbjct: 121 RPDSDMRLSNVLDTATALAKKINDISTTIQAERSKAEQAIESDVSRLNAALQQVAKLNAQ 180

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV-PRDI 235
           I   TA   DA   +D R   +  IS+I+ I  + R N  + ++T DG  L +   P  I
Sbjct: 181 IVTITAQSKDASSLVDARQAAIDGISDILPIKEVPRENGRIALFTPDGAILLDGTEPARI 240

Query: 236 NFEKMNSYTV-----TSESNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQ 289
            F  +   T      +S  + + ++G  ++  Q   +   G + A   IRD + P +Q Q
Sbjct: 241 EFSAVPGITAEMSIGSSALSALTLNGKPLTGPQQQTMLSGGSLGANFAIRDQIAPAYQQQ 300

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           +D  AR L    S+    +  +   PGLF                         +  +P 
Sbjct: 301 IDAFARDLYDRLSDPMIDSSLNTGGPGLFTDAQGAFDPANESGFAGRIA---VTFLVSPE 357

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                  +           +G   L++    + + +         N   +L   +     
Sbjct: 358 TGGQLWRIRAGINAPDPGNSGESALLDRLSSAISASRFPASAHLSNAPRSLQTLSAELSS 417

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
               NR  S    ++S    + +  +     GV+  +E+  L+ +E++Y  + K+    +
Sbjct: 418 GAATNRIRSEASALQSSSHQSGLKAALLAE-GVDSDKEMESLLALERAYAANAKVFQTAN 476

Query: 470 KMLQTLLEG 478
            ML  +L  
Sbjct: 477 DMLDAILRL 485


>gi|257866412|ref|ZP_05646065.1| flagellar hook-associated protein FlgK [Enterococcus casseliflavus
           EC30]
 gi|257873072|ref|ZP_05652725.1| flagellar hook-associated protein FlgK [Enterococcus casseliflavus
           EC10]
 gi|257800370|gb|EEV29398.1| flagellar hook-associated protein FlgK [Enterococcus casseliflavus
           EC30]
 gi|257807236|gb|EEV36058.1| flagellar hook-associated protein FlgK [Enterococcus casseliflavus
           EC10]
          Length = 507

 Score =  192 bits (487), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 80/502 (15%), Positives = 158/502 (31%), Gaps = 27/502 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------ISPENV 50
            L      A            +   NI N +   Y R+                     V
Sbjct: 3   GLFGSLGTATRGMTANQAALQTSSHNIANTNTDGYSRQRVNLQAEASYHLAGVGSIGMGV 62

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V +      +     +   +S               E +  ++  +N  +  ++ + DS
Sbjct: 63  KVGSVERIVDDFVIGQVRNANSTYTYYEQKADILGQLESLM-NEPSDNGLSKQLATMFDS 121

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
             + + N   D     V++N+       N   +++ ++++D    IE    +    + +L
Sbjct: 122 WTALANNPELDTSKTLVLENSSTFADTINQMGKQMTQLQSDTLDTIEKSALDFNEKVKQL 181

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ I   T S    +D LD+RD LL+ +S + GI T         V  S  T L   
Sbjct: 182 QSLNEQIYGLTTSGETPNDLLDRRDSLLKDLSGLAGIETKTDQYGRGFVSMSGQTILSAE 241

Query: 231 VPRDINFEKMNSYTV----------TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
               ++     S T                              +          L I++
Sbjct: 242 ERNTLSVVVGQSDTGALVSKDGNALNPAETITGSYPAGTVLLTKTTDNGETAYTELPIKE 301

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDL-DNKLCQGISETIC 339
             +   Q    E+   L    +    IA     V     +         +   G + TI 
Sbjct: 302 GAIGGLQASSGEIGSRLTELNNFTTTIAQAMNMVFTGGASPTSGLFEIGQDDTGTATTIR 361

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV----AGIN 395
           V+     NPS +  G S +         +A        +  S      FD      A   
Sbjct: 362 VSQALLDNPSLVTGGTSNAAGDGSRAAAMAKLSSAKLDFPLSEKTIASFDSETLTFANAA 421

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           + +++  Y  + +     ++  + +       + N +     +  GV+L EE+S +I+ +
Sbjct: 422 SGMSVSSYFNSIVTKNGISKQQADNTVSAQLSLLNQLEYKNQSVSGVSLNEEMSDVIRFQ 481

Query: 456 QSYNISNKLIMFTDKMLQTLLE 477
           Q +  + +++    +ML TL+ 
Sbjct: 482 QGFQANARILSVVSEMLDTLIN 503


>gi|325567496|ref|ZP_08144163.1| hypothetical protein HMPREF9087_0452 [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158929|gb|EGC71075.1| hypothetical protein HMPREF9087_0452 [Enterococcus casseliflavus
           ATCC 12755]
          Length = 507

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 80/502 (15%), Positives = 158/502 (31%), Gaps = 27/502 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------ISPENV 50
            L      A            +   NI N +   Y R+                     V
Sbjct: 3   GLFGSLGTATRGMTANQAALQTSSHNIANTNTDGYSRQRVNLQAEASYHLAGVGSIGMGV 62

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V +      +     +   +S               E +  ++  +N  +  ++ + DS
Sbjct: 63  KVGSVERIVDDFVIGQVRNANSTYTYYEQKADILGQLESLM-NEPSDNGLSKQLATMFDS 121

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
             + + N   D     V++N+       N   +++ ++++D    IE    +    + +L
Sbjct: 122 WTALANNPELDTSKTLVLENSSTFADTINQMGKQMTQLQSDTLDTIEKSALDFNEKVKQL 181

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ I   T S    +D LD+RD LL+ +S + GI T         V  S  T L   
Sbjct: 182 QSLNEQIYGLTTSGETPNDLLDRRDSLLKDLSGLAGIETKTDQYGRGFVSMSGQTILSAE 241

Query: 231 VPRDINFEKMNSYTV----------TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
               ++     S T                              +          L I++
Sbjct: 242 ERNTLSVVVGQSDTGALVSKDGNALNPAETITGSYPAGTVLLTKTTDNGETAYTELPIKE 301

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDL-DNKLCQGISETIC 339
             +   Q    E+   L    +    IA     V     +         +   G + TI 
Sbjct: 302 GAIGGLQASSGEIGSRLTELNNFTSTIAQAMNMVFTGGASPTSGLFEIGQDDTGTATTIR 361

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV----AGIN 395
           V+     NPS +  G S +         +A        +  S      FD      A   
Sbjct: 362 VSQALLDNPSLVTGGTSNAAGDGSRAAAMAKLSSAKLDFPLSEKTIASFDSETLTFANAA 421

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           + +++  Y  + +     ++  + +       + N +     +  GV+L EE+S +I+ +
Sbjct: 422 SGMSVSSYFNSIVTKNGISKQQADNTVSAQLSLLNQLEYKNQSVSGVSLNEEMSDVIRFQ 481

Query: 456 QSYNISNKLIMFTDKMLQTLLE 477
           Q +  + +++    +ML TL+ 
Sbjct: 482 QGFQANARILSVVSEMLDTLIN 503


>gi|257876025|ref|ZP_05655678.1| flagellar hook-associated protein FlgK [Enterococcus casseliflavus
           EC20]
 gi|257810191|gb|EEV39011.1| flagellar hook-associated protein FlgK [Enterococcus casseliflavus
           EC20]
          Length = 507

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 76/502 (15%), Positives = 153/502 (30%), Gaps = 27/502 (5%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-----------ISPENV 50
            L      A            +   NI N +   Y R+                     V
Sbjct: 3   GLFGSLGTATRGMTANQAALQTSSHNIANTNTDGYSRQRVNLQAEASYHLAGVGSIGMGV 62

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V +      +     +   +S               E +  ++  +N  +  ++ + DS
Sbjct: 63  KVGSVERIVDDFVIGQVRNANSTYTYYEQKADILGQLESLM-NEPSDNGLSKQLATMFDS 121

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
             + + N   D     V++N+       N   +++ ++++D    IE    +    + +L
Sbjct: 122 WTALANNPELDTSKTLVLENSSTFADTINQMGKQMTQLQSDTLDTIEKSALDFNEKVKQL 181

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ I   T S    +D LD+RD LL+ +S + GI T         V  S  T L   
Sbjct: 182 QSLNEQIYGLTTSGETPNDLLDRRDSLLKDLSGLAGIETKTDQYGRGFVSMSGQTILSAE 241

Query: 231 VPRDINFEKMNSYT------VTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
               ++     S T        +  NP         +                    +  
Sbjct: 242 ERNTLSVVVGQSDTGALVSKDGNALNPAETITGSYPAGTVLLTKTTDNGETAYTELPIKE 301

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
                L   +  +    +E +           +    G          G  +T       
Sbjct: 302 GAIGGLQASSSEIGSRLTELNNFTTTIAQAMNMVFTGGASPTSGLFEIGQDDTGTATTIR 361

Query: 345 RS-----NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPV----AGIN 395
            S     NPS +  G S +         +A        +  S      FD      A   
Sbjct: 362 VSQALLDNPSLVTGGTSNAAGDGSRAAAMAKLSSAKLDFPLSEKTIASFDSETLTFANAA 421

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
           + +++  Y  + +     ++  + +       + N +     +  GV+L EE+S +I+ +
Sbjct: 422 SGMSVSSYFNSIVTKNGISKQQADNTVSAQLSLLNQLEYKNQSVSGVSLNEEMSDVIRFQ 481

Query: 456 QSYNISNKLIMFTDKMLQTLLE 477
           Q +  + +++    +ML TL+ 
Sbjct: 482 QGFQANARILSVVSEMLDTLIN 503


>gi|319409168|emb|CBI82812.1| Flagellar hook-associated protein FlgK [Bartonella schoenbuchensis
           R1]
          Length = 456

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 119/481 (24%), Positives = 224/481 (46%), Gaps = 26/481 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           M   +  N A+N     + Q   + +N+  A + NYVRR +     P+    +  R +  
Sbjct: 1   MGFNSTINTARNSLKATTGQLGIVSQNVVGAQDPNYVRRTSYIESGPKGAVHLMVRRDGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     SS       + +       +   D ++ +P+  +S  + +L++Y+ +  +
Sbjct: 61  IHLLNNYLVKSSQAAVSGSVANGLNRLSNIYGVDEFSRAPSQLLSDFQKALQTYANDPQQ 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
              G   +D A ++V + N   RE++K+R DAD +I+  + ++   L +   ++  +  +
Sbjct: 121 RFAGDAAVDRARDLVYSLNEGNREIEKLRNDADSDIQDSVDHINDLLQQFHELDQYVVRE 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
             +  D   ++DQRD +L+ +S+ IGI+T+  ++  M +Y  DG+TL++  PR++ F+  
Sbjct: 181 RNAGRDDSIYMDQRDTVLKALSQEIGINTVYHSDGSMTIYGMDGSTLYDKTPREVTFQSS 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            S         +F+DGV +   +       G +  LL+IRD + P +Q QLDEMA  L+ 
Sbjct: 241 GSLPAGVAGKQVFVDGVPLGHPSFVEPNGGGNLGGLLRIRDEIAPQYQKQLDEMANALLQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F             P LF+ D   D      +G+S  I +N  + SN            
Sbjct: 301 MF----------PGPPSLFLDDNQPDGVIGPIEGLSGRIRLNSVFDSNT----------- 339

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                      + + +    D+F++   F    G+    +++++++NSIGWLE  RSD+ 
Sbjct: 340 ----EGGGPEHFGEDLQSLVDAFDQKRTFGTDTGLFPEQSIMDFSKNSIGWLEGLRSDAD 395

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                   +F H SE+ SN  GVN  +E+  ++++EQ+Y  + ++I    KML  L+  +
Sbjct: 396 KDAKYHSTMFLHASEALSNGTGVNTDDEMVLMLQLEQTYAATTRIISTVGKMLDDLMIAI 455

Query: 480 K 480
           +
Sbjct: 456 R 456


>gi|146294544|ref|YP_001184968.1| flagellar hook-associated protein FlgK [Shewanella putrefaciens
           CN-32]
 gi|145566234|gb|ABP77169.1| flagellar hook-associated protein FlgK [Shewanella putrefaciens
           CN-32]
          Length = 457

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 77/485 (15%), Positives = 160/485 (32%), Gaps = 36/485 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT-------VV 53
           MS+    N  ++    +     +   N+ NA    Y R+  M +              V 
Sbjct: 1   MSM---LNIGKSGLLASMAALNATSNNVANAMVAGYSRQQVMLSSVGGGAYGSGAGVFVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +SA+G  ++  S+    E +       N+ +  + +L  +L S
Sbjct: 58  GVRRISDQYEVAQLWQTTSAVGFSKVQSSYLRQAEQVFG--ADGNNISKGLDQLFAALNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +     ++V++ A+ V Q  N     +   R   + ++   +  +   L+ +   
Sbjct: 116 SMEQPNLIAYRQSVLNEAKAVAQRVNAINDNIDSQRNQINGQLGTSVKEINAQLAIIANF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+  + +        D RD  +  ++ II I  +  +   + +  + G  L      
Sbjct: 176 NRDIQAASVTGTIPPALQDGRDAAIDDLAAIIDIRVVEDSQGMLNISLARGEPLLTGNTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +     +    I       + ++ +    G + ALL  RD+ +   Q  +DE+
Sbjct: 236 AKLTSAPDPANPKNNLVSIQFGASQFNVDETA---GGSLGALLNYRDTQLADSQAYIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A +L   F+       +             +  +      ++     +            
Sbjct: 293 AVMLATEFNSILASGTDLNGATPSQDLFTYQANNPGGSLSLTAGFTPDKLAFGQ------ 346

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    +       NK   F     + ++ +L E   + +G L  
Sbjct: 347 ------------DGTQGDNTNLKALVQLANKELSF---TSLGSSTSLAESFSSKVGQLGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      S  +       +++T GVN  EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAISFAKTSVDLQKDAQVQWASTSGVNPDEEGINLIIYQQSYMANAKVISTADQLFQ 451

Query: 474 TLLEG 478
           T+L  
Sbjct: 452 TMLSS 456


>gi|89068727|ref|ZP_01156113.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
 gi|89045690|gb|EAR51752.1| flagellar hook-associated protein [Oceanicola granulosus HTCC2516]
          Length = 470

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/485 (17%), Positives = 185/485 (38%), Gaps = 21/485 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQR--SE 58
           MSL    +  ++     S+   +   N+ NA  + YVRRD   + +     V+      +
Sbjct: 1   MSLTNALSAGRSGLLAVSRWSETTAGNVANAKTQGYVRRDVGLSTNVVGGGVIVTGITRD 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +     ++   H +    Q  +                  + +  +  L+D+  + +   
Sbjct: 61  SDAALTRLHRDHLAEGATQSTISDRLQAYATALGQPGDPTTLSARLGGLQDAFVALASTP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
                 ++V++ AE      N  +R++        ++I  ++  +   LSEL  +N  + 
Sbjct: 121 GSGPAQRSVLEAAEGAAAALNGLSRQLDSAVRGVGEQIAGQVERVEGLLSELAAMNARMA 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT-LFETVPRDINF 237
                   + +  D+ D  L  ++  +      R +  + ++T DGT  L    P  + F
Sbjct: 181 GTEQGTAASAELRDRMDGRLDALATSLDFQVRERVDGGLDIFTPDGTVMLDGDDPAPLTF 240

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSN--QGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
           +           + +  DGV ++     G  + +G +  L ++R  ++P F+ QLDE AR
Sbjct: 241 DPN---------SGLAFDGVDITPGKAVGRGITEGVLAGLTELRSEILPRFRMQLDETAR 291

Query: 296 VLIGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
            L+ +F++ DP        +     A     L   L   I+      P+       +RD 
Sbjct: 292 ALVQTFADADPTVGAGGAGLFTDAGAGYDPALHEGLAGRITVNDAARPEAGGALWRVRD- 350

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                      +   G   +++   D   +  ++DP  G+     L E+A   +      
Sbjct: 351 -----GMGAVSEGPPGDATVVDGILDRLAQGQVYDPATGLQGGAPLGEFAAQLMADQHAV 405

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
           R+ +             ++ES +   GV++  E+  L+++EQ+Y  ++K++    +M+  
Sbjct: 406 RARADTALEGLNTATAAVAESRAARQGVDIDAEMQRLLEIEQTYAANSKVLTTVVRMIDD 465

Query: 475 LLEGV 479
           LL  +
Sbjct: 466 LLAAI 470


>gi|191168469|ref|ZP_03030257.1| flagellar hook-associated protein FlgK [Escherichia coli B7A]
 gi|190901488|gb|EDV61249.1| flagellar hook-associated protein FlgK [Escherichia coli B7A]
          Length = 547

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/548 (12%), Positives = 159/548 (29%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLIARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKD------------------------- 325
            ++A     +F+ +     ++    G       K                          
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASVVL 358

Query: 326 -----LDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD 380
                +     Q     +  N  + + P           +  +           +    D
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTATPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 381 SFNKNFI------------------------------FDPVAGINTNVTLLEYARNSIGW 410
           +     +                                    +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|238752861|ref|ZP_04614326.1| Flagellar hook-associated protein [Yersinia rohdei ATCC 43380]
 gi|238708900|gb|EEQ01153.1| Flagellar hook-associated protein [Yersinia rohdei ATCC 43380]
          Length = 452

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/479 (12%), Positives = 156/479 (32%), Gaps = 42/479 (8%)

Query: 9   KAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------SPENVTVVTQRSEN 59
            A +    A     +   N+ N     Y R+    +          +   V V   +  +
Sbjct: 6   TALSGTKAAQAHLDATAMNVANMKTPGYSRQRAEQSALGASGVGAYAGNGVNVDGIKRIS 65

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
            +   K     +S        Q +    E + + +  + S +  +++   +L+  +    
Sbjct: 66  DHYLVKQEWQANSQSAYFNGKQRYLDKLESVVSTE--STSLSKGLNEFYAALDGATLIPD 123

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                + +I+ A+ +    N +   + + +     +    I  +    S +   N  I  
Sbjct: 124 SLPQRQNIINRADALALRINNTNMTLSEQKQSIANQRASCIDQINVLTSAIADYNKKIVH 183

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
             +   +++  +D RD  + ++S +I   +I   +  + +   +G  L       ++   
Sbjct: 184 LDSIGTNSNALIDNRDKKINELSTLIETRSIQAKDGSLSLSLKNGQPL-------VSGST 236

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             S T       + ++ V   S    +   G++ +L      ++   Q  +  +A  L  
Sbjct: 237 AASITANVGRPGLNLNFVGTQSLIDMSC-GGQLGSLHDYETGILNSVQETIQNIANHLAT 295

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            F+ +  +  + E   G+ + D        + Q  + ++       S             
Sbjct: 296 EFNRQLLLGTDLEGNTGVELFDFQSTNPKGILQVNAISLKQLALAGS------------- 342

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
                  N  G    ++      +K   F+ +     N  L + A   +  +      + 
Sbjct: 343 ------GNGPGDNTNLHELIAIKDKPITFNGIQ----NTKLSDAAFGLLSDVGVASGRNK 392

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                ++ V N       +   V+  EE   L++ ++ Y  + K++   D++ + LL  
Sbjct: 393 TELTAARDVLNQAIRERDSVSSVDKDEEAINLMEYQRVYQSNIKVVSTGDQLFRDLLAL 451


>gi|94969957|ref|YP_592005.1| flagellar hook-associated protein [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552007|gb|ABF41931.1| Flagellar hook-associated protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 458

 Score =  191 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 78/487 (16%), Positives = 169/487 (34%), Gaps = 45/487 (9%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVT 51
           SL    + A            +   NI N +   Y R+  + +               V 
Sbjct: 3   SLSGTLSIATRAMLAEQGAMQATTNNIANVNTPGYSRQIPIFSAVDPVVSGSTTYGNGVE 62

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           +   +S    + +  L        Q  L     ++ ++  A    +      +S   +S+
Sbjct: 63  LRGYQSLRNRVLN--LRIAEEQQNQSALQSYVSSMDQVQVAFSDASGGIGGALSAFFNSI 120

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
              S       L ++V+ +A  +V  F+T A  +  ++   D E++ +++ + R   ++ 
Sbjct: 121 SQLSTQPDSTTLRQSVLSSANTLVNAFHTDASSLSSMQQGLDLEVKDQVNEVNRLTVQIA 180

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N  I        D     DQ D  + ++S ++ +S     +    + T++G  L    
Sbjct: 181 SLNGRISAMQKLHQDPGTLSDQLDQSVSELSNLLDVSVTQTEDGI-SLTTANGVALVVGD 239

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                    +  T  S      ID         + + KG +  +L++RD  VP  Q+QLD
Sbjct: 240 KSFGLTTAADPDTGLSRVQAGEID-------LTALLQKGSLGGVLRVRDEEVPSIQSQLD 292

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
           ++A  L  + +       +    PG  +                         ++  + +
Sbjct: 293 KLAAGLSTAMNAVHQTGFDLNGNPGGLLFS-----------------APPSDGKNAAALI 335

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
               S   +   +    AG   + N      N+  +         N T ++     +  +
Sbjct: 336 SLAISDPAQLAMSGNGAAGDNTVANELLQIKNQAVV--------GNATPIDAYSQIVFNV 387

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
             + SD+      S  +   + +      GV+L EE + L++ ++ +  +  L+   D+M
Sbjct: 388 GSDISDAQAGLDTSTSLLQQLQDQRGALSGVSLDEETANLLQFQRGFEAAAHLVSVVDEM 447

Query: 472 LQTLLEG 478
           +QT++  
Sbjct: 448 MQTVIAM 454


>gi|193064539|ref|ZP_03045619.1| flagellar hook-associated protein FlgK [Escherichia coli E22]
 gi|194428412|ref|ZP_03060952.1| flagellar hook-associated protein FlgK [Escherichia coli B171]
 gi|260843322|ref|YP_003221100.1| flagellar hook-filament junction protein FlgK [Escherichia coli
           O103:H2 str. 12009]
 gi|192927791|gb|EDV82405.1| flagellar hook-associated protein FlgK [Escherichia coli E22]
 gi|194413464|gb|EDX29746.1| flagellar hook-associated protein FlgK [Escherichia coli B171]
 gi|257758469|dbj|BAI29966.1| flagellar hook-filament junction protein FlgK [Escherichia coli
           O103:H2 str. 12009]
          Length = 547

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/548 (12%), Positives = 159/548 (29%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKD------------------------- 325
            ++A     +F+ +     ++    G       K                          
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFTIGKPAVLQNTKNKGDVAIGATVTDASVVL 358

Query: 326 -----LDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD 380
                +     Q     +  N  + + P           +  +           +    D
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTATPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 381 SFNKNFI------------------------------FDPVAGINTNVTLLEYARNSIGW 410
           +     +                                    +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|120597311|ref|YP_961885.1| flagellar hook-associated protein FlgK [Shewanella sp. W3-18-1]
 gi|120557404|gb|ABM23331.1| flagellar hook-associated protein FlgK [Shewanella sp. W3-18-1]
          Length = 457

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 78/485 (16%), Positives = 160/485 (32%), Gaps = 36/485 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT-------VV 53
           MS+    N  ++    +     +   N+ NA    Y R+  M +              V 
Sbjct: 1   MSM---LNIGKSGLLASMAALNATSNNVANAMVAGYSRQQVMLSSVGGGAYGSGAGVFVD 57

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  +       L   +SA+G  ++  S+    E +       N+ +  + +L  +L S
Sbjct: 58  GVRRISDQYEVAQLWQTTSAVGFSKVQSSYLRQAEQVFG--ADGNNISKGLDQLFAALNS 115

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
             +  +     ++V++ A+ V Q  N     +   R   + ++   +  +   L+ +   
Sbjct: 116 SMEQPNLIAYRQSVLNEAKAVAQRVNAINDNIDSQRNQINGQLGTSVKEINSQLAIIANF 175

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
           N  I+  + +        D RD  +  ++ II I  +  +   + +  + G  L      
Sbjct: 176 NRDIQAASVTGTIPPALQDGRDAAIDDLAAIIDIRVVEDSQGMLNISLARGEPLLTGNTA 235

Query: 234 DINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
                  +     +    I       + +Q +    G + ALL  RD+ +   Q  +DE+
Sbjct: 236 AKLTSAPDPANPKNNLVSIQFGASQFNVDQTA---GGSLGALLNYRDTQLADSQAYIDEL 292

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           A +L   F+       +             +  +      ++     +            
Sbjct: 293 AVMLATEFNSILASGTDLNGATPSQDLFTYQANNPGGSLSLTAGFTPDKLAFGQ------ 346

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                           G    +       NK   F     + ++ +L E   + +G L  
Sbjct: 347 ------------DGTQGDNTNLKALVQLANKELSF---TSLGSSTSLAESFSSKVGQLGS 391

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
               +      S  +       +++T GVN  EE   LI  +QSY  + K+I   D++ Q
Sbjct: 392 ASRQAISFAKTSVDLQKDAQVQWASTSGVNPDEEGINLIIYQQSYMANAKVISTADQLFQ 451

Query: 474 TLLEG 478
           T+L  
Sbjct: 452 TMLSS 456


>gi|293395589|ref|ZP_06639872.1| flagellar hook-associated protein FlgK [Serratia odorifera DSM
           4582]
 gi|291421908|gb|EFE95154.1| flagellar hook-associated protein FlgK [Serratia odorifera DSM
           4582]
          Length = 549

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 77/552 (13%), Positives = 177/552 (32%), Gaps = 78/552 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS  ++ N A +  N A    +++  NI N +   Y R+  +   +             V
Sbjct: 1   MS-NSLINTAMSGLNAAQVALSTVSNNISNYNVAGYNRQTAILAQNGGMGTMSGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           TV +   E        L    S  G       FE + ++ +      N+ +  +     +
Sbjct: 60  TVTSVNREYNQFITNQLRGAQSQAGAHD--AYFEKVSQIDNLLADKTNTLSSSMQDFFSN 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D    TV+  A  +V  FN + + ++ + +  ++++      +  +  ++
Sbjct: 118 LQNLVSNAGDDASRNTVLGKANGLVNQFNNTDKYLRDMESGVNQQLSDSAVQINNYSQQI 177

Query: 171 TVVNDAIKFKTASKH-DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I     S   + +  LDQRD L+ ++++I+G+    ++ +   V  ++G TL +
Sbjct: 178 AKLNQDITRLRGSGGGEPNALLDQRDQLVSELNQIVGVQVTQQDGDAYSVSFANGLTLVQ 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      +S   +      +  G   S      +  G +  +L+ R   +   +NQ
Sbjct: 238 GNNAYQVEAMPSSQDPSR-LTLGYNRGSGASEIPQGQIVSGSVSGVLKFRSEALDSARNQ 296

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGI-------------------------- 323
           L ++A  +  +F+++     +     G                                 
Sbjct: 297 LGQIALAMADNFNQQHRAGFDINGDAGGDFFSFSGGRVVENTRNVGDATLGVSYTDTGKV 356

Query: 324 --------KDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLI 375
                    D +N     +S+   +     ++ S          +   +          +
Sbjct: 357 QASDYRVEFDGNNWQVTRLSDNTPITASAGTDASGTPTLAFEGLQVSIDGNAQKNDSFTV 416

Query: 376 NHYCDSFNKNFIFDPVAG-----------------------------INTNVTLLEYARN 406
               D      +    AG                             ++   TL     +
Sbjct: 417 KPVSDVAGSLKVAISDAGKIAAAGADDGGRGDNDNAKKLLDLQTRKLVDGKATLTGAYAS 476

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
            +  +    + +         +   ++    +  GVNL EE   L++ +Q Y  + ++I 
Sbjct: 477 LVSNVGNQTATAKSNSAAQGNIVKQLTVQQQSVSGVNLDEEYGELLRFQQYYMANAQVIQ 536

Query: 467 FTDKMLQTLLEG 478
               +   +L  
Sbjct: 537 TASSLFDAILSI 548


>gi|95928660|ref|ZP_01311407.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95135450|gb|EAT17102.1| Flagellar hook-associated protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 465

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 79/487 (16%), Positives = 162/487 (33%), Gaps = 36/487 (7%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVT 51
            L+   N  +     + +       N+ NA  + Y R+    + SP              
Sbjct: 3   GLIGALNTGKTGLMVSQKGIEVTGNNLTNASTEGYSRQVLKVSSSPALEHNGIIVGHGAV 62

Query: 52  VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSL 111
           V     +      K L   S   G+Q  +       E ++     N      I+   ++ 
Sbjct: 63  VTAIARQESVFVTKQLINKSGDYGEQAAMAEPLGELERIAGISDDN--LVADINAYFEAW 120

Query: 112 ESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELT 171
           ++ S   S  +  + VI   + + + F +   ++ ++  + +  I  E+  + +   ++ 
Sbjct: 121 QALSNEPSGTVERQEVIQMGKNIAKTFASMDADLNELTENINVSIAAEVDTINQMADQIA 180

Query: 172 VVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
            +N  I    A    A+   D RD LLQ++SE++GI+T    +  + V  S G  L E  
Sbjct: 181 SLNLRIVSTEAGGTSANGLRDDRDQLLQELSELVGINTYEGGSGMVSVQLSSGLPLVEGG 240

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                     S +       + +D    +   G     G+IK L+ +RD+ +P  ++ LD
Sbjct: 241 IAS-----SMSSSRVDGLTTLSLDMGATTVELGLDDFGGEIKGLMSVRDNEIPQVRDSLD 295

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
            +A  L    +       + +  PG+                          +    + L
Sbjct: 296 RLAYTLANEVNAVHEAGVDLDGNPGVSFFSYSTSTAADAE-----------AWTGAAATL 344

Query: 352 RDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWL 411
               + + +      + +G            +   +           T  E+       +
Sbjct: 345 AVAITQTDQVAAGATSSSGDNTNTLAMVALQDAEVV--------DGSTFNEFYSQIASKV 396

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
                 +      +Q     +     + VGV+  EEL  L + +  Y  + + I   ++M
Sbjct: 397 GLAVDQNTYELETAQDALVQVQNMRDSAVGVSTDEELLLLTQYQTGYRAAAQYINAINEM 456

Query: 472 LQTLLEG 478
           L T+L  
Sbjct: 457 LDTMLTM 463


>gi|119947171|ref|YP_944851.1| flagellar hook-associated protein FlgK [Psychromonas ingrahamii 37]
 gi|119865775|gb|ABM05252.1| flagellar hook-associated protein FlgK [Psychromonas ingrahamii 37]
          Length = 454

 Score =  190 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 67/480 (13%), Positives = 155/480 (32%), Gaps = 34/480 (7%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI------SPENVTVVTQRSE 58
           +++N A +  +          +NI NA+   + R+  + +           V V + R  
Sbjct: 2   SIYNIALSGVSANRTALNITAQNIANANTAGHSRQQAVQSSITRSNDVGAGVEVSSIRRM 61

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
                   L + ++ +G      S     E +   D +N   +  + +   S+   S   
Sbjct: 62  ADQFIISQLRSSNTELGNSSYSASSLGQLEQIVGLDGFN--LSAGMDQFFSSISEASVAP 119

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
                 + V+ +A+ + Q F   ++ +    A    + E  +S +   L  L   + AI 
Sbjct: 120 ESVEFRQQVLSDAQALAQRFKGLSQTLSNQNAQLASDRENNLSMVNGLLDNLAQSSKAIM 179

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
                  +     D RD +L ++S++I ++     N ++ + T++G  L           
Sbjct: 180 EVYNVGGNTATLEDNRDQMLNELSQLIKVNVNKEENGELQLSTNNGQPLLINDKAAEFTT 239

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
                           +G   + +       G++ A+ + +   +    N ++EMA ++ 
Sbjct: 240 TPLPSDPYQAIINATFNGSTFNVSSD---LGGELGAIDKTQKKDLAALHNTINEMAVIVA 296

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
              ++      +   +            +      ++        +  + +         
Sbjct: 297 DEVNKSLASGTDLNGLSPGLALFSYDPANPAGSMQMNLLSTDELAFSGDGNP-------- 348

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                                 +       D       N+ L E    S+G +  +   +
Sbjct: 349 ---------------GDGQILANLLDISKTDFSITGAGNINLSEAFSLSVGKIAIDSRQA 393

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                 +  +FN +  S  N  GVN  EE + L+    +Y  + K+I   ++M  ++L  
Sbjct: 394 QQNLDSNTALFNQVQASRENLSGVNSDEEAANLMIYANAYEANMKVISTANQMFNSILRA 453


>gi|209967001|ref|YP_002299916.1| flagellar hook-associated protein FlgK, putative [Rhodospirillum
           centenum SW]
 gi|209960467|gb|ACJ01104.1| flagellar hook-associated protein FlgK, putative [Rhodospirillum
           centenum SW]
          Length = 526

 Score =  190 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 82/521 (15%), Positives = 182/521 (34%), Gaps = 46/521 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MSL    + A +         A++ +N  N     Y R+           +   V     
Sbjct: 1   MSLSVAISSAISGLRATQNNIATVSQNTSNIQTPGYTRKFVTQEAQVHTPTTGGVRTGQV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           +        + L    S       + +  +  E +        S +  ++ LRD     +
Sbjct: 61  QRTFDQALYRELLQRESQAAHLETVSTTLSSIEKLQGSPESQTSISARLADLRDDFIGLA 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                  L   V+++A+    + NT A  +   R++    I   I  +   L+++  ++ 
Sbjct: 121 AKPESVELQADVVNSAQIFAASMNTVANAIIDKRSETQDAIVNTIDTVNGLLTDIAQLDR 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     ++    D  D+RD+ ++ +++++ +  + R +  M++ T  G TL + VP  +
Sbjct: 181 QIFQTQGTQQGTADLQDRRDLKIRDLAKLVDVVALERADGTMLLMTRGGATLLDRVPNYL 240

Query: 236 NFEKM-------NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           +              +      PI +       +    +  G++  LL++RD ++P  Q 
Sbjct: 241 STSPSRIAASSYYDPSGAGGIAPIRLGDPNTGVDITQDLRGGQLGGLLELRDDILPRMQA 300

Query: 289 QLDEMARVLI---------GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC 339
           +LDE+A ++             +    +  +++ V       G  D    +      +  
Sbjct: 301 ELDELAHMVAVRFKGKTAPDDGAPGLTLFTDTDGVSIPGDVSGSVDYAPPILYVGFASRI 360

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWNVKNLA-------------------------GYPDL 374
              Q     + L   G      +      +                         G  + 
Sbjct: 361 RVGQAVMENAELVRYGDGGAPKVPPASGSSPPDPIAGSTIFLKNVVDHVFGTTTLGGSNH 420

Query: 375 INHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISE 434
           I         N   +  + I  NV+L+++A++ +         +     ++  +   +  
Sbjct: 421 IAFNTQGLGANPRRNLTSSIPANVSLIDFAQSVLVKQSSEAGWAKARATEATAMKEELDF 480

Query: 435 SYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
            YS+  GVNL EE+  L  +++SY  S+++I   ++M  +L
Sbjct: 481 RYSDKTGVNLDEEVVMLTVLQRSYAASSRVITTVEQMYDSL 521


>gi|114765248|ref|ZP_01444380.1| flagellar hook-associated protein K [Pelagibaca bermudensis
           HTCC2601]
 gi|114542383|gb|EAU45411.1| flagellar hook-associated protein K [Roseovarius sp. HTCC2601]
          Length = 470

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 91/481 (18%), Positives = 186/481 (38%), Gaps = 13/481 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENV-TVVTQRSEN 59
           MSL+   N A++  + +S+   ++  NI NA+N +Y RR+T  T + +    V       
Sbjct: 1   MSLITALNAARSGMSTSSRWAETVSTNIANANNASYARRETQVTTNVQGAAQVSEITRAV 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
               D +         +Q  + +       +  D    ++    ++  + SL   + + +
Sbjct: 61  DGALDAMYRGEVGRTAKQDAIAAGLESYTSLLGDTESTDTVLTRLTDFQSSLGLLAVSPA 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +  L +  + +A+E+ Q  N +   +      A   I  +++ +   L ++  +++ +  
Sbjct: 121 DTALQRATVGDAQELTQALNRAGANLDAALDRAGDGISSDVAAVNSTLEKIAGLSERLAG 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           +  S        D+    L  +SE I  +T   +   + ++T  GT L      +     
Sbjct: 181 QGQSADARLALQDELGAELDALSEYIDFTTRTDSKGRIEIFTGGGTALITGGEAETLSFD 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            ++  +T+    I              + +G +   +++  +V+P  ++QLDE+AR LI 
Sbjct: 241 TDTGILTAGEIEITPGVAGKRG-----ISEGSLSGKIELVTTVLPEMRSQLDEVARALID 295

Query: 300 SFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
                D   A     +     A      +  L   IS    V P+   +   +RD     
Sbjct: 296 GMVAADASLAAGEAGLFTDNGAALSDPFEPGLASRISVNDAVVPESGGSLWRIRD----- 350

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                +    AG    +  + D+ +    FD   G+  N++L  Y    I      R+ +
Sbjct: 351 -GLGADAPGPAGDNTQVTAFLDTLDGAMNFDESLGLGDNMSLSSYISTLIASQNTTRASA 409

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                        +  S  + +GVN+ +EL  L  ++QSYN + + +    +ML TLL  
Sbjct: 410 ETSAESLAAGAIAVQSSRLSFMGVNVDDELQQLAAIQQSYNANAQTLSVVSEMLDTLLSA 469

Query: 479 V 479
           +
Sbjct: 470 I 470


>gi|261341488|ref|ZP_05969346.1| flagellar hook-associated protein FlgK [Enterobacter cancerogenus
           ATCC 35316]
 gi|288316284|gb|EFC55222.1| flagellar hook-associated protein FlgK [Enterobacter cancerogenus
           ATCC 35316]
          Length = 456

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 72/484 (14%), Positives = 147/484 (30%), Gaps = 40/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTVVT 54
            + N A +    A    +    NI NA    Y R+  + +               V V +
Sbjct: 2   NMINIAWSGLQAAQFGMSVTSMNISNALTPGYSRQGIIQSSVVTMGQGGMSAGAGVQVES 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S      +   + +  E +   D  + S    +     +L + 
Sbjct: 62  IRRVSDQYLTNQVWQSNSKASYYGINNQYLSSLEKVIGTD--STSLGTGLDDFFSALSAL 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           +K    +   + +++ A  +   FN     +   +     +    +  +    + +   N
Sbjct: 120 TKEPESEASRQQLLNQAGSLATRFNNMNDFINSQKTSVTNQRNTMVGQINSLTAGIADYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    ++  +++   DQRD L++++S    +     +N    V   +G  L       
Sbjct: 180 KKIMEMDSTGGNSNVLRDQRDELVKQLSTYADVKVTEDSNGSYAVAMKNGQPLVSGKVAG 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  S ++    NP+       +S   +    G++ AL       +   Q+ +  MA
Sbjct: 240 EL-----SSSLDGNGNPVLSLNFSNTSFSLNPSTGGQLGALYDYETGELAQMQSSVQGMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
             +   F+++     +    PG  +          + Q                  + D 
Sbjct: 295 EAVATLFNDQLAKGFDKNGNPGKPLFTFDLKNPAGILQ------------------VNDL 336

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                    N        +L         K        G   N++L E A   I  +   
Sbjct: 337 KQDELALSDNPDEQGNDGNLQE-----LIKIKNQKVDIGGMGNMSLNEGAAAIISNIGIA 391

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              S      +Q V +      +N   VN  EE   L    Q+Y  + K+I   +++   
Sbjct: 392 SKKSKSELEAAQGVLDQAQLQRNNLSAVNNDEEAINLQVYMQAYQSNVKVIATGNQIFND 451

Query: 475 LLEG 478
           LL  
Sbjct: 452 LLGL 455


>gi|288962672|ref|YP_003452966.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
 gi|288914938|dbj|BAI76422.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
          Length = 465

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 101/484 (20%), Positives = 180/484 (37%), Gaps = 25/484 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MS+      A +      QQ A +  N+ NA    YVRR+   +          V V   
Sbjct: 1   MSVQLALTAALSGLRTTQQQAAMLSHNLANATTAGYVRRELDLSAVTTAGRGAGVRVDAV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
             +   +  +     +S    Q+   S  A   ++        S +  +SKL+ +     
Sbjct: 61  ARKVDELLIRDARFETSRYTGQQARASALADYALVLGQPQDEKSVSTQLSKLQQAFSRLH 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
              ++D     V+  A  +    N +A+  Q + ADA   ++  +  +   L  ++ +N 
Sbjct: 121 DMPNDDAARNAVVSQASALADGLNRNAQAAQTVLADAKDRLQTSVDAVNGSLQRVSELNG 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I        DA D  D+RD LL ++S+ IGI T  R +  MVV T +G TL +      
Sbjct: 181 RIATLETRGGDAGDLRDERDRLLDQVSQEIGIRTYSREDGQMVVMTRNGQTLLDHPLA-- 238

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
                    +T     +  +GV +S+   S +  G+I   +Q     +P    QLDE+A 
Sbjct: 239 ----PGEQPLTLVGGEVTANGVALSAKPDSEIQSGRIMGYVQTIKQDMPRALAQLDELAA 294

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG 355
            L+  F         +E  P                 G++  I VN   ++    ++   
Sbjct: 295 GLVQGFQ-------GAEADPTKPGLFTDAGAAYGATAGLASRIAVNGVVKTESWRIQ--- 344

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
                         G    I  +   F     F     +  + TL  YA   +   +  R
Sbjct: 345 ---SGVQAAAALKPGDQTQIEKFQAVFTAARGFTA-TDMPASATLGSYATAMVSAQQGYR 400

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
           + +       ++  + +  +  N  GVN+ +E+  L+ +EQSY  S +++    +M+  L
Sbjct: 401 TGAESEMNARKISADTLESARINRDGVNIDDEMQKLLLIEQSYGASAQVVQVAGRMIDVL 460

Query: 476 LEGV 479
           L+  
Sbjct: 461 LQIK 464


>gi|296531743|ref|ZP_06894568.1| flagellar hook-associated protein FlgK [Roseomonas cervicalis ATCC
           49957]
 gi|296267926|gb|EFH13728.1| flagellar hook-associated protein FlgK [Roseomonas cervicalis ATCC
           49957]
          Length = 485

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 93/480 (19%), Positives = 176/480 (36%), Gaps = 5/480 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT-----MTTISPENVTVVTQ 55
           M++ A  + A +      +Q A +  NI NA+   YVRRD      +       V     
Sbjct: 1   MTISAALSNALSSLAAEQRQAAILSNNIANANTPGYVRRDMPRSERLVAGIGSGVDTAIT 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           +            +  ++      L+        +        S +  +   + ++ + S
Sbjct: 61  QRLGDAALAAASRSADASEAYALQLKQGLETYNALIGQPSDQRSLSSRLGAFQTAMTTLS 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                 +     ++ A ++V   + +   V K RA+AD ++  E+  +   L +L   + 
Sbjct: 121 SAPDNAVAQSQALEAARDLVDALHDADAAVAKARAEADLQLSREVGAINSALDQLAETDR 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            +   +A      ++ D+RD LL +I   I I         ++V +  GT+L ++     
Sbjct: 181 RMALASARGGSTAEYEDRRDTLLAEIGRKIPIRIFDNGPGHLLVMSDGGTSLLDSTVVHR 240

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
                       + +P  +  V V          G +   L++RD+ +P F + LD++A 
Sbjct: 241 LNFTHTPVVQAEQRHPAALSAVTVEGQALRVTETGSMAGALRLRDTTLPNFIDMLDQVAV 300

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGG 355
            LI SF + DP    ++            D        I     +      +P       
Sbjct: 301 RLIESFQDADPTLTGNQAGLFTDAGAANWDGSGGYASFIGMARKIAINAAVDPDQGGQLW 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
            +        +  A     I    D+ N    +D   G+  ++TL + A  SIG ++  R
Sbjct: 361 RLRTGVNAVAQGNAADNTNIIAALDAMNVVRSYDSNTGLPASMTLSQAASQSIGLMQGER 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
           +   D       +     +  SN   VN+ EEL  L+ V+Q+Y+ S ++I    +ML  L
Sbjct: 421 AVWSDRAETRGRLAAEARQELSNKTAVNVDEELQRLLLVQQTYSASVQIIQAATRMLDEL 480


>gi|260466602|ref|ZP_05812790.1| flagellar hook-associated protein FlgK [Mesorhizobium opportunistum
           WSM2075]
 gi|259029608|gb|EEW30896.1| flagellar hook-associated protein FlgK [Mesorhizobium opportunistum
           WSM2075]
          Length = 470

 Score =  189 bits (479), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 152/469 (32%), Positives = 241/469 (51%), Gaps = 4/469 (0%)

Query: 15  NNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAI 74
            N ++Q + + RNI +A N +Y RR ++ T +      V  +    ++  +      SA 
Sbjct: 1   MNTARQTSVVSRNIADASNPDYTRRISVITSTAPGARFVDVQRAANDLLFRQNLGALSAY 60

Query: 75  GQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEV 134
             Q  L S     ++        +SP+  I+ L+ +L+ Y+ + S   LG +VID A++V
Sbjct: 61  SGQNALYSGMDQLDVSVNGVDNASSPSAAIANLQQALQLYATSPSNQNLGSSVIDAAKQV 120

Query: 135 VQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQR 194
           V++ N  ++ +Q  R   D +I+  + +L   L +    N A+   T S  D  D LDQR
Sbjct: 121 VRSLNEGSKAIQDFRTQTDGQIDTAVKDLNSLLGQFQDANQAVMSGTRSGTDVSDALDQR 180

Query: 195 DVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFI 254
           D LL+KIS  + IST  R +NDMV+ T DGTTLFET+PR ++F     Y   +  N ++I
Sbjct: 181 DALLKKISNYVPISTFTRGDNDMVITTGDGTTLFETIPRTVSFTPAAGYAAGAAGNTVYI 240

Query: 255 DGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSEN 313
           D V +S+   G+    G +  LLQ+RD V    Q+QLDE AR LI +F+E  P   N+  
Sbjct: 241 DNVPISAGTGGNTTASGTLAGLLQLRDGVASTMQSQLDETARGLITAFAETAPSMPNAAG 300

Query: 314 VPGLFIADGIK---DLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAG 370
           +     A  +     L N L   IS    ++P    NP+ LRDGG+    ++ N    A 
Sbjct: 301 LFTWSGAPAVPAAGTLVNGLAGTISINAAMDPSVGGNPTLLRDGGANGLAYVANTTGGAS 360

Query: 371 YPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFN 430
           Y +L+  Y D  +K   FD  AGI+   ++ +YA NSIGWL+  R  +       + +  
Sbjct: 361 YSNLLIAYGDQLDKPMTFDSAAGISATSSVSDYAANSIGWLQSVRQQASTAADAKEALAQ 420

Query: 431 HISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +++ SN  GVN+ +E+S ++ +E +Y  S +++   D M+  LL  V
Sbjct: 421 RSADALSNATGVNIDQEMSLMLDLEHTYQASARMMKTVDDMMTALLSAV 469


>gi|157371201|ref|YP_001479190.1| flagellar hook-associated protein FlgK [Serratia proteamaculans
           568]
 gi|157322965|gb|ABV42062.1| flagellar hook-associated protein FlgK [Serratia proteamaculans
           568]
          Length = 548

 Score =  189 bits (479), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 80/551 (14%), Positives = 175/551 (31%), Gaps = 77/551 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS  ++ N A +  N A    +++  NI N +   Y R+  +   +             V
Sbjct: 1   MS-NSLINTAMSGLNAAQVALSTVSNNISNYNVAGYNRQTAILAQNGGMSTMNGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           TV +   E        L    S  G Q     FE + ++ +      N+ +  +     +
Sbjct: 60  TVTSVNREYNQFITNQLRGAQSQAGAQN--AYFEKISQIDNLLASKTNTLSTNMQDFFSN 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           LE+   N  +D   +TV+  A  +V  FN + + ++ + +  ++++    + +  +  ++
Sbjct: 118 LENLVSNAGDDAARQTVLGKANGLVNQFNNTDKYLRDMDSGVNQQLSDSATQINSYSQQI 177

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +ND I     S  + +  LDQRD L+ ++++++G+    ++ +   V  ++G TL + 
Sbjct: 178 AKLNDEITRLRGSGGEPNALLDQRDQLVTELNQVVGVQVTQQDGDAYTVSFANGLTLVQG 237

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S          +  G  VS      +  G +  +L+ R   +   +NQL
Sbjct: 238 NNAYQVEAIPSSGDPAR-LTIGYNRGNGVSEVPEGQITSGSVSGVLKFRTESLDGARNQL 296

Query: 291 DEMARVLIGSFSEKDPIA----------------------------------GNSENVPG 316
            ++A  +  SF+++                                              
Sbjct: 297 GQLALAMADSFNQQHRAGFDLNGDAGTDFFNFGGGRVVDNSRNTGDAALSVSYTDTGKVK 356

Query: 317 LFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLIN 376
                   D  N     + + + VN    ++            K              + 
Sbjct: 357 ANDYRVEFDGSNWQVSRLPDNVKVNATAGTDADGKATLSFDGLKVGIEGNAQKNDSFTVK 416

Query: 377 HYCDSFNKNFIFDPVAG-----------------------------INTNVTLLEYARNS 407
              D      +    +                              ++   T      + 
Sbjct: 417 PVSDVAGSLKVAITNSSNIAAAGKDDSGRGDNENAKKLLDLQTKKLVDGKATFSGAYASM 476

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           +  +    + +         +   ++    +  GVNL EE   L++ +Q Y  + ++I  
Sbjct: 477 VSSVGNQTASAKVSVTSQNNIVKQLTIQQQSASGVNLDEEYGELLRFQQYYMANAQVIQT 536

Query: 468 TDKMLQTLLEG 478
              M   LL  
Sbjct: 537 ASSMFDALLNI 547


>gi|330501143|ref|YP_004378012.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina
           NK-01]
 gi|328915429|gb|AEB56260.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina
           NK-01]
          Length = 455

 Score =  189 bits (479), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 67/486 (13%), Positives = 146/486 (30%), Gaps = 40/486 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV------- 53
           MS+L     A +    +    A+  +NI N     + R  T+T        +        
Sbjct: 1   MSILN--QIAYSGVRASQVALATTGQNIANVKTPGFSRLQTITGSLAGQGGLSVGGGVEV 58

Query: 54  -TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
            + R       ++ L   ++        Q +    E +       +S +  + +   +L 
Sbjct: 59  ISIRRMTNEFHNQQLWRATTEQNFYSASQQYLTALEALM--SGTGSSISAGLDQFFAALS 116

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             S       L + +I  A  + Q FN  +  +        ++     + +      + +
Sbjct: 117 EASATPGSIALRQQIIGEAGNLAQRFNGLSSNIDAQVKALQEQRTAMATEINGLTENIAL 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I    + K D+    DQR+ L+ ++++   +      +  + V  ++G  L     
Sbjct: 177 LNKKIVETESVKGDSTALRDQRESLIGQLTQFAKLRINETPDGSVSVALANGQPLVAGAT 236

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                  M +    S    + +     S         G    L  +    +      L +
Sbjct: 237 AGQLKVAMTA----SGEQEVSLAFAGTSFPLRQDGFGGAFGGLHDVEYGSLRPNLEALHD 292

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           MA  L    ++      +    PG  +          L +    T               
Sbjct: 293 MASQLAQMVNDVLATGFDLNGNPGQPLFAYDPTSTTALLRVEPLTAEQLA---------- 342

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
                    L +     G  +++       N+    +      + VTL +     +G + 
Sbjct: 343 ---------LSSAAGETGNNEVLLSLLGLKNQTITLN-----GSQVTLNDAYAGLLGQVA 388

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            N   +      +  V         +   V+L EE   L+  +Q+Y  + K+I   +++ 
Sbjct: 389 SNSRQNQADLKSATAVTQQAQSQRDSVSAVSLDEEAVNLMTYQQAYQANMKVISTANQLF 448

Query: 473 QTLLEG 478
             +L  
Sbjct: 449 DDMLSA 454


>gi|325289235|ref|YP_004265416.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964636|gb|ADY55415.1| flagellar hook-associated protein FlgK [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 512

 Score =  189 bits (479), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/515 (14%), Positives = 169/515 (32%), Gaps = 42/515 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PE 48
           M+              +     +I  NI NA    Y R+      S              
Sbjct: 1   MNSFFGLTVGLKGLTASQAALNTINHNISNAGTTGYSRQVVAQKASRALAAANGAGMVGT 60

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V + T         D+     ++  G+ ++  S  +  + + +    +      +S   
Sbjct: 61  GVDITTIVQIRNVFLDRRYWQENAQYGEWQVKSSSLSELQSLLSSSSTD-GLDDALSSFV 119

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
            +LE  + + S+D    +V   AE      N  A  ++ +R++A+  ++ ++  +     
Sbjct: 120 SALEDLAGDPSDDSARSSVKAEAEAFCTYLNNMASTLEDLRSEANSAVKTKVDEINSLAG 179

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV---------RNNNDMVV 219
            ++ +N  I     +   A+D  DQR VL+ ++SEI  I             + +    +
Sbjct: 180 RISALNQQIYKAELTGGTANDLRDQRTVLVDQLSEIASIEVSETAVGTLADGQEDLRFSI 239

Query: 220 YTSDGTTLFETVPRDINFEKMNSYTVTS---------ESNPIFIDGVVVSSNQGSAVPKG 270
             +  + +     + +    ++  + +            N +   G  +  +   A   G
Sbjct: 240 KINGVSLVNHFSVKKLECSAISDGSASDGLYEVRWAETGNEVTFTGGEIKGDLDMAGGDG 299

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
           +  A        +P +  QL+  A+ L  +F+E     G +                 + 
Sbjct: 300 QDGAF-----KGIPYYLGQLNTFAQTLAKAFNEGVYADGETYGSGHAGGVGLDDGTGIRF 354

Query: 331 CQGISETICVNPQYRSNPSFLRDGGSVSKKFLWN------VKNLAGYPDLINHYCDSFNK 384
                 +        ++ + +    + +   L         +  A           +  +
Sbjct: 355 FSYDGLSSEELMAGGTDLASIYGKITAANISLSAEVENDPGQIAASSVSGETENSANLTE 414

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
                  +G+  N +  E+       +    S +  +    + +   I  + +   GV+L
Sbjct: 415 LIAMFSDSGVFANGSPEEFINAIYTTIGVETSLAGRISTLHENIAAQIDTNRTAVAGVSL 474

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            EE S LIK + +YN + K++   D++L   +  +
Sbjct: 475 DEETSNLIKYQLAYNAAAKVMSVMDEVLDVTINSL 509


>gi|188995967|ref|YP_001930218.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931034|gb|ACD65664.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 475

 Score =  189 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 78/482 (16%), Positives = 170/482 (35%), Gaps = 13/482 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSLLA  + A        +   S  +NI N   + Y +   +    P   V +       
Sbjct: 1   MSLLASLSIAGQSLLTFQRGINSTNKNISNVTTEGYNKETPVFQDLPKSGVYLNKIIRAF 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                    + + ++   +         E +  +D      +  ++   +S+        
Sbjct: 61  DQSLFNRSISLNQSVNSDKSYSGILDNIEDVF-NDALGGGFSDTLNTFFNSINDMLIKPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +       I NA+ +V    +S + ++ ++     ++  +I+ + +   +L  +N+ IK 
Sbjct: 120 DLAARSQFIANAKVLVGKIRSSNKALEDLKQQTVLKVRDQINQINQITEQLAKLNNLIKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           KT      +++L++RD L+ ++S +I    +   +N + V+T+ G  L   +        
Sbjct: 180 KTLDVESNNEYLNERDRLITQLSNLIDTKVVFNEDNTVNVFTAKGFGLVVGMTNTQL--- 236

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
                    +   + +   ++    +    G +K +  I         N+L++ A VL  
Sbjct: 237 QFETDSNGNAIIKWNNTNDITKEIQNGELGGNLKGIDAINGQ-----LNRLNDFATVLAN 291

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNK--LCQGISETICVNPQYRSNPSFLRDGGSV 357
            F++        +   GL       +          I   I    Q     +        
Sbjct: 292 VFNKVHSQGYGLDGSTGLNFFGIDPNSSLSKIDASNIIVAIDDPKQVALATNNAYLNSDN 351

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN-SIGWLEKNRS 416
           +          +    L      +   +        I  N    EY  +  +  +    S
Sbjct: 352 TNGKNLLALKDSINGVLTPTEETALKSSLNDPNNYDIIKNSKFSEYYNSQLVAIISSESS 411

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
                   +Q +++ I+E   +  GVN+ EEL  L K+++SY  + ++I  TD+++QT+L
Sbjct: 412 RIKTQMKNNQFLYDAITEKMKSLTGVNMDEELINLTKLQRSYQAAARIITVTDELMQTIL 471

Query: 477 EG 478
             
Sbjct: 472 NI 473


>gi|311280011|ref|YP_003942242.1| flagellar hook-associated protein FlgK [Enterobacter cloacae SCF1]
 gi|308749206|gb|ADO48958.1| flagellar hook-associated protein FlgK [Enterobacter cloacae SCF1]
          Length = 547

 Score =  189 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/548 (14%), Positives = 177/548 (32%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           + ++ N A +    A     ++  NI + +   Y R+ T+   S             VTV
Sbjct: 1   MSSLINSAMSGLGAAQAALNTVSNNIASYNVSGYTRQTTVLAQSNSTLGPGGWVGNGVTV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + + +D    NS +  +     SL+
Sbjct: 61  TGVQREYNAFITNQLRAAQNQSSGLTTRYQQMSKIDDVLSDTT--NSLSATLQDFFSSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    ++V+  A+ +V  F  + + ++      +  +   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQSVLGKADGLVNQFKVTDQYLRDQDKQVNSAVASSVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    +D LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDKISKLTGVGAGASPNDLLDQRDQLVSQLNQIVGVEVNVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +     +           +  G +  LL  R   +   +N L
Sbjct: 239 STAHQLAAVPSSADPSRTTVAYVDNVAGNVEIPEKLLTTGSLGGLLTFRSQDLDQTRNSL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADG---------------------------- 322
           ++MA     +F+++     ++   PG    D                             
Sbjct: 299 NQMALAFADAFNQQHAKGVDANGDPGSKFFDIGSPSVLKNTKNTGTANLGATVTDSSKVQ 358

Query: 323 ------IKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLIN 376
                   D  N     +++   V P   ++ S   DG +VS     N  +      + N
Sbjct: 359 ATDYNVSWDGSNWQVTRLADNTKVTPTVEADGSLSFDGLNVSVSGTANKNDSFTVKPVAN 418

Query: 377 HYCDSFNKNFIFDPVAG--------------------------INTNVTLLEYARNSIGW 410
              +          +A                           +  N T+ +   + +  
Sbjct: 419 TIVNMDVAITDETQIAMGINDGKSGESDNRNGQALLDLQNSKLVGGNKTVNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    S           V   +++   +  GVNL EE   L   +Q Y  + +++     
Sbjct: 479 VGNKTSTLKVSSTTQGNVVTQLTKQQQSISGVNLDEEYGNLQLFQQYYLANAQVLQTAST 538

Query: 471 MLQTLLEG 478
           +   LL  
Sbjct: 539 LFDALLNI 546


>gi|238799422|ref|ZP_04642851.1| hypothetical protein ymoll0001_16400 [Yersinia mollaretii ATCC
           43969]
 gi|238716726|gb|EEQ08613.1| hypothetical protein ymoll0001_16400 [Yersinia mollaretii ATCC
           43969]
          Length = 549

 Score =  188 bits (477), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/550 (13%), Positives = 174/550 (31%), Gaps = 80/550 (14%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVTQR 56
            N A +  + A    +++  NI N     Y R++ +   +             VTV    
Sbjct: 1   MNTAMSGLSAAQYALSTVSNNITNFQVAGYNRQNAIFAQNGGTLSPAGFIGNGVTVTGVN 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
            E  +     L   SS      L   ++ + ++ +   + +N+ +  +     +L++   
Sbjct: 61  REYNSFITNQLR--SSQTQSSGLTTYYQQISQIDNLLSNSSNNLSVTMQDFFSNLQNLVS 118

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++  +ND 
Sbjct: 119 NAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKITESVTKINNYSEQIAKLNDQ 178

Query: 177 IKFKT-ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
           I     +S  + +  LDQRD L+ ++++I+G++   ++ +   V  ++G  L +      
Sbjct: 179 ITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVAFANGLPLVQGSSSHK 238

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
                +S   T  +         V     S +  G +   L+ R   +   +NQL ++A 
Sbjct: 239 IEAIASSSDATRLAIGYKYGSGDVMEVDESRLATGSLGGTLKFRSEALDSARNQLGQLAL 298

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADG--------------------------------- 322
            +  SF+ +     +    PG                                       
Sbjct: 299 AMADSFNTQHKAGFDINGDPGDDFFSFAQPNVLKNSNNQGDASLTVKYTDTSKVKASDYS 358

Query: 323 -----IKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
                      +L                + + L   G             +    L+  
Sbjct: 359 VEFDGTDWQVTRLSDNTKVPANPVKDVNGDTTGLSFDGLDVSIDNGTGGAQSKDKFLVKT 418

Query: 378 YCDSFNKNFIFDPVAG-----------------------------INTNVTLLEYARNSI 408
             +      +    +                              +++  TL       +
Sbjct: 419 VSNVAANLQVAVTDSSKIAAAGTADGGASDNVNAKALLDLQTKKLVDSKATLSGAYAGLV 478

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +    + +         +   ++    +  GVNL EE   L + +Q Y  + ++I   
Sbjct: 479 SNVGNQTNTAKTNSAAQANIVKQLTAEQQSISGVNLDEEYGDLQRFQQYYLANAQVIQTA 538

Query: 469 DKMLQTLLEG 478
             +   LL+ 
Sbjct: 539 STLFNALLDL 548


>gi|218135314|ref|ZP_03464118.1| hypothetical protein BACPEC_03219 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990699|gb|EEC56710.1| hypothetical protein BACPEC_03219 [Bacteroides pectinophilus ATCC
           43243]
          Length = 512

 Score =  188 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/508 (15%), Positives = 184/508 (36%), Gaps = 32/508 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT------------ISPEN 49
           S     N A      AS    +   N+ N + K Y R+ T  +             +   
Sbjct: 3   STFFGLNIAYTGLQAASVSINTTAHNVSNVNTKGYSRQQTDVSADNALRTYAKYGTAGSG 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V V + +    + +D    ++ +  G    +Q++    E    +++     T   +    
Sbjct: 63  VIVNSIQQVRDSYYDVKYRSNETNYGYYNTMQTYMTQLEDYL-NEYTLEGFTKAYADFFQ 121

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           S     +  +E+ +    I+ A+ +   FNT +  ++ ++ D ++EI   +  +    + 
Sbjct: 122 SAIQLQEQPAEESVRNQFINKAQSLADYFNTLSSNLKNVQKDTNEEIGNRVDKINTISTS 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVR----NNNDMVVYTSDGT 225
           +  +N  I    A+   A+D  D R+ LL ++S+I+ I T       N N   VY +   
Sbjct: 182 IASLNKQINQIEANHGTANDLRDARNNLLDELSQIVNIETTETPVGVNTNCFKVYINGQV 241

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPIFIDG--VVVSSNQGSAVPKGKIKALLQIRDSVV 283
            +       +      +    S+++ ++       +S  + S+   G +KAL++ RD   
Sbjct: 242 LVDNNNSNKLMVTAKENPRNASDADGLYQITWESGMSFGEYSSTLNGSLKALIEARDGCN 301

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFI------------ADGIKDLDNKLC 331
              + Q  +     +           N + VP                 + +    N   
Sbjct: 302 GEIEKQTTDANGNPVLETEGVSVNNTNFKGVPYYQSKLNEFVQIFTTAVNDVLAGPNART 361

Query: 332 QGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPD-LINHYCDSFNKNFIFDP 390
               + I +      + +      +V+ + + +   LA   D       +   ++ +   
Sbjct: 362 INGEKGIPLFVSKYEDSAMSASSITVNNELVLDQSKLATTTDENKGESYNDLVESILELR 421

Query: 391 VAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSF 450
              +  N T   +  + +G +  + S +   +     +   +     + +GV+  EE   
Sbjct: 422 DKKMYGNGTGGYFLESIMGDVAIDSSKATQFNKNFTNLKTTVQNQRLSVMGVDQDEEGMD 481

Query: 451 LIKVEQSYNISNKLIMFTDKMLQTLLEG 478
           L+K +++YN+S K++   +++   L+ G
Sbjct: 482 LMKYQEAYNLSAKMMSVMNEIYDRLING 509


>gi|237757071|ref|ZP_04585515.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690770|gb|EEP59934.1| flagellar hook-associated protein FlgK [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 475

 Score =  188 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 81/482 (16%), Positives = 180/482 (37%), Gaps = 13/482 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSEN 59
           MSLLA  + A        +   S  +NI NA  + Y +   +    P   V +       
Sbjct: 1   MSLLASLSIAGQSLLTFQRGINSTNKNISNATTEGYNKETPVFQDLPKSGVYLNKIIRAF 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                    + + ++   +         E +  +D   +  +  ++   +S+        
Sbjct: 61  DQSLFNRSISLNQSVNSDKSYSGILNNIEDVF-NDALGSGFSDALNTFFNSINDMLIKPD 119

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +       I NA+ +V    +S + ++ ++     ++  +I+ + +   +L  +N+ IK 
Sbjct: 120 DLATRSQFIANAKVLVGKIRSSDKALEDLKQQTVLKVRDQINQINQITEQLAKLNNLIKT 179

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
           KT     ++++L++RD L+ ++S +I    +   +N + V+T+ G  L   +        
Sbjct: 180 KTLDVESSNEYLNERDRLITQLSNLIDTKVVFNEDNTVNVFTAKGFGLVVGITNTQL--- 236

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
                  ++SN   +     +++    +  G++   L+  D++     N+L++ A VL  
Sbjct: 237 ----QFETDSNGNAVIKWNNTNDITKEIQNGELGGNLKAIDAINGQL-NRLNDFATVLAN 291

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNK--LCQGISETICVNPQYRSNPSFLRDGGSV 357
            F++        +   GL       +          I   I    Q     +        
Sbjct: 292 VFNKVHSQGYGLDGSTGLNFFGIDPNSSLSKIDASNIIVAIEDPKQVALATNTAYLNSDN 351

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN-SIGWLEKNRS 416
           +          +    L +    +   +        I  N    EY  +  +  +    S
Sbjct: 352 TNGKNLLALKDSIGGVLTSTEETALKSSLNDPNNYDIIKNSKFSEYYNSQLVAIISSESS 411

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
                   +Q +++ I+E   +  GVN+ EEL  L K+++SY  + ++I  TD+++QT+L
Sbjct: 412 RIKTQMENNQFLYDAITEKMKSLTGVNMDEELINLTKLQRSYQAAARIITVTDELMQTIL 471

Query: 477 EG 478
             
Sbjct: 472 NI 473


>gi|323163692|gb|EFZ49513.1| flagellar hook-associated protein FlgK [Escherichia coli E128010]
          Length = 547

 Score =  188 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/548 (12%), Positives = 158/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKD------------------------- 325
            ++A     +F+ +     ++    G       K                          
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFTIGKPAVLQNTKNKGDVAIGATVTDASVVL 358

Query: 326 -----LDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD 380
                +     Q     +  N  + + P           +  +           +    D
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTATPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 381 SFNKNFI------------------------------FDPVAGINTNVTLLEYARNSIGW 410
           +     +                                    +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + + +   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQALQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|126734126|ref|ZP_01749873.1| flagellar hook-associated protein FlgK [Roseobacter sp. CCS2]
 gi|126716992|gb|EBA13856.1| flagellar hook-associated protein FlgK [Roseobacter sp. CCS2]
          Length = 480

 Score =  188 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 94/490 (19%), Positives = 174/490 (35%), Gaps = 24/490 (4%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQRS 57
           + +  N A       S+    +  N+ NA  + Y RR    +          V V +   
Sbjct: 1   MSSALNNAVTGLTATSRMAEVVSSNLSNALTEGYGRRGVELSSVQVGGRGGGVRVDSINR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                         +A+  Q          E               +++   +L +   +
Sbjct: 61  FVDAGLLADRRLADAALSGQERSVDLVMRLEQAIGGPDDAAGLGARLAEFERALIAAGSD 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            + ++   +V+   E V      +   VQ +R DAD  I  +I  L   L ++  +N  I
Sbjct: 121 PASELRLASVVARLEGVAGTLKANTASVQALRQDADVAIARDIDVLNGALQQVDALNKDI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              + S  D    LD R   + +I+ I+ +  + R+N  + + T+ GTTL ++ PR+  F
Sbjct: 181 LRISGSGDDPSALLDARQRAVDQIAGIVPVREMPRDNGSIGLMTTSGTTLLDSRPREFGF 240

Query: 238 EKMNSYTVTSE-----SNPIFIDGVVVSSNQGSAV-PKGKIKALLQIRDSVVPIFQNQLD 291
           +   + T            I +DGV +    G      G + A   +RD  +   Q+ LD
Sbjct: 241 QNTLTITADMTLASGALGAIKLDGVALDLATGVGRLDGGTLGAAFVLRDQTLVQAQSALD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIK---DLDNKLCQGISETICVNPQYRSNP 348
            +   L+  F +            GL    G        + L   IS    + P    N 
Sbjct: 301 GITADLVARFQDSTNDPSLMPGDIGLLTDQGNPLDLSDLSGLAGRISVNPAIVPAQGGNL 360

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           + LRD                G    IN +  + +   +  P A + +    +      +
Sbjct: 361 ALLRD------GLNATTPGPTGDAAQINRWIAALDTPRMDVPGATLASASGRIAAY---V 411

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +   R  + +    +   +  + E+     G++   EL  L+++EQ+Y  + K+I   
Sbjct: 412 SEVGTTRLMAQEQLSFTTARWETLREAELAD-GIDTDVELQRLLQIEQAYAANAKVIQTV 470

Query: 469 DKMLQTLLEG 478
           D M+Q L+E 
Sbjct: 471 DFMMQRLMEL 480


>gi|259417223|ref|ZP_05741142.1| flagellar hook-associated protein FlgK [Silicibacter sp. TrichCH4B]
 gi|259346129|gb|EEW57943.1| flagellar hook-associated protein FlgK [Silicibacter sp. TrichCH4B]
          Length = 482

 Score =  187 bits (475), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 87/486 (17%), Positives = 171/486 (35%), Gaps = 12/486 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP--ENVTVVTQRSE 58
           MSL    + A      A +  + +  N+ NA  + Y RR    + +     V + + +  
Sbjct: 1   MSLSTALSSAMTGITAAGRSTSVVSDNLANALTEGYYRRTLDLSSNGSAGGVRIGSVQRM 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
                 K + +  +      +   F A         + + S    ++ +  +L   +   
Sbjct: 61  IDPAIQKSVRSAEANFAATSVTAGFYARISDQVGTVNDDYSIAQRMTDMETALIEATSLP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
             D     +   A E+  +   +A  V  +R  A+  I   +  L+  L  L  +N  I 
Sbjct: 121 DSDARLNDLSMQAGELAMSIRNAAEGVSTLRNKAEDSIGALVEGLQTNLETLNDLNKKIL 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINF 237
                  D     DQRD L+  I+E+I +    R+NN   +YT+ G  L +     + +F
Sbjct: 181 AAEIRGQDPSGLEDQRDNLINAINEVIPVQVHKRDNNQTALYTNSGIKLIDGGSVAEFSF 240

Query: 238 EKMNSYTV-----TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
           ++    T        + + + IDG  + ++    +  G + A   +RD      Q  LD 
Sbjct: 241 DETRLVTPYMSIDNGQLSGLEIDGRSIDTSINGKIGGGSLAAQFHVRDVASVQAQEDLDT 300

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           MA  LIG F +           PG+F   G           +     +      + S   
Sbjct: 301 MAADLIGRFQDPAVDPTLGATDPGIFTDAGAFFDPVNT---LGAANRIELNEVISMSGSA 357

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           +   +            G   ++N+Y ++             + + +    A N +    
Sbjct: 358 ETWRLRDGLNATAIGDRGDTTILNNYAEAMEATNTITSPGLGSGDYSAYAIAANLMTNFT 417

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           +  + +      S  +++ I        GV+   EL  L+ +E  Y  + +++   D+M+
Sbjct: 418 QENTWAEQELAYSSAIYSDIQSRELEQ-GVDTDAELQTLMMIETVYGANARMLQAIDEMM 476

Query: 473 QTLLEG 478
           Q L+  
Sbjct: 477 QELMRL 482


>gi|295096219|emb|CBK85309.1| flagellar hook-associated protein FlgK [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 546

 Score =  187 bits (474), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 74/547 (13%), Positives = 167/547 (30%), Gaps = 73/547 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           + ++ N A +  + A     ++  NI + +   Y R+ T+   S             V V
Sbjct: 1   MSSLINSAMSGLSAAQSALNTVSNNISSYNVAGYTRQTTILGASNSTLTGGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + + +D    NS +  +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQNQSSGLTTRYQQMSKIDDVLSDTT--NSLSANLQDFFKSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    +TV+  A+ +V  F T+ + ++   A  +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQTVLGKADGLVNQFKTNDQYLRDQDAQVNTAISTSVDQINNYAKQIAN 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V+++    +  ++G TL + 
Sbjct: 179 LNDQISRLTGVGAGASPNELLDQRDQLVSELNKIVGVDVTVQDSGTYNISIANGYTLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S      +                 +  G +  LL  R   +   +N L
Sbjct: 239 SNASQLAAVKSSADPARTTIAYVDAAAGNVEISEKQITTGSLGGLLTFRSQDLDQARNTL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADG---------------IKDLDNKLCQGIS 335
           ++MA     + + +     ++    G  + D                           + 
Sbjct: 299 NQMALAFADAMNTQHQAGFDANGDAGGKLFDFGSPAVLSNGKNTGSASVTATMTDSTKVQ 358

Query: 336 ETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD------ 389
            T        ++ +  R   + S     +      +  L      S +    F       
Sbjct: 359 ATNYKVEYNGTDWTITRLSDNTSFTAKPDASGNLSFDGLNVKISGSADNKDSFIVKPVND 418

Query: 390 --------------------------------------PVAGINTNVTLLEYARNSIGWL 411
                                                     +  N T  +     +  +
Sbjct: 419 VIVNMDVAISDESKLAMASAKGNGESDNTNGQKLLDLQSAKLVGGNKTFNDAYAALVSTV 478

Query: 412 EKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
               +           V   +++   +  GVNL EE   L + +Q Y  + +++     +
Sbjct: 479 GSTTASLKTSSETKVNVVTQLTKQQQSISGVNLDEEYGNLQRYQQYYLANAQVLQTASTL 538

Query: 472 LQTLLEG 478
              L+  
Sbjct: 539 FDALINI 545


>gi|150019110|ref|YP_001311364.1| flagellar hook-associated protein FlgK [Clostridium beijerinckii
           NCIMB 8052]
 gi|149905575|gb|ABR36408.1| flagellar hook-associated protein FlgK [Clostridium beijerinckii
           NCIMB 8052]
          Length = 583

 Score =  187 bits (473), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 82/584 (14%), Positives = 174/584 (29%), Gaps = 106/584 (18%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------- 46
           MS L   F  A+   N       +   NI NA    Y R+  +   +             
Sbjct: 1   MSGLFDTFTIAKRGLNVQQGNINTTSHNISNASTTGYSRQRAVVQTTRPFGGTSRFDSCS 60

Query: 47  ----PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTH 102
                    + T +       D  +    S  G+     S+    E +  ++  +     
Sbjct: 61  AGQVGTGAEITTIQRIRDVFKDYQVRTQKSDNGKLETKNSYLTQVEDIL-NETSDTGIQQ 119

Query: 103 YISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
            +S      +S S + ++       +  A+ +    N    ++   ++DA   ++ ++++
Sbjct: 120 ALSDFYKGFQSLSLDPTKSSNRTVALQQAQTLASALNNRYTQLDTKKSDAQGTMQTDVTD 179

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           +   L ++  +N  I   +A     +D +D+RD LL  +S   GI+T   N   M V +S
Sbjct: 180 INSILDQIKDLNQQIAGVSAIGMTPNDLMDKRDNLLDDLSTKFGITTKRENYEAMDVSSS 239

Query: 223 -----------DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK-- 269
                      DG  L        ++ +  +   +      +       + +   +    
Sbjct: 240 ELSSPTIGMLVDGNDLTGKNCNRFSYVESATLDTSGNLTVTYSVLGDKKNIKTLTISGAD 299

Query: 270 ----------------------------------------GKIKALLQIRDSVVPIFQNQ 289
                                                   G+I     ++   +    +Q
Sbjct: 300 EALKNEVLEKRILIADKSGIVTPAPTDKASIEKSLFKVEKGEIGGKQAVQ-KDIQTCMDQ 358

Query: 290 LDEMARVLIGSFSEKDPIAGNSE--------NVPGLFIADGIKDLDNKLCQGISETICVN 341
           LD+ A  L  + +     + ++         N P    +              ++ I VN
Sbjct: 359 LDKFAAGLAYAVNAIQTGSTDAASSNSNLKYNDPIFVTSASNGTGAATDIGINAKNITVN 418

Query: 342 PQYRSNPSFLRDGGSVSKKFLWNVKNLA-------------------------GYPDLIN 376
               ++PS L  G + +          A                          +     
Sbjct: 419 SVLNTDPSKLNCGETSTDVSGDKAGTRALAIASIKEIKMDLDKIDVTSNSTRKDFFTNTA 478

Query: 377 HYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESY 436
                   +     +   ++  TL  Y ++ I  L             S+          
Sbjct: 479 TTGSQLTLDASALKLNSSSSGATLDNYYKSVISNLATVTKGVTSDLSISEKQLETYENDR 538

Query: 437 SNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK 480
            +  GV++ EE + LI+ + +Y  + K+I   D++L  ++ G+K
Sbjct: 539 LSESGVSIDEETTNLIQFQHAYQANAKVISTVDELLDVVINGLK 582


>gi|99082780|ref|YP_614934.1| flagellar hook-associated protein FlgK [Ruegeria sp. TM1040]
 gi|99039060|gb|ABF65672.1| Flagellar hook-associated protein 1 (HAP1) [Ruegeria sp. TM1040]
          Length = 482

 Score =  187 bits (473), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 91/486 (18%), Positives = 170/486 (34%), Gaps = 12/486 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP--ENVTVVTQRSE 58
           MSL    + A      AS+  + I  N+ NA ++ Y RR    + +     V + + +  
Sbjct: 1   MSLSTALSSAMTGITAASRSTSVISDNLANALSEGYYRRTLDLSSNGAAGGVRIGSVQRM 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
                 K + +  +      +   F A         +   S    ++ +  +L   +   
Sbjct: 61  IDPAIQKSVRSAEANYAATSVTAGFYARVSEQVGTVNDAYSIAQRMTDMETALIEATSLP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
             D     +   A E+  +   +A  V  +R  A+  I   +  L   L  L  +N  I 
Sbjct: 121 DSDARLNDLSMQAGELAMSIRDAAEGVSSLRNKAEDSIAALVQGLETNLETLNDLNRKIL 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE-TVPRDINF 237
                  D     DQRD L+  I+E+I +    R+NN   +YT+ G  L +     + +F
Sbjct: 181 AAEVRGQDPSGLEDQRDSLIDAINEVIPVQVHKRDNNQTALYTNSGIKLIDGGSVAEFSF 240

Query: 238 EKMNSYTV-----TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
           ++    T        + + + IDG  + ++    +  G + A   +RD      Q  LD 
Sbjct: 241 DETRLVTPYMTLGNGQLSGLEIDGKQIDTSINGKIGGGSLAAQFHVRDVASVQAQEDLDT 300

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           MA  LI  F +           PG+F   G           +     +      + S   
Sbjct: 301 MAADLIQRFQDPAVDPTLGATDPGIFTDQGAFFDPVNT---LGVANRIELNSIISMSGSA 357

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           +   +            G   ++N+Y ++             + + +    A N +    
Sbjct: 358 ETWRLRDGLNATAIGERGDTTILNNYAEAMEATNTITSPGLGSGDYSAYAIAANLMTNFT 417

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
           +  + +      S  +F+ I        GV+   EL  L+ VE  Y  + ++I   D+M+
Sbjct: 418 QENTWAEQELAYSSAIFSDIQSRELEQ-GVDTDSELQTLMMVETIYAANARMIQAIDEMM 476

Query: 473 QTLLEG 478
           Q L+  
Sbjct: 477 QELMRL 482


>gi|254255092|ref|ZP_04948409.1| Flagellar hook-associated protein [Burkholderia dolosa AUO158]
 gi|124899737|gb|EAY71580.1| Flagellar hook-associated protein [Burkholderia dolosa AUO158]
          Length = 446

 Score =  187 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 62/475 (13%), Positives = 141/475 (29%), Gaps = 32/475 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-SPENVTVVTQRSENKNMF 63
            + +   +    A        RN  N     Y R+    T      V   +         
Sbjct: 2   NIMHIGLSGTLAAQAGLNVAARNTANLLTPGYTRQGVHLTSRVGGGVDATSLVRFADQYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDIL 123
            +   A ++  G+  + +S     E +      + S    I K   +L   S +++   L
Sbjct: 62  TQQKWASNAPYGRYSVTESHYKQLEGVMGL--GDGSVKAGIDKFFGALSEVSADVTNSTL 119

Query: 124 GKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTAS 183
            + VI  A+ + ++ N     ++       ++       +      +  +N  I   +++
Sbjct: 120 RRQVIHAADGLAKSMNALQSALRTQLDGTRQQSAATAQEINALAGSIADLNREIANASSA 179

Query: 184 KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSY 243
                + +D+RD  + ++S +  +  + R N  + V  + G  L            ++  
Sbjct: 180 GVTPSELVDRRDEAIDRLSALADVRVVTRANGTVDVDLAGGLPLVSGS----ETATLDVA 235

Query: 244 TVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
                +  + +     +         G +  L +  D V+      +  +A  L    + 
Sbjct: 236 AQPDGTFSLSLAFADTTYPLDGTKIGGALGGLFEFVDDVLIPQTTAIRALAGELAERINA 295

Query: 304 KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLW 363
           +          PG  + +                           + L            
Sbjct: 296 QLSAGYGMNGEPGKPLFNVDPATGELH-----------------VNALAPDELGFSADPA 338

Query: 364 NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHM 423
              N A    LI+    S +              V L +     +G +      +  +  
Sbjct: 339 EPGNSANLTKLIDLQRASIDLPGF--------GEVALGDAYTMLVGKVGSQSQQNQTMLA 390

Query: 424 KSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            +  V      ++  T GVN+ EE   + +  Q+Y+ + K+I   +++    L  
Sbjct: 391 MAADVRKQSEAAWLATSGVNMDEEAVNIAEFMQTYSANMKVISVANQLFDVTLAS 445


>gi|258513988|ref|YP_003190210.1| flagellar hook-associated protein FlgK [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257777693|gb|ACV61587.1| flagellar hook-associated protein FlgK [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 430

 Score =  186 bits (472), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 65/492 (13%), Positives = 152/492 (30%), Gaps = 74/492 (15%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PEN 49
           MS         +               N+ NA+   Y R+                    
Sbjct: 1   MSGTFFGLEIGKRALQANKTGMDVTGNNVANANTTGYSRQRVNLVTGPPYTGSGYQLGTG 60

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V V        N  D  + ++ S IG Q   Q+     E +      N     Y++   +
Sbjct: 61  VNVGDIERIRNNYIDGQVRSNLSQIGYQEKEQNVLQKVEALF-PYSVNEGMQVYLNDFFN 119

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
             +  ++N  +  +   V++  + +    N S  ++  IR D D E    +S + +    
Sbjct: 120 GWQEVNENPLDKGIQAGVLEKGKALAAAMNQSYEQLGIIRKDVDTEHTDLVSQVGKLTER 179

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS-DGTTLF 228
           +  VN++I    A  ++         +LL ++++++ I   + N+N  +V  S +G  L 
Sbjct: 180 IVKVNESIAKSHAENNNVLLDERD--LLLDRLAKLVKIDATMNNDNKALVDVSVNGVALI 237

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                + N    ++  V      +   G                          +  ++ 
Sbjct: 238 TGTANNFNAANFDTPDVGGSVGSLINTGS------------------------RIDNYKE 273

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
           +L+++A  +    +                                           +  
Sbjct: 274 KLEKLANAIAEEINGLYT-----------------------------GEGKFFKDLSNAS 304

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
                  +   +   N               +    +   D             Y ++ +
Sbjct: 305 DSKTLNNNKIIELDDNASVDPQIALEAAQLRNKKIDSLGEDEGITF------ESYYQDLM 358

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             + +  + +  L    + + + +     +  GV+++EE++ L++ +  Y  ++K+I   
Sbjct: 359 VTIGEESNSAGQLLETYEAIGDQLFAQRESVSGVSIEEEMTNLLQYQYGYQAASKIITTI 418

Query: 469 DKMLQTLLEGVK 480
           D+ML+TLL  ++
Sbjct: 419 DQMLETLLGIIR 430


>gi|323137000|ref|ZP_08072080.1| flagellar hook-associated protein FlgK [Methylocystis sp. ATCC
           49242]
 gi|322397761|gb|EFY00283.1| flagellar hook-associated protein FlgK [Methylocystis sp. ATCC
           49242]
          Length = 490

 Score =  186 bits (472), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 140/490 (28%), Positives = 231/490 (47%), Gaps = 10/490 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-VTVVTQRSEN 59
           M+L      A       S Q + + RNI NA       + +    +P      +      
Sbjct: 1   MTLTNASIIAGQSLGTISSQISVVSRNISNAGRPGVNAKYSQIATAPNGSAEFLGVGRMA 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKE--MMSADDHYNNSPTHYISKLRDSLESYSKN 117
                + + + ++A G    +       +  +  ++   + SP   I++L  +L++YS  
Sbjct: 61  NVALFRSMLSATAAQGSAAQISDALDQIDRALNLSNPAQSRSPASMITRLTTALQNYSAA 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
              +   +  +  A +VV + N + +  Q IR  AD++I   + ++   L++ + +N  I
Sbjct: 121 PDNETAAELALAAARDVVASLNDATKTNQGIRRQADEDIASSVKDVNDILAKFSALNREI 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              TA+  D  D LDQRD LL ++S  IG++T+ R NNDMV+YT  G TLFET PR + F
Sbjct: 181 VEGTAAGADITDQLDQRDALLTQLSNEIGVTTVTRPNNDMVIYTDSGVTLFETTPRSVTF 240

Query: 238 EKMNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
           +   + T   E   ++IDGV V+ ++   A+  G I    Q+RD   P FQ QLDE+AR 
Sbjct: 241 QPTPTLTAGVEGAAVYIDGVQVTGADSPLALKSGAINGFAQVRDVTAPQFQKQLDEIARG 300

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL-----CQGISETICVNPQYRSNPSFL 351
           L+ +F+E D   G    +PGLF   G       +        I+    V+P      S L
Sbjct: 301 LVAAFAETDQTGGGGAPLPGLFTYPGAPGAPGSMLIPGLAGQITINANVDPDKGGVVSRL 360

Query: 352 RDGG-SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           RDGG S +  +++N    A Y + +    ++ +    FDP AG+  + +L   A  SIGW
Sbjct: 361 RDGGISGNPDYVYNKSGGAAYSERLLQLVNAPSTQQGFDPGAGLGASGSLNAIAAGSIGW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           L   R+ +         +    +++ SN  GVNL +++S ++ +E SY  S KL+   + 
Sbjct: 421 LGAQRAQAEKNVTYQDAMVAQTTQALSNATGVNLDDQMSQMLALENSYQASAKLLETINA 480

Query: 471 MLQTLLEGVK 480
           M  TL   V+
Sbjct: 481 MFDTLFAAVR 490


>gi|218694616|ref|YP_002402283.1| flagellar hook-associated protein FlgK [Escherichia coli 55989]
 gi|307310140|ref|ZP_07589790.1| flagellar hook-associated protein FlgK [Escherichia coli W]
 gi|218351348|emb|CAU97054.1| flagellar hook-filament junction protein 1 [Escherichia coli 55989]
 gi|306909858|gb|EFN40352.1| flagellar hook-associated protein FlgK [Escherichia coli W]
 gi|315060360|gb|ADT74687.1| flagellar hook-filament junction protein 1 [Escherichia coli W]
 gi|320200978|gb|EFW75562.1| Flagellar hook-associated protein FlgK [Escherichia coli EC4100B]
 gi|323379079|gb|ADX51347.1| flagellar hook-associated protein FlgK [Escherichia coli KO11]
          Length = 547

 Score =  186 bits (472), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 64/548 (11%), Positives = 155/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLIGSFSEKDPI--------------------------------AGNSENVPGLF 318
            ++A     +F+ +                                        +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN                  + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWHVTRLASNTTFSVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|90418364|ref|ZP_01226276.1| putative flagellar hook-associated protein FlgK [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90338036|gb|EAS51687.1| putative flagellar hook-associated protein FlgK [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 499

 Score =  186 bits (471), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 129/498 (25%), Positives = 220/498 (44%), Gaps = 20/498 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           MSLL+ F+ A    ++ + Q A + RNI NAD+    R+    T+     V +++     
Sbjct: 1   MSLLSAFSNATASLSSVASQSALVSRNIANADSPYATRKYAGLTVGQTGGVRIMSIAQSG 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                + L   +SA+G   +          +  D     SP   +S L+ +L  ++ +  
Sbjct: 61  DQALFRSLITTNSALGSASVSAQSLNRIREVIGDVDSPTSPAATLSSLKAALSQFAVSPE 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                +  ++ A ++  + N +   VQ  R DAD +++L   ++ R L E   +N  I  
Sbjct: 121 NGQTAEAAVNAARDMALSLNRATSAVQSARKDADDQLDLAAKDMNRLLGEFGTLNAKIMA 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            +AS  D  D +D+RD +++ +S  +G++  VR  NDM +YT  G T+F+   R + F  
Sbjct: 181 GSASGSDVTDAVDRRDQIVRTLSGYVGLNVQVRAGNDMALYTDSGITMFDKTARSVEFTP 240

Query: 240 MNSYTVTSESNPIFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
             +Y  T   N   IDGVVV  ++    +  G +  L+ +RD     FQ QLD +A  L+
Sbjct: 241 QPAYDATVAGNSFKIDGVVVAGASSPMPIKGGSVYGLITLRDETAATFQGQLDGIAYALV 300

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC------------VNPQYRS 346
            +F+E D  A           A    D  +                          +   
Sbjct: 301 QAFAETDQRAAGDPGYLPGSYAGLFTDGGSNAIPASMAGAKGLAGTIQIAAGVDPTKPGG 360

Query: 347 NPSFLRDGGSVSKKF------LWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
            P+ LRDGG             +N    +G+   +N     F+    FD   G  ++ TL
Sbjct: 361 EPARLRDGGIAFAGTANEQYFSYNANGSSGFTGRLNDLIAGFSMPRSFDAAFGAGSSATL 420

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
            EY  +SIGW E  R+ ++D      V+ +   E+ S+  G+N+ +E++ L+ +E+SY  
Sbjct: 421 TEYTASSIGWFEGRRATANDASSYQTVLLSRTQETLSDATGINIDDEMTRLLDLERSYQA 480

Query: 461 SNKLIMFTDKMLQTLLEG 478
           S+KLI    +M+ +LL  
Sbjct: 481 SSKLISTVGQMIDSLLAI 498


>gi|86136708|ref|ZP_01055286.1| flagellar hook-associated protein [Roseobacter sp. MED193]
 gi|85826032|gb|EAQ46229.1| flagellar hook-associated protein [Roseobacter sp. MED193]
          Length = 471

 Score =  186 bits (471), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 80/475 (16%), Positives = 173/475 (36%), Gaps = 11/475 (2%)

Query: 11  QNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--PENVTVVTQRSENKNMFDKVLH 68
                  ++       N+ NA    Y  +    + S     V +                
Sbjct: 1   MTGLTANARLSQVTSENLANALTPGYSSQKLNLSSSQYAAGVRIGDVERNIDPALQSTTR 60

Query: 69  AHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVI 128
              +   +  +  +F +           + S +  IS    +L               + 
Sbjct: 61  KAEAEYAKVEVYANFYSRMSNFVGTVDDSTSISAQISNFDSALVEAISRPDSTERLHDLS 120

Query: 129 DNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAH 188
             A  VVQ+   +A  + + R  A+  I+L++  L   L EL  +N  I    A+  +  
Sbjct: 121 VKAGLVVQSITDAAEGLNQQREAAESSIDLQVDQLNTQLKELEKLNARIIVSQATGANTT 180

Query: 189 DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSE 248
              DQRD+L+  +++ I ++ + R+   + +YT  G  L +    +++F+   +      
Sbjct: 181 AMEDQRDLLVDAVNQAIPVNVVQRDQGRIALYTVGGVALLDGKAAELSFDVNRTIEPQMT 240

Query: 249 S-----NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSE 303
                 + + I+G+ + ++    +  G + A   IRD+V    QN LD MAR L+  F +
Sbjct: 241 QANGLLSGLEINGLAMDTSSTGPLRGGTLIAAFDIRDNVTVEAQNDLDAMARDLVERFQD 300

Query: 304 KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLW 363
               A       G+F        D     G+S  + +N     +         +      
Sbjct: 301 PALDATIGATDAGIFTDG-GGAFDPSDTVGLSARLELNDLVAMDGQAETWR--LRDGLYA 357

Query: 364 NVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHM 423
             +   G    +  Y ++ ++N           +  L   + + +    ++   ++++  
Sbjct: 358 ATEGDPGDASQLIAYSEAISENRTVSTTKLGLISSDLNTLSASVMSRFARDSDSANNMLS 417

Query: 424 KSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            +   +  ++++     GV+   EL  ++ +E +Y  + K++   D+M+QTLL  
Sbjct: 418 YAATSYTELAQAELAL-GVDSDAELQNMMLIENAYAANAKMLSAIDEMMQTLLRM 471


>gi|146305256|ref|YP_001185721.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina ymp]
 gi|145573457|gb|ABP82989.1| flagellar hook-associated protein FlgK [Pseudomonas mendocina ymp]
          Length = 455

 Score =  186 bits (470), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 65/486 (13%), Positives = 150/486 (30%), Gaps = 40/486 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVV------- 53
           M++L     A +    +    AS  +NI N +   + R  T+T        +        
Sbjct: 1   MTILN--QIAYSGVRASQVALASTGQNIANVNTPGFSRLQTITGSLAGQGGLSVGGGVEV 58

Query: 54  -TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
            + R    +  ++ L   ++        Q +    E + +    +   +  + +   +L 
Sbjct: 59  ISIRRMTNDFHNQQLWRATTEQSFYSASQQYLTALEALMSGSGSSI--SAGLDQFFAALS 116

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             S       L + +I  A  + Q FN     +        ++     + +      + +
Sbjct: 117 EASATPGSIALRQQIISEAGNLAQRFNGLNSNIDAQIKALQEQRSAMATEINGLTENIAL 176

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
           +N  I    + K D+    D R+ L+ ++S+   +      +  + V  ++G  L     
Sbjct: 177 LNKKIVETESVKGDSTALRDHRESLIGQLSQFAKLRVNETPDGSVSVALANGQPLVAGPT 236

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                  M +    S    + +     S         G    L ++  + +   Q  L +
Sbjct: 237 AGQLKVAMTA----SGEQDVSLAFAGTSFPLRQDGFGGAFGGLYEVEYASLRPNQQALHD 292

Query: 293 MARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           MA  L    ++      +    PG  +     +    L +    T               
Sbjct: 293 MASQLAQMVNDVLATGFDLAGNPGQPLFAYDPNSTTALLRVEPLTAEQLA---------- 342

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
                      +    +G  +++       N+    +      + VTL +     +G + 
Sbjct: 343 ---------FSSAAGESGNNEVLLDLLGLKNQTITLN-----GSQVTLNDAYAGLLGQVA 388

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            +   +      +  V         +   V+L EE   L+  +Q+Y  + K+I   +++ 
Sbjct: 389 SDSRQNQADLKSATAVTQQAQSQRDSVSAVSLDEEAVNLMTYQQAYQANMKVISTANQLF 448

Query: 473 QTLLEG 478
             +L  
Sbjct: 449 DDMLAA 454


>gi|116250501|ref|YP_766339.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255149|emb|CAK06223.1| hook associated protein i homolog (agr_c_1014p) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 495

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 166/493 (33%), Positives = 262/493 (53%), Gaps = 15/493 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV      +
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               +     SS    Q+ L S     + +   + Y  SP+ Y+   +  L+++      
Sbjct: 61  EALLRQYLKTSSQDSAQQTLLSGLEDLKSIVGGNDYETSPSTYLGVFQQKLQAFRTTPGS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   LS+    N+A+K  
Sbjct: 121 TVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKLNTLLSDFEKANNAVKTA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T+S  DA   LD+R+  L++IS+I+G++T  R+NNDMV+ TSDGT LFET+PR++ F+  
Sbjct: 181 TSSGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTSDGTILFETIPREVTFKSQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPK-GKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + YT T   N +++DGV +    GS     G +++LLQ+RD + P FQ QLDE+AR L+ 
Sbjct: 241 DVYTATIAGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRDEIAPNFQKQLDEVARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGG 355
            F E++ +AG +        + G  D       G++ TI V+         +P  LRDGG
Sbjct: 301 LFKEQNTVAGPAYVPGLFTWSGGTVDTGATAVAGMAATITVSSRVITSQGGDPMRLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSF----------NKNFIFDPVAGINTNVTLLEYAR 405
                 + N    +GY   ++    +                FD   GI++NV+++E+A 
Sbjct: 361 INLTGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGTPVGFDATTGIDSNVSIMEFAT 420

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++
Sbjct: 421 NSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL 480

Query: 466 MFTDKMLQTLLEG 478
              D+ML++LL+ 
Sbjct: 481 NAVDEMLKSLLDI 493


>gi|209547947|ref|YP_002279864.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533703|gb|ACI53638.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 495

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 168/493 (34%), Positives = 262/493 (53%), Gaps = 15/493 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQNI NN   Q + +  NI NA NK+YVRR  M T S     VV      +
Sbjct: 1   MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           +   +     SS    Q+ L       + +   + Y  SP+ Y+   +  L+++      
Sbjct: 61  DALLRQYLKTSSQDSAQQALLGGLEDLKSIMGGNDYETSPSTYLGVFQQKLQAFRTTPGS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   LS+    N+A+K  
Sbjct: 121 TVAAQGAITAAQDVANSLNNASQSVQDVRATADKQIATDVDKLNTLLSDFEKANNAVKTA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TAS  DA   LD+R+  L++IS+I+G++   R+NNDMV+ T+DGT LFET+PR + F+  
Sbjct: 181 TASGADASGALDEREKALKQISQIVGVNATTRDNNDMVLSTTDGTILFETIPRKVTFKSQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + Y  T   N ++IDGV ++   GS    +G +++LLQ+RD + P FQ QLDE+AR L+ 
Sbjct: 241 DVYNATITGNSVYIDGVALARGSGSTTTAQGSLQSLLQVRDEIAPNFQKQLDEVARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGG 355
            F E++     +        + G  D       G++ TI V+         +P  LRDGG
Sbjct: 301 LFKEQNTAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTITVSSRVITSQGGDPMRLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEYAR 405
                 + N   L+GY   ++    +   +  FDP A          GI++NV+++EYA 
Sbjct: 361 INVNGVVLNPTGLSGYTTELDRLYTALGSDIDFDPAAGPAVGFDATTGIDSNVSIMEYAT 420

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS++      S    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++
Sbjct: 421 NSLGWLEQYRSNATTAAENSSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL 480

Query: 466 MFTDKMLQTLLEG 478
              D+ML++LL+ 
Sbjct: 481 NAVDEMLKSLLDI 493


>gi|254505051|ref|ZP_05117202.1| flagellar hook-associated protein FlgK [Labrenzia alexandrii
           DFL-11]
 gi|222441122|gb|EEE47801.1| flagellar hook-associated protein FlgK [Labrenzia alexandrii
           DFL-11]
          Length = 482

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 122/487 (25%), Positives = 218/487 (44%), Gaps = 12/487 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP------ENVTVVT 54
           MSL      AQ+       + + I RNI  A    + ++    +           + V  
Sbjct: 1   MSLSVALQVAQSALAARQTESSVIARNITGAQEPGFSKKSVQLSTMYTSSGQAGGLRVNG 60

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
                 +     L   +S    Q+              D     SP   + +L+ +L++Y
Sbjct: 61  VARMADSALYASLLTSTSVGTSQQAKLDGITRMAETIGDTELETSPAALLGELQKTLQNY 120

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + + +  ++ +  + +A+ +  +  +S+  VQ++RA+AD ++   +  +   L EL  +N
Sbjct: 121 ASDPNNSVMAQDTLQSAKNMAASLRSSSDLVQEVRANADSDMATSVREISSLLGELENLN 180

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I   T +  D  D LD RD +L  +SE IGI T+ R N D+VVYT  G TLFET  R+
Sbjct: 181 STIVKGTQNGADVTDALDDRDQVLLALSEEIGIKTMDRANGDIVVYTDSGVTLFETSARE 240

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
           ++F    +Y+  +  + + +DGV V+       +  G++  L ++RD     +Q+QLDE+
Sbjct: 241 VSFAPTTTYSPGTVGSAVIVDGVPVTGPGAIMPISSGRLHGLAELRDDTAVTYQSQLDEI 300

Query: 294 ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRD 353
           AR +I +F E +  AG        +              G++  I VNP    +     D
Sbjct: 301 ARGVIEAFGESNGDAGLFT-----WSGAPAIPPGATHSVGLAADIIVNPNADPDQGGSLD 355

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
                    +N    AG+   +     +F+ +  F     ++ + +L  +A +S+ WLE 
Sbjct: 356 RIRDGFSVAYNPAGDAGFSARLQELVGAFDTSRTFAGSVELDPDASLNSFAGSSVSWLEN 415

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            R           V+    +E+ SNT GVN+ EEL+ L++VE++Y  +++LI   D ML+
Sbjct: 416 GRKTLTKNVEIQSVIVGRTAENLSNTTGVNIDEELTLLLEVERAYAAASRLITAVDTMLE 475

Query: 474 TLLEGVK 480
            L+   +
Sbjct: 476 ELMMATR 482


>gi|322421655|ref|YP_004200878.1| flagellar hook-associated protein FlgK [Geobacter sp. M18]
 gi|320128042|gb|ADW15602.1| flagellar hook-associated protein FlgK [Geobacter sp. M18]
          Length = 481

 Score =  185 bits (468), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 80/500 (16%), Positives = 173/500 (34%), Gaps = 39/500 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------ISPENV 50
           M +  +F+ A +              NI N + + Y R+  +                 V
Sbjct: 1   MGINTIFDIASSGITANRLAIEVTGENISNVNTEGYSRQRVVMENKPVSTANGFALGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            +   +    NM    L   +S   +    QS     E    +   ++     ++    +
Sbjct: 61  EIAAVQRSYDNMLQLQLVNANSTYQESLAQQSALEQIEPSF-NSLTSDGLGTAVANFFGA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  S N S     + V+  A+ +V +F+     +  + + AD  +    + +      L
Sbjct: 120 FQDLSVNPSGSAERQAVLTRAQIMVDSFHQLDSSLTSVASTADNNLVGITAEVTDNARNL 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
            +VN  I    +   +A++ LDQRD+LL+K+SE +G++  V N+    V  + G  L  +
Sbjct: 180 ALVNTQILATNSVGGNANELLDQRDLLLRKLSEQVGVTYSVANDGTASVTLAGGAQLVSS 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ----------GSAVPKGKIKALLQIRD 280
                 +       VT++     +     ++              A   GK+   +++RD
Sbjct: 240 TRYATLYTNATGAPVTNDIMISGLGSPPPANAPATDTLVGTVGDGATVGGKLGGTMEVRD 299

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV 340
           S+VP ++  LDEMA  ++   +         +   G    D        +          
Sbjct: 300 SIVPKYRAMLDEMADEVVTQVNTLHAAGYALDGSTGNDFFDAAGLTSGSIALD------- 352

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
                   + L      +              +  N    +   +  F   A    + T 
Sbjct: 353 --------AGLSAVKIAAGFPTATDPAPTSSGNNENALKIANLGSTSF---AFSTGSATF 401

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
             +  + +  +  +   + ++  ++      ++   ++   V+L EEL  L + ++++  
Sbjct: 402 GNFYSSLVSQVGVDTEGTQNVTTQNAAFLKQLNALRASNSEVSLDEELLNLTRYQRAFQG 461

Query: 461 SNKLIMFTDKMLQTLLEGVK 480
           S K++     ML  +L  V+
Sbjct: 462 SAKVVNAATDMLDIVLGMVR 481


>gi|22127321|ref|NP_670744.1| flagellar hook-associated protein FlgK [Yersinia pestis KIM 10]
 gi|45442802|ref|NP_994341.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108809049|ref|YP_652965.1| flagellar hook-associated protein FlgK [Yersinia pestis Antiqua]
 gi|108810754|ref|YP_646521.1| flagellar hook-associated protein FlgK [Yersinia pestis Nepal516]
 gi|145597823|ref|YP_001161899.1| flagellar hook-associated protein FlgK [Yersinia pestis Pestoides
           F]
 gi|150260243|ref|ZP_01916971.1| lateral flagellar hook-associated protein 1 [Yersinia pestis
           CA88-4125]
 gi|162420194|ref|YP_001604841.1| flagellar hook-associated protein FlgK [Yersinia pestis Angola]
 gi|165925087|ref|ZP_02220919.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939060|ref|ZP_02227612.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008985|ref|ZP_02229883.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212172|ref|ZP_02238207.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399689|ref|ZP_02305213.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419324|ref|ZP_02311077.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425178|ref|ZP_02316931.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167466331|ref|ZP_02331035.1| flagellar hook-associated protein FlgK [Yersinia pestis FV-1]
 gi|218927918|ref|YP_002345793.1| flagellar hook-associated protein FlgK [Yersinia pestis CO92]
 gi|229837414|ref|ZP_04457577.1| Flagellar hook-associated protein flgK [Yersinia pestis Pestoides
           A]
 gi|229840629|ref|ZP_04460788.1| Flagellar hook-associated protein flgK [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842820|ref|ZP_04462972.1| Flagellar hook-associated protein flgK [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900951|ref|ZP_04516075.1| Flagellar hook-associated protein flgK [Yersinia pestis Nepal516]
 gi|270487666|ref|ZP_06204740.1| flagellar hook-associated protein FlgK [Yersinia pestis KIM D27]
 gi|294502794|ref|YP_003566856.1| flagellar hook-associated protein [Yersinia pestis Z176003]
 gi|21960402|gb|AAM86995.1|AE013948_3 putative flagellar hook-associated protein [Yersinia pestis KIM 10]
 gi|45437668|gb|AAS63218.1| putative flagellar hook-associated protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108774402|gb|ABG16921.1| flagellar hook-associated protein [Yersinia pestis Nepal516]
 gi|108780962|gb|ABG15020.1| putative flagellar hook-associated protein [Yersinia pestis
           Antiqua]
 gi|115346529|emb|CAL19406.1| putative flagellar hook-associated protein [Yersinia pestis CO92]
 gi|145209519|gb|ABP38926.1| flagellar hook-associated protein [Yersinia pestis Pestoides F]
 gi|149289651|gb|EDM39728.1| lateral flagellar hook-associated protein 1 [Yersinia pestis
           CA88-4125]
 gi|162353009|gb|ABX86957.1| flagellar hook-associated protein FlgK [Yersinia pestis Angola]
 gi|165913016|gb|EDR31641.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923287|gb|EDR40438.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992324|gb|EDR44625.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206918|gb|EDR51398.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166963318|gb|EDR59339.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167052193|gb|EDR63601.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055941|gb|EDR65722.1| flagellar hook-associated protein FlgK [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229682290|gb|EEO78382.1| Flagellar hook-associated protein flgK [Yersinia pestis Nepal516]
 gi|229690087|gb|EEO82144.1| Flagellar hook-associated protein flgK [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696995|gb|EEO87042.1| Flagellar hook-associated protein flgK [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229705537|gb|EEO91547.1| Flagellar hook-associated protein flgK [Yersinia pestis Pestoides
           A]
 gi|262360826|gb|ACY57547.1| flagellar hook-associated protein [Yersinia pestis D106004]
 gi|262364771|gb|ACY61328.1| flagellar hook-associated protein [Yersinia pestis D182038]
 gi|270336170|gb|EFA46947.1| flagellar hook-associated protein FlgK [Yersinia pestis KIM D27]
 gi|294353253|gb|ADE63594.1| flagellar hook-associated protein [Yersinia pestis Z176003]
 gi|320016705|gb|ADW00277.1| Flagellar hook-associated protein flgK [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 453

 Score =  185 bits (468), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 65/483 (13%), Positives = 155/483 (32%), Gaps = 43/483 (8%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQR 56
              A +          +   NI N     Y R+    +           +   V V   R
Sbjct: 4   IRTAFSGMQATQAHLNATSMNIANMHTPGYSRQRAEQSAIGADGQGGVNAGNGVNVDGIR 63

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
             ++          +S        + +    E+M +++  + S    ++    SL + ++
Sbjct: 64  RLSQQYVVMQEWRANSQQQYYDAGEQYLNAVELMVSNE--STSLATGLNNFFSSLSAATQ 121

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
                 + + +I++A  +   FN     + + +    ++ ++ +  +      +   N  
Sbjct: 122 LPDSPPMRQQIIESANAMALRFNNVNNFIVQQKKSIGQQRDITVKEINSLTRSIADYNQQ 181

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I    +  ++ +D LD++++ ++K+S +I        +    +    G  L         
Sbjct: 182 ILKNRSDGNNINDLLDKQELQIKKLSGLIETQVNQAEDGTYRISVKQGQPLVNGAVAAEL 241

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
               +S       +         ++   +    G++  +     + +   Q+   EMA+ 
Sbjct: 242 AVDTSSVDTKITLH------FSGATQGMNMSCGGQLGGINDYELTTLKKLQDSTQEMAKT 295

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           +   F+++     +    PG  +        N + Q                        
Sbjct: 296 VADKFNDQLGKGTDFTGAPGQDLFVFNPSDPNGMLQL----------------------- 332

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
                      LA +        + F    I         NV L + A   +G++    +
Sbjct: 333 --SAITAEQLALAAHGKPAGDNSNLFELLDIRKTPVTGMKNVPLDDAATALVGYIAITSN 390

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +H     ++   N  +  + +  GVN  EE   L++ +++Y  + K+I   DK+   LL
Sbjct: 391 RNHSELENAENTLNQATRYHESFSGVNNDEEAMNLMEYQRAYQSNMKVIATGDKLFSDLL 450

Query: 477 EGV 479
             V
Sbjct: 451 ALV 453


>gi|241203125|ref|YP_002974221.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857015|gb|ACS54682.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 495

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 166/493 (33%), Positives = 260/493 (52%), Gaps = 15/493 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQNI NN   Q + +  NI NA NK+YVRR  M T S     VV      +
Sbjct: 1   MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               +     SS    Q+ L       + +   + Y  SP+ Y+   +  L+++      
Sbjct: 61  EALLRQYLKTSSQDSAQQALLGGLEDLKSIVGGNDYETSPSTYLGVFQQKLQAFRTTPGS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +  +  I  A++V  + N +++ VQ +RA ADK+I  ++  L   L++    N+A+K  
Sbjct: 121 TVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKLNTLLNDFEKANNAVKTA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TAS  DA   LD+R+  L++IS+I+G++T  R+NNDMV+ TSDGT LFET+PR + F+  
Sbjct: 181 TASGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTSDGTILFETIPRKVTFKSQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPK-GKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + YT T   N +++DGV +    GS     G +++LLQ+RD + P FQ QLDE+AR L+ 
Sbjct: 241 DVYTATITGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRDEIAPNFQKQLDEVARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGG 355
            F E++  AG +        + G  D       G++ TI V+         +P  LRDGG
Sbjct: 301 LFKEQNTAAGPAYVPGLFTWSGGTVDTGATAVAGMAATITVSSRVITSQGGDPMRLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSF----------NKNFIFDPVAGINTNVTLLEYAR 405
             +   + N    +GY   ++    +                FD   GI++NV+++E+A 
Sbjct: 361 VNATGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGTPVGFDATTGIDSNVSIMEFAT 420

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++
Sbjct: 421 NSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL 480

Query: 466 MFTDKMLQTLLEG 478
              D+ML++LL+ 
Sbjct: 481 NAVDEMLKSLLDI 493


>gi|238785491|ref|ZP_04629474.1| hypothetical protein yberc0001_18240 [Yersinia bercovieri ATCC
           43970]
 gi|238713593|gb|EEQ05622.1| hypothetical protein yberc0001_18240 [Yersinia bercovieri ATCC
           43970]
          Length = 549

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 76/550 (13%), Positives = 171/550 (31%), Gaps = 80/550 (14%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVTQR 56
            N A +  + A    +++  NI N     Y R++ +   +             VTV    
Sbjct: 1   MNTAMSGLSAAQYALSTVSNNITNFQVAGYNRQNAIFAQNGGTLSPAGFIGNGVTVTGVN 60

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
            E  +     L   SS      L   ++ + ++ +   + +N+ +  +     +L++   
Sbjct: 61  REYNSFITNQLR--SSQTQSSGLTTYYQQISQIDNLLSNSSNNLSVTMQDFFSNLQNLVS 118

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++  +ND 
Sbjct: 119 NAGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKITESVTKINNYAEQIAKLNDQ 178

Query: 177 IKFKT-ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
           I     +S  + +  LDQRD L+ ++++I+G++   ++ +   V  + G  L +      
Sbjct: 179 ITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVAFASGLPLVQGSSSYK 238

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR 295
                +    T  +         V     S +  G +   L+ R   +   +NQL ++A 
Sbjct: 239 VEAIASGSDATRLAIGYKYGSGDVMEVDESRLATGSLGGTLKFRSEALDSARNQLGQLAL 298

Query: 296 VLIGSFSEKDPIAGNSENVPGLFIADG--------------------------------- 322
           V+  SF+ +     +     G                                       
Sbjct: 299 VMADSFNTQHKAGFDINGDQGENFFSFAQPNVLKNSNNQGDASLTVSYADTSKVKASDYS 358

Query: 323 -----IKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
                      +L                + + L   G             A    L+  
Sbjct: 359 VEFDGTNWQVTRLSDNTKVPANPVVDVNGDTTGLSFDGLSVSIDNGTTGAQAKDKFLVKT 418

Query: 378 YCDSFNKNFIFDPVAG-----------------------------INTNVTLLEYARNSI 408
             +      +    +                              ++   TL       +
Sbjct: 419 VSNVAANLQVDITDSSKIAAAGTADGGASDNVNAKALLDLQTQKLVDGKATLAGAYAGLV 478

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +    + +         +   ++    +  GVNL EE   L + +Q Y  + ++I   
Sbjct: 479 SNVGNQTNTAKTNSAAQANIVTQLTAEQQSISGVNLDEEYGDLQRFQQYYLANAQVIQTA 538

Query: 469 DKMLQTLLEG 478
             +   LL+ 
Sbjct: 539 STLFNALLDL 548


>gi|310764854|gb|ADP09804.1| Flagellar hook-associated protein 1, FlgK [Erwinia sp. Ejp617]
          Length = 545

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 88/546 (16%), Positives = 174/546 (31%), Gaps = 73/546 (13%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVT 54
            +FN A++  +++    + I  NI NA N +Y RRD +   S             V V  
Sbjct: 2   NLFNIARSGLSSSQAGLSVIGSNINNAMNGHYSRRDILLGESGGMISGKGFYGFGVQVNG 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            +       +  L               +E L E+ +   +   +P+  ++K  ++L+  
Sbjct: 62  VQRGYDAFINNELR--GGITACAGHKTRYEQLAEIDNMLGNDETNPSVSLNKFFEALKEM 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
            K+ S     ++       +   FN+S+  +  +    + +I+  + ++     +L  +N
Sbjct: 120 EKDPSAPAARQSAYSTLGSLTYQFNSSSERLTGLEKSTNTQIKQSVDDINSCTQQLAKLN 179

Query: 175 DAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRN-NNDMVVYTSDGTTLFETVP 232
           + I K  +       D LD RD LL+ +S   GI          M V  +DG  L     
Sbjct: 180 ENIEKIVSQHGTPPADLLDARDGLLEDLSMQTGIKVNEDKLTGRMDVTLADGRPLVSGTR 239

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                 + ++                 +      +  G +  L   R+  +   +N+L++
Sbjct: 240 VYQLKAEASAENPNKTVVSYIDASGNATRLDEERMTGGALGGLFTFRNEDLSKARNELNQ 299

Query: 293 MARVLIGSFS---------EKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN-- 341
           MA  + G F+           +P            +A+     D  +   ++        
Sbjct: 300 MALKMAGRFNEVNGQGYDQNGNPGGDLFNVPTPEALANRNNGGDASIDARLTAPYTDVKA 359

Query: 342 -------------------------------------------PQYRSNPSFLRDGGSVS 358
                                                           +   L     V+
Sbjct: 360 EDYTITFTNGDWEVKGADGRVVPHTLNAAGELEFDGVSLGVSGTAEEGDSFMLNPAAGVA 419

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN-----TNVTLLEYARNSIGWLEK 413
           +     V N        +   +  + N     + GI         TL E   + +  L  
Sbjct: 420 ENVSVAVDNGEAIAASDSSDPEEVSNNKNLAKLLGIQDEKLVGKATLTESYASLVSGLGS 479

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           + S     +  +  V N ++  + + VGVNL++E   L   E+ Y  + +++     ML 
Sbjct: 480 STSALKADYATAGSVLNELTTKWQSVVGVNLEDEYVTLSMFEKYYQANAQVLQTATTMLD 539

Query: 474 TLLEGV 479
           TLL   
Sbjct: 540 TLLAIK 545


>gi|259907640|ref|YP_002647996.1| Flagellar hook-associated protein 1, FlgK [Erwinia pyrifoliae
           Ep1/96]
 gi|224963262|emb|CAX54746.1| Flagellar hook-associated protein 1, FlgK [Erwinia pyrifoliae
           Ep1/96]
          Length = 545

 Score =  184 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 88/546 (16%), Positives = 174/546 (31%), Gaps = 73/546 (13%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVT 54
            +FN A++  +++    + I  NI NA N +Y RRD +   S             V V  
Sbjct: 2   NLFNIARSGLSSSQAGLSVIGSNINNAMNGHYSRRDILLGESGGMISGKGFYGFGVQVNG 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            +       +  L               +E L E+ +   +   +P+  ++K  ++L+  
Sbjct: 62  VQRGYDAFINNELR--GGITACAGHKTRYEQLAEIDNMLGNDETNPSVSLNKFFEALKEM 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
            K+ S     ++       +   FN+S+  +  +    + +I+  + ++     +L  +N
Sbjct: 120 EKDPSAPAARQSAYSTLGSLTYQFNSSSERLTGLEKSTNTQIKQSVDDINSCTQQLAKLN 179

Query: 175 DAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRN-NNDMVVYTSDGTTLFETVP 232
           + I K  +       D LD RD LL+ +S   GI          M V  +DG  L     
Sbjct: 180 ENIEKIVSQHGTPPADLLDARDGLLEDLSMQTGIKVNEDKLTGRMDVTLADGRPLVSGTR 239

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                 + ++                 +      +  G +  L   R+  +   +N+L++
Sbjct: 240 VYQLKAEASAENPNKTVVSYIDASGNATRLDEERMTGGALGGLFTFRNEDLSKARNELNQ 299

Query: 293 MARVLIGSFS---------EKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN-- 341
           MA  + G F+           +P            +A+     D  +   ++        
Sbjct: 300 MALKMAGRFNEVNGQGYDQNGNPGGDLFNVPTPEALANRNNGGDASIDARLTAPYTDVKA 359

Query: 342 -------------------------------------------PQYRSNPSFLRDGGSVS 358
                                                           +   L     V+
Sbjct: 360 EDYTITFTNGDWEVKGADGRVVPHTVNAAGELEFDGVSLGVSGTAEEGDSFMLNPAAGVA 419

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN-----TNVTLLEYARNSIGWLEK 413
           +     V N        +   +  + N     + GI         TL E   + +  L  
Sbjct: 420 ENVSVAVDNGEAIAASDSSDPEEVSNNKNLAKLLGIQDEKLIGKATLTESYASLVSGLGS 479

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
           + S     +  +  V N ++  + + VGVNL++E   L   E+ Y  + +++     ML 
Sbjct: 480 STSALKADYATAGSVLNELTTKWQSVVGVNLEDEYVTLSMFEKYYQANAQVLQTATTMLD 539

Query: 474 TLLEGV 479
           TLL   
Sbjct: 540 TLLAIK 545


>gi|327193060|gb|EGE59972.1| flagellar hook-associated protein [Rhizobium etli CNPAF512]
          Length = 495

 Score =  184 bits (465), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 165/493 (33%), Positives = 260/493 (52%), Gaps = 15/493 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV      +
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGSQVVKIDRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           +   +     SS    Q+ L S     + +   + Y  SP+ Y+   +  L+++  +   
Sbjct: 61  DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGNDYETSPSTYLGVFQQKLQAFRTSPGS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +  +  I  A++V  + N +++ VQ +RA ADK+I   +  L   LS+    N+A+K  
Sbjct: 121 TVAAQGAITAAQDVANSLNNASQSVQDVRAGADKQIATAVDTLNTLLSQFEKANNAVKTA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  D    LD+R+  L++IS+I+G+S   R+NNDMV+ T DGT LFET+PR + F+  
Sbjct: 181 TATGADPSSALDEREKTLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFQAQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + Y  T   N +++DGV +    GS    +G +++LLQ+RD + P FQ QLDE+AR L+ 
Sbjct: 241 DVYNATITGNSVYVDGVALPRGSGSTTTAQGSLQSLLQVRDEIAPNFQKQLDEIARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGG 355
            F E++     +        + G  D       G++ TI V+         +P  LRDGG
Sbjct: 301 LFKEQNTAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTISVSSRVITSQGGDPMRLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEYAR 405
                 + N   L+GY   ++    +   +  FDP A          GI++NV+++EYA 
Sbjct: 361 VNVNGVVNNPTGLSGYTTDLDRLYTALGSDIDFDPAAGPAVGFDATTGIDSNVSIMEYAT 420

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++
Sbjct: 421 NSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL 480

Query: 466 MFTDKMLQTLLEG 478
              D+ML++LL+ 
Sbjct: 481 NAVDEMLKSLLDI 493


>gi|253702425|ref|YP_003023614.1| flagellar hook-associated protein FlgK [Geobacter sp. M21]
 gi|251777275|gb|ACT19856.1| flagellar hook-associated protein FlgK [Geobacter sp. M21]
          Length = 480

 Score =  184 bits (465), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 72/500 (14%), Positives = 172/500 (34%), Gaps = 40/500 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           M +  +F+ A +              NI N + + Y R+  +                 V
Sbjct: 1   MGIGTLFDIASSGVTAQRLAIEVTGENIANVNTEGYSRQQVIMETKPVTTANGFPLGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            +   +    NM    +   +S+  +    Q+     +    ++   +     ++    +
Sbjct: 61  QIAAVQRTYDNMLQLQMVNGNSSYQENLAKQTALEQIQPSF-NEVTADGLGKALANFFGA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + N S     + +I  ++ +V +F+     + K+   AD  +    +        L
Sbjct: 120 WQDLTTNASGSAERQALITRSQILVDSFHQMDFTLSKVAETADSNLVGITAEATDNARNL 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
            +VN  I    +   +A++ LDQRD+LL+K+S+ + I++ +  +    V  + G  + ++
Sbjct: 180 ALVNTQILATASVGGNANELLDQRDLLLRKLSQQVEITSTINVDGTASVKVAGGGQIVDS 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV----------PKGKIKALLQIRD 280
                 +         ++     +     ++   +              GK+   +Q+RD
Sbjct: 240 TRYATLYTNATGVPAANDIMLSDLGNPPPANVPATDTLVATVGGGAAVGGKLGGTMQVRD 299

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV 340
            +VP +  +LDEMA  L+   +         +   G    D        +          
Sbjct: 300 DIVPDYLARLDEMADELVTRVNALHNAGYALDGSTGNDFFDAAGLSAGTIAL-------- 351

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
                 + +      + +     +    +G            N++  F        N + 
Sbjct: 352 ------DGTLTGVKVAAALSVPTDPVPSSGNNLNALQLAALGNQSVPF-----TTGNASF 400

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
           +    + +  +  +   + ++  +       ++   S+   V+L EEL+ L K ++++  
Sbjct: 401 VNNYNSLVSQVGVDTEGTQNVAGQGASFLKQLNALRSSNSEVSLDEELTNLTKYQRAFQG 460

Query: 461 SNKLIMFTDKMLQTLLEGVK 480
           S K+I     ML  +L  V+
Sbjct: 461 SAKVISAATDMLDIVLGMVR 480


>gi|224825783|ref|ZP_03698887.1| flagellar hook-associated protein FlgK [Lutiella nitroferrum 2002]
 gi|224602007|gb|EEG08186.1| flagellar hook-associated protein FlgK [Lutiella nitroferrum 2002]
          Length = 457

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 65/482 (13%), Positives = 157/482 (32%), Gaps = 39/482 (8%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQR 56
              A +    A     ++ +N+ N     Y R+  + +           +   V V   R
Sbjct: 4   IQNALSGAIAAQAALNTVSQNLSNEMTPGYSRQGVLLSTLVPGAGDRLGAGMGVDVTAIR 63

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
             + +  +  +   ++  G+    Q + A  E +        S +  + K   +L + S 
Sbjct: 64  RFSDSYKNLQMWQAAAGQGELAAAQPYFAQLEQVMG--SDGTSLSGGLDKFYSALNAASV 121

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
             S   L + VI  A+ + + FN         +A  +++    ++ +      +  +N  
Sbjct: 122 EPSSVPLRQQVISEADALARRFNNLNGVFATQQASLNEQRSATLAQINTITQSIAALNGK 181

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           +    A   +A   LD+RD  +  ++ ++ +    + +  + V    G  L         
Sbjct: 182 VAEADAVGTNASGLLDERDRQIDALAALVDVRVSQQPDGSLSVTLRGGQPLVIGNTAATL 241

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
             + N     + +  + +          +    G++  L Q + +V+    + +  +A  
Sbjct: 242 AAQGNV----NGTQTMTLQFAKERFTLPNDNLGGQLGGLNQYQSAVLQPMTDAVRTLAGE 297

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           L    + +     +     G  +        + + Q                  +    +
Sbjct: 298 LATRTNAQLASGFDLNGQAGAALFVFDAASTSGMLQ------------------VSAIQA 339

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
               F  +    A   +L+     +               NVT+ +      G L  +  
Sbjct: 340 DQLGFSSDPAKPANSDNLL-----ALIAIKDQSIAMTGLGNVTISDAYAQLTGHLAIDSQ 394

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +      + VV     +++ +T GVN  EE   L++ ++ Y  + K+I   +++  + L
Sbjct: 395 QNKAGLETASVVRGEAEKNWKSTSGVNSDEEAINLVEFQKMYQANMKVIAVANQLFDSTL 454

Query: 477 EG 478
             
Sbjct: 455 AI 456


>gi|291282102|ref|YP_003498920.1| Flagellar hook-associated protein FlgK [Escherichia coli O55:H7
           str. CB9615]
 gi|290761975|gb|ADD55936.1| Flagellar hook-associated protein FlgK [Escherichia coli O55:H7
           str. CB9615]
          Length = 547

 Score =  183 bits (463), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 153/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++S+I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELSQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +    +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSCADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDEGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|51597631|ref|YP_071822.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           IP 32953]
 gi|186896765|ref|YP_001873877.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           PB1/+]
 gi|51590913|emb|CAH22569.1| putative flagellar hook-associated protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699791|gb|ACC90420.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           PB1/+]
          Length = 453

 Score =  183 bits (463), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 67/483 (13%), Positives = 157/483 (32%), Gaps = 43/483 (8%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQR 56
              A +          +   NI N     Y R+    +           +   V V   R
Sbjct: 4   IRTAFSGMQATQAHLNATSMNIANMHTPGYSRQRAEQSAIGADGQGGVNAGNGVNVDGIR 63

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
             ++          +S        + +    E+M +++  + S    ++    SL + ++
Sbjct: 64  RLSQQYVVMQEWRANSQQQYYDAGEQYLNAVELMVSNE--STSLATGLNNFFSSLSAATQ 121

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
                 + + VI++A  +   FN     + + +    ++ ++ +  +      +   N  
Sbjct: 122 LPDSPPMRQQVIESANAMALRFNNVNNFIVQQKKSIGQQRDITVKEINSLTRSIADYNQQ 181

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           I    +  ++ +D LD++++ ++K+S +I        +    +    G  L         
Sbjct: 182 ILKNRSDGNNINDLLDKQELQIKKLSGLIETQVNQAEDGTYRISVKQGQPLVNGAVAAEL 241

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
               +S       +         ++   +    G++  +     + +   Q+   EMA+ 
Sbjct: 242 AVDTSSVDTKITLH------FSGATQGMNMSCGGQLGGINDYELTTLKKLQDSTQEMAKT 295

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           +   F+++     +    PG  +        N + Q  + T                   
Sbjct: 296 VADKFNDQLGKGTDFTGAPGQDLFVFNAGDPNGMLQLSAITAEQLA-------------- 341

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
                L +    AG    +    D                NV L + A   +G++    +
Sbjct: 342 -----LADRGKPAGDNSNLFKLLDIRQTPVTGM------KNVALDDAATALVGYIAITSN 390

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +H     ++   N  +  + +  GVN  EE   L++ +++Y  + K+I   DK+   LL
Sbjct: 391 RNHSELENAENTLNQATRYHESFSGVNNDEEAMNLMEYQRAYQSNMKVIATGDKLFSDLL 450

Query: 477 EGV 479
             V
Sbjct: 451 ALV 453


>gi|74311643|ref|YP_310062.1| flagellar hook-associated protein FlgK [Shigella sonnei Ss046]
 gi|73855120|gb|AAZ87827.1| flagellar hook-filament junction protein 1 [Shigella sonnei Ss046]
 gi|323165592|gb|EFZ51379.1| flagellar hook-associated protein FlgK [Shigella sonnei 53G]
          Length = 547

 Score =  182 bits (462), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 153/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITVANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQELDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGEDFFTIGKPAVLQNTKNKGDVAIGATVTDASVVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEKDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|300954378|ref|ZP_07166832.1| flagellar hook-associated protein FlgK [Escherichia coli MS 175-1]
 gi|301029703|ref|ZP_07192757.1| flagellar hook-associated protein FlgK [Escherichia coli MS 196-1]
 gi|299877391|gb|EFI85602.1| flagellar hook-associated protein FlgK [Escherichia coli MS 196-1]
 gi|300318614|gb|EFJ68398.1| flagellar hook-associated protein FlgK [Escherichia coli MS 175-1]
 gi|323942551|gb|EGB38718.1| flagellar hook protein FlgK [Escherichia coli E482]
          Length = 547

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 153/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMEQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|209773324|gb|ACI84974.1| flagellar hook-filament junction protein 1 FlgK [Escherichia coli]
 gi|320659346|gb|EFX26915.1| flagellar hook-associated protein FlgK [Escherichia coli O55:H7
           str. USDA 5905]
          Length = 547

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 64/548 (11%), Positives = 153/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +    +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSCADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDEGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|167574707|ref|ZP_02367581.1| flagellar hook-associated protein FlgK [Burkholderia oklahomensis
           C6786]
          Length = 452

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 65/476 (13%), Positives = 154/476 (32%), Gaps = 32/476 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSENKNMF 63
            +     +    A+    +   N  N     Y RR  + +      V        N++  
Sbjct: 2   NLIYIGMSGLRAANWSLRATADNTSNLATSGYSRRGVLLSSGANGGVDTSATLRFNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSA---DDHYNNSPTHYISKLRDSLESYSKNLSE 120
            + L   +  +G+ +  QS+    E +++    +  + +    +     SL + S +   
Sbjct: 62  TQQLWTTNGKLGRHKASQSYLDQLERLTSISLPEGKSKTNDLGMGAFFASLNAASTDPGS 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L + V+D    + + FN     + +   + ++     +  +    + +  +N  I   
Sbjct: 122 SVLRQAVLDATGSMTKQFNNMRSTLNEQLRNIEQARVATVEEINGRAAAIAELNAKIMSG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            A+  D    LDQRDV +  +S + G+  + + N  + V    G  L           + 
Sbjct: 182 QAAGADVSGLLDQRDVAVDALSGLAGVRVVQQPNGTVDVSLGTGQPLVLGNQAATMAVEH 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    S    + +     +    +A   G ++ L  + D V+      L  +   L+  
Sbjct: 242 DA----SGRQTLSLTFGDQTMPVRTASVGGALRGLSDVEDDVLRPQMEALRSLGSQLVDL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            + +     +    PG  +                 T   +         L+        
Sbjct: 298 VNTQLGDGYDMNGKPGKPL----------------ITYDPSTGMLGIDKTLKPDDLAFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + A    LI       +   +          V+L       +  +     ++  
Sbjct: 342 DPDNPGDNANLRALIELGHSKIDVPGL--------GTVSLENATAVMMAKIGSASRENKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           L   +          + +  GV+  EE   +++ ++ Y+ + K+I   +++ +T L
Sbjct: 394 LLETADATRAQAERDWQSVSGVDKDEEAMNILRFKEMYSANMKVISVANELFETTL 449


>gi|86356331|ref|YP_468223.1| flagellar hook-associated protein FlgK [Rhizobium etli CFN 42]
 gi|86280433|gb|ABC89496.1| flagellar hook-associated protein [Rhizobium etli CFN 42]
          Length = 495

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 168/493 (34%), Positives = 261/493 (52%), Gaps = 15/493 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQNI NN   Q + +  NI NA NK+YVRR  M T S     VV      +
Sbjct: 1   MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           +   +     SS    Q+ L S     + +   + Y  SP+ Y+   +  L+++  +   
Sbjct: 61  DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGNDYETSPSTYLGVFQQKLQAFRTSPGS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +  +  I  A++V  + N +++ VQ +RA+ADKEI   +  L   LSE    N+A+K  
Sbjct: 121 TVAAQGAITAAQDVANSLNNASQSVQDVRANADKEIATAVDTLNTLLSEFEKANNAVKTA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  D    LD+R+ +L++IS+I+G+S   R+NNDMV+ T DGT LFET+PR + F+  
Sbjct: 181 TATGADTSGALDEREKVLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFKSQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPK-GKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + YT T+  N ++IDGV +   +GS     G +++LLQIRD + P FQ QLDE AR L+ 
Sbjct: 241 DIYTATTVGNSVYIDGVALPLGKGSTTTGQGSLQSLLQIRDEIAPNFQKQLDETARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGG 355
            F E++     +        + G  D       G++ TI V+         +P  LRDGG
Sbjct: 301 LFKEQNTAGPPAYVPGLFTWSGGTVDTGATAVAGMASTITVSTRVITSQGGDPMRLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNK----------NFIFDPVAGINTNVTLLEYAR 405
             +   + N   ++GY   ++    +                FD   GI++NV+++EYA 
Sbjct: 361 VNAAGVVLNTSGVSGYTAELDRLYTAMTSDMDFDPAAGAPVGFDATTGIDSNVSIMEYAT 420

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++
Sbjct: 421 NSLGWLEQYRSNATTAAENTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL 480

Query: 466 MFTDKMLQTLLEG 478
              D+ML++LL+ 
Sbjct: 481 NAVDEMLKSLLDI 493


>gi|293433372|ref|ZP_06661800.1| flagellar hook-associated protein FlgK [Escherichia coli B088]
 gi|291324191|gb|EFE63613.1| flagellar hook-associated protein FlgK [Escherichia coli B088]
          Length = 547

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +  + + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAVRQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|304392492|ref|ZP_07374432.1| flagellar hook-associated protein FlgK [Ahrensia sp. R2A130]
 gi|303295122|gb|EFL89482.1| flagellar hook-associated protein FlgK [Ahrensia sp. R2A130]
          Length = 481

 Score =  182 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 127/486 (26%), Positives = 248/486 (51%), Gaps = 11/486 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDT--MTTISPENVTVVTQRSE 58
           MSL      AQN   N S+  +++ RNI  +D+ NYVRR+   +   +    T+ ++   
Sbjct: 1   MSLTQALGSAQNSLLNISRGTSTVARNISRSDDANYVRRELSNIAGANRAPQTITSRAQL 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +  +    + A S + GQ+ +    + +   ++  D  ++     +++L++SL+ ++   
Sbjct: 61  DAQLTRTQIDALSRSAGQEVIAGQLDRMAIAINGIDGESSPLAG-LTRLQNSLQVWAARP 119

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           S++ LG   +D+A  +V+  N + + V + R   D+  + ++++L   L        AI 
Sbjct: 120 SDETLGGAAVDSARTLVRGLNRAQQAVGEARLSIDRLAQDDVASLNGLLQRFKATERAIA 179

Query: 179 ---FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
                + +   A D +D+RD L+++I++I+ +++I R++   ++ TS+G T+F+   R +
Sbjct: 180 GNDDTSLTAEKAMDAMDERDNLIRQIAQIVPVTSIARSDRSTMLVTSNGATIFDDTARTV 239

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK-GKIKALLQIRDSVVPIFQNQLDEMA 294
           +     S  V S+ + + +DGV + + QGS     G +   LQ+RD  +   + QLD +A
Sbjct: 240 SL----SLPVGSQQSRVLVDGVPLPAAQGSDTDARGSLSGYLQLRDGALADQERQLDAIA 295

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
             LI  F+E D   G +    GLF   G   +      G + +I ++P + +NP+ LRDG
Sbjct: 296 GQLISQFAETDLSGGGAPPAVGLFTWSGAPAVPGATAIGTARSIAIDPAFEANPNLLRDG 355

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
           G+     + N    A + DL+N   D+            I+  +T+ ++A  SIGWL+  
Sbjct: 356 GANGASTVANTSGGASFSDLLNQRIDALETPAAIGSATQISGTLTISQFASQSIGWLDGA 415

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
           RS +     +   +   +SE+ SN  GVN+ EE++ L+++E++Y  S +++   D++  T
Sbjct: 416 RSTASRAADEKSALATRLSENLSNEGGVNIDEEMTRLLQLERAYEASARIVSTVDRLFDT 475

Query: 475 LLEGVK 480
           LL  ++
Sbjct: 476 LLASIR 481


>gi|157160609|ref|YP_001457927.1| flagellar hook-associated protein FlgK [Escherichia coli HS]
 gi|170020522|ref|YP_001725476.1| flagellar hook-associated protein FlgK [Escherichia coli ATCC 8739]
 gi|312971219|ref|ZP_07785397.1| flagellar hook-associated protein FlgK [Escherichia coli 1827-70]
 gi|157066289|gb|ABV05544.1| flagellar hook-associated protein FlgK [Escherichia coli HS]
 gi|169755450|gb|ACA78149.1| flagellar hook-associated protein FlgK [Escherichia coli ATCC 8739]
 gi|310336421|gb|EFQ01607.1| flagellar hook-associated protein FlgK [Escherichia coli 1827-70]
          Length = 547

 Score =  182 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDEGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASVVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|315618252|gb|EFU98842.1| flagellar hook-associated protein FlgK [Escherichia coli 3431]
          Length = 547

 Score =  182 bits (460), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 152/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +   +  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKLIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|197120116|ref|YP_002140543.1| flagellar hook-associated protein FlgK [Geobacter bemidjiensis Bem]
 gi|197089476|gb|ACH40747.1| flagellar hook-associated protein FlgK [Geobacter bemidjiensis Bem]
          Length = 482

 Score =  182 bits (460), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/500 (14%), Positives = 170/500 (34%), Gaps = 38/500 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           M +  +F+ A +              NI N +   Y R+  +                 V
Sbjct: 1   MGIGTLFDIASSGVTAQRLAIEVTGENIANVNTDGYSRQQVIMENKPVTTANGFPLGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            +   +    NM        +S+  +    Q+     +    ++  ++     ++    +
Sbjct: 61  QIGAVQRTYDNMLQLQQVNGNSSYQENLAKQTALEQIQPSF-NELTSDGLGKALTNFFGA 119

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + N S     + +I  ++ +V +F+     +  + + AD  +    +        L
Sbjct: 120 WQDLTTNASGSAERQALITRSQILVDSFHQMDFTLSNVASTADSNLVGITAEATDNARNL 179

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
            +VN  I    +   +A++ LDQRD+LL+K+S+ + I++ +  +    V    G  +  +
Sbjct: 180 ALVNTQILATGSVGGNANELLDQRDLLLRKLSQQVSITSTINADGTASVTLPGGGQIVNS 239

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAV----------PKGKIKALLQIRD 280
                 +         ++     +     ++   +              GK+   +Q+RD
Sbjct: 240 TRYATLYTNATGAPAANDIMLSALGNPPPANVPATDTLVATVGGGATVGGKLGGTMQVRD 299

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV 340
            +VP +  +L+EMA  L+   +         +   G    +                   
Sbjct: 300 GIVPGYLARLNEMANQLVTRTNTLHSAGYALDGTTGNNFFNPAGLTAGS----------- 348

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
                   +  +   ++       +   +G       +    N++  F        N + 
Sbjct: 349 -IALDGALTGTKVAAALPVVPTDPIPTSSGNNLNALQFVALGNQSVPF-----TTGNASF 402

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
           +    + +  +  +   + ++  +       +S   S+   V+L EEL+ L K ++++  
Sbjct: 403 VNNYNSLVSQVGVDTEGTQNVASQGASFLKQLSALRSSNSEVSLDEELTNLTKYQRAFQG 462

Query: 461 SNKLIMFTDKMLQTLLEGVK 480
           S K+I     ML T+L  V+
Sbjct: 463 SAKVISAATDMLDTVLGMVR 482


>gi|320664481|gb|EFX31632.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. LSU-61]
          Length = 547

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAARTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDEGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|187732740|ref|YP_001880749.1| flagellar hook-associated protein FlgK [Shigella boydii CDC
           3083-94]
 gi|187429732|gb|ACD09006.1| flagellar hook-associated protein FlgK [Shigella boydii CDC
           3083-94]
          Length = 547

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 153/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRMTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEKDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|221640803|ref|YP_002527065.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           KD131]
 gi|332559781|ref|ZP_08414103.1| FlgK2 [Rhodobacter sphaeroides WS8N]
 gi|221161584|gb|ACM02564.1| Flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           KD131]
 gi|332277493|gb|EGJ22808.1| FlgK2 [Rhodobacter sphaeroides WS8N]
          Length = 481

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 91/490 (18%), Positives = 168/490 (34%), Gaps = 21/490 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MS+    + A +  N  S+   +   N+ NA  + + RR+   T        + V  V  
Sbjct: 1   MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSYGGGGQGVRTVGI 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                           +A G +    +F       + D     S    IS    SL + +
Sbjct: 61  DRMVNMALVADRRLADAATGDRDTRAAFYQALADATGDTG-GGSLLARISAFSASLVTAA 119

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                    + V+D A+ +      ++  V + R  AD  I  +I  L   L+ +  +N 
Sbjct: 120 SRPESQARLQDVLDKAQSLAAGLRAASDAVLEARRAADASIADQIKTLTATLARVQQMNA 179

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     +  D+    D+R  L+  IS I+ +  + R N  + ++T+ G  L +    DI
Sbjct: 180 TITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLDGRVADI 239

Query: 236 NFEKMN-----SYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            FE        S     +   + ++G+ +  +  G  +  G + A   +RD + P  Q +
Sbjct: 240 AFEPEPGLVAASSVAAGDLGLLTVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAEQAR 299

Query: 290 LDEMARVLIGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
           LD +A+ LIG  +  D         +     A         L   +S     +P      
Sbjct: 300 LDALAQDLIGRMAAADASLGAGDAGLFTDDGAAFDPAAPAGLASRLSVNALADPDRGGAL 359

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             LRDG     +       L                        G++   +    A  ++
Sbjct: 360 WHLRDGLQRPSEGDSGDPTLLNALAAA-------LDARTPHAANGLSGTFSFSGLAAETV 412

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
                    +      +    + +        GV+   E+  L+ +E++Y  + K++   
Sbjct: 413 SGAAVALVSAEAEASFASARRDELQALILAD-GVDTDREMEQLLLLERAYAANAKVVTAC 471

Query: 469 DKMLQTLLEG 478
           D +LQ LLE 
Sbjct: 472 DDLLQYLLEM 481


>gi|332669180|ref|YP_004452188.1| flagellar hook-associated protein FlgK [Cellulomonas fimi ATCC 484]
 gi|332338218|gb|AEE44801.1| flagellar hook-associated protein FlgK [Cellulomonas fimi ATCC 484]
          Length = 480

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/492 (11%), Positives = 131/492 (26%), Gaps = 34/492 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS  +    A +      Q      +N+ NA+   Y R+    +                
Sbjct: 1   MSTFSGLGTALSSLIAQRQALDVAGQNVANANTVGYTRQRASMSALPAAQVPSMFSVNHG 60

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
           + E V V           D  L   +             A  E     +         ++
Sbjct: 61  AGEGVRVTGIERLGDVFLDMRLRTQTGGASYLAARADAYATLEKSLG-EPGETGLASQLA 119

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
            +  +    S    +D     V+  +  V     T     +     A       +  +  
Sbjct: 120 TMWGAWADLSNTPDKDSARAVVMQESTAVADRIATLYTAARTQWTQALSTTTALVDKVNT 179

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             + +  +N  I   T S   A++  DQRD+L+  ++ ++G S + R N  + V      
Sbjct: 180 TAAGVADLNARILEITNSGGTANELADQRDLLVMDLASLVGASAVTRENGQVDVLVGGNA 239

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPI 285
            +       +  +   S+   +         V V   +      G     +    SV+  
Sbjct: 240 LVSGKRAHALEVQGARSFAQATGDTATPGQPVTVVWAERPTQSAGLDGGRVAGLLSVLAP 299

Query: 286 FQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYR 345
                     V   +  +       ++       A                 +       
Sbjct: 300 AGPGGTGGPLVEAAARYDALAQTIATKVNAFHSTA-----------------VTTTGAAG 342

Query: 346 SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYAR 405
            +   +      +      V + +           + + +      A          +  
Sbjct: 343 GDFWAVDGPEPPALALRIAVADRSAIAVAAAG-AGALDGSVGDQIAALKTDETGPDAHWS 401

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
            ++  L    + +      ++       +       V+  EE   ++  +++Y  + +++
Sbjct: 402 ATVVDLGVRAASASARSKVAESARVTAQQQQLAATSVDTDEETVNMLAFQRAYEGAARVL 461

Query: 466 MFTDKMLQTLLE 477
              D+ML TL+ 
Sbjct: 462 TAVDEMLDTLIN 473


>gi|331652135|ref|ZP_08353154.1| flagellar hook-associated protein FlgK [Escherichia coli M718]
 gi|331050413|gb|EGI22471.1| flagellar hook-associated protein FlgK [Escherichia coli M718]
          Length = 547

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 153/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIVAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLVLTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|15801199|ref|NP_287216.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           EDL933]
 gi|15830714|ref|NP_309487.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. Sakai]
 gi|168747142|ref|ZP_02772164.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4113]
 gi|168758625|ref|ZP_02783632.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4401]
 gi|168764494|ref|ZP_02789501.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4501]
 gi|168767741|ref|ZP_02792748.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4486]
 gi|168773927|ref|ZP_02798934.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4196]
 gi|168783612|ref|ZP_02808619.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4076]
 gi|168790017|ref|ZP_02815024.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC869]
 gi|168802027|ref|ZP_02827034.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC508]
 gi|195935472|ref|ZP_03080854.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4024]
 gi|208808965|ref|ZP_03251302.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4206]
 gi|208815841|ref|ZP_03257020.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4045]
 gi|208822064|ref|ZP_03262383.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4042]
 gi|209396607|ref|YP_002269928.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4115]
 gi|217328179|ref|ZP_03444261.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. TW14588]
 gi|254792464|ref|YP_003077301.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. TW14359]
 gi|261227013|ref|ZP_05941294.1| flagellar hook-filament junction protein 1 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256247|ref|ZP_05948780.1| flagellar hook-filament junction protein 1 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|12514623|gb|AAG55828.1|AE005318_5 flagellar biosynthesis, hook-filament junction protein 1
           [Escherichia coli O157:H7 str. EDL933]
 gi|13360924|dbj|BAB34883.1| flagellar hook-filament junction protein 1 FlgK [Escherichia coli
           O157:H7 str. Sakai]
 gi|187770507|gb|EDU34351.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4196]
 gi|188018095|gb|EDU56217.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4113]
 gi|188999081|gb|EDU68067.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4076]
 gi|189354572|gb|EDU72991.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4401]
 gi|189363324|gb|EDU81743.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4486]
 gi|189365527|gb|EDU83943.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4501]
 gi|189370488|gb|EDU88904.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC869]
 gi|189375922|gb|EDU94338.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC508]
 gi|208728766|gb|EDZ78367.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4206]
 gi|208732489|gb|EDZ81177.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4045]
 gi|208737549|gb|EDZ85232.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4042]
 gi|209158007|gb|ACI35440.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC4115]
 gi|209773318|gb|ACI84971.1| flagellar hook-filament junction protein 1 FlgK [Escherichia coli]
 gi|209773320|gb|ACI84972.1| flagellar hook-filament junction protein 1 FlgK [Escherichia coli]
 gi|209773322|gb|ACI84973.1| flagellar hook-filament junction protein 1 FlgK [Escherichia coli]
 gi|209773326|gb|ACI84975.1| flagellar hook-filament junction protein 1 FlgK [Escherichia coli]
 gi|217318606|gb|EEC27032.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. TW14588]
 gi|254591864|gb|ACT71225.1| flagellar hook-filament junction protein 1 [Escherichia coli
           O157:H7 str. TW14359]
 gi|320189765|gb|EFW64421.1| Flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. EC1212]
 gi|320637533|gb|EFX07333.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. G5101]
 gi|320643094|gb|EFX12295.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H-
           str. 493-89]
 gi|320648552|gb|EFX17207.1| flagellar hook-associated protein FlgK [Escherichia coli O157:H-
           str. H 2687]
 gi|320653866|gb|EFX21940.1| flagellar hook-associated protein FlgK [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|326339304|gb|EGD63118.1| Flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. 1125]
 gi|326344735|gb|EGD68483.1| Flagellar hook-associated protein FlgK [Escherichia coli O157:H7
           str. 1044]
          Length = 547

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDEGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|292489127|ref|YP_003532014.1| flagellar hook-filament junction protein 1 [Erwinia amylovora
           CFBP1430]
 gi|292900246|ref|YP_003539615.1| flagellar hook-associated protein 1 [Erwinia amylovora ATCC 49946]
 gi|291200094|emb|CBJ47220.1| flagellar hook-associated protein 1 [Erwinia amylovora ATCC 49946]
 gi|291554561|emb|CBA22169.1| Flagellar hook-filament junction protein 1 [Erwinia amylovora
           CFBP1430]
 gi|312173285|emb|CBX81540.1| Flagellar hook-filament junction protein 1 [Erwinia amylovora ATCC
           BAA-2158]
          Length = 545

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 85/546 (15%), Positives = 169/546 (30%), Gaps = 73/546 (13%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTVVT 54
            +FN A++  +++    + I  NI NA N +Y RRD +   S             V V  
Sbjct: 2   NLFNIARSGLSSSQAGLSVIGSNINNAMNGHYSRRDILLGESGGMISGKGFYGFGVQVNG 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            +       +  +   S           +E L E+ +   +   +P+  ++K  D+L+  
Sbjct: 62  VQRGYDAFINNEMR--SGITACAGHKARYEQLAEIDNMLGNDETNPSVSLNKFFDALKEM 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
            K+ S     ++       +   FN+S+  +  +    + +I+  + ++     +L  +N
Sbjct: 120 EKDPSAPAARQSAFSTLGSLTYQFNSSSERLTGLEKSTNTQIKQSVDDINSCTQQLAKLN 179

Query: 175 DAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRN-NNDMVVYTSDGTTLFETVP 232
           + I K  +       D LD RD LL+ +S   GI          M V  +DG  L     
Sbjct: 180 ENIEKIVSQHGTPPADMLDARDGLLEDLSMQTGIKVSEDKLTGRMDVMLADGRPLVSGSR 239

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDE 292
                 + ++                 +      +  G +  L   R+  +   +N+L++
Sbjct: 240 VYQLKAEASAENPNKTVVSYIDASGNATRLDEERMTGGALGGLFTFRNEDLSKARNELNQ 299

Query: 293 MARVLI-------------------------------------------------GSFSE 303
           MA  +                                                     + 
Sbjct: 300 MALKMAGRFNEVNGQGYDQNGNPGGDLFNVPTPEALANRNNGGTASIDVKLTAPYTDINA 359

Query: 304 KDPIAGNSENV-----PGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
           +D     +            +     +   +L                +   L     V+
Sbjct: 360 EDYTITFTNGDWEVKGADGRVVPHTVNAAGELEFDGVSLGVSGTAEEGDSFMLNPAAGVA 419

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN-----TNVTLLEYARNSIGWLEK 413
           +     + N        +   +  + N     + GI         TL E   + +  L  
Sbjct: 420 ENVSVAIANGEAIAASDSSDPEEVSNNKNLALLLGIQDEKLIGKATLTESYASLVSGLGS 479

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
             S     +  S  V   ++  + + VGVNL++E   L   E+ Y  + +++     ML 
Sbjct: 480 TTSALKADYSTSGSVLKELTTKWQSVVGVNLEDEYVTLSMFEKYYQANAQVLQTATTMLD 539

Query: 474 TLLEGV 479
           TLL   
Sbjct: 540 TLLAIK 545


>gi|156934434|ref|YP_001438350.1| flagellar hook-associated protein FlgK [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156532688|gb|ABU77514.1| hypothetical protein ESA_02265 [Cronobacter sakazakii ATCC BAA-894]
          Length = 552

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 73/554 (13%), Positives = 163/554 (29%), Gaps = 79/554 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           MS  ++ N A +  + A    +++  NI N +   Y R+ T+   S             V
Sbjct: 1   MS-SSLINSAMSGLSAAQTALSTVSNNISNYNVAGYTRQTTVLGQSNSTMTQGGWVGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V   + E        L+A  +            +  + M       N+ +  +     S
Sbjct: 60  YVSGIQREYDAFITNQLNAAQNQSSGLTTRYEQMSKIDDM--VSGTTNNISTTMQDFFKS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++ + N  +    +T++  A+ +V  F    + ++      +  +   +  +  + +++
Sbjct: 118 LQTLASNAEDPAARQTLLGKADGLVNQFKVVDQYLRDQDKQVNTAVTASVQQINNYATQI 177

Query: 171 TVVNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +N+ I   T   +    +D LDQRD L+ ++++I+G+   V++ N   V  ++G  L 
Sbjct: 178 ASLNEQITRLTGMGAGASPNDLLDQRDQLVSELNKIVGVDVSVQDGNTFNVTMANGYNLV 237

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
           +           +S   +  +                 V  G +  L   R   +   +N
Sbjct: 238 QGSKASQVAAVPSSADPSRTTIAFVDKTAGNIEIPEKLVTSGSLGGLFAFRSEDLDQARN 297

Query: 289 QLDEMARVLIGSFSEKD--------------------------------------PIAGN 310
            L ++A     +F+++                                         +  
Sbjct: 298 NLGQIALAFGDAFNKQHEAGFDANGDVGKAFFKLGSPAAMSNARNTGSASLTASITDSTA 357

Query: 311 SENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVK---- 366
            +        DG      +L   ++           N + L   G               
Sbjct: 358 VKASNYQMAYDGTNWKVTRLSDNVTVNATPTTDGAGNVTALEFDGLKIGITGAAANKDTF 417

Query: 367 ----------------------NLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
                                  +A           +            +  + T  +  
Sbjct: 418 IVKPVNDVIISMDVNVHDESEIAMASDATSGESDNRNGKALLDLQNSKVVGGSKTFNDAY 477

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
              I  +    +           V   ++    +  GVNL EE   L + +Q Y  + ++
Sbjct: 478 AAFISEVGNKTNTLKSSSTTQTNVVTQLTNQQQSISGVNLDEEYGNLQRYQQYYMANAQV 537

Query: 465 IMFTDKMLQTLLEG 478
           +     +   LL+ 
Sbjct: 538 LQTASALFDALLQI 551


>gi|323190594|gb|EFZ75866.1| flagellar hook-associated protein FlgK [Escherichia coli RN587/1]
          Length = 547

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYIDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGKDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|293414375|ref|ZP_06657024.1| flagellar hook-associated protein FlgK [Escherichia coli B185]
 gi|291434433|gb|EFF07406.1| flagellar hook-associated protein FlgK [Escherichia coli B185]
          Length = 547

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDEGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|194432475|ref|ZP_03064762.1| flagellar hook-associated protein FlgK [Shigella dysenteriae 1012]
 gi|194419362|gb|EDX35444.1| flagellar hook-associated protein FlgK [Shigella dysenteriae 1012]
 gi|332092937|gb|EGI98005.1| flagellar hook-associated protein FlgK [Shigella dysenteriae
           155-74]
          Length = 547

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 152/548 (27%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAKDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                            I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +           F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGPELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 TIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|188492078|ref|ZP_02999348.1| flagellar hook-associated protein FlgK [Escherichia coli 53638]
 gi|188487277|gb|EDU62380.1| flagellar hook-associated protein FlgK [Escherichia coli 53638]
          Length = 547

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNSQHKAGFDANGDAGEDFFAIGKPAVLQNTKNNGNVAIGATVTDASVVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|254182888|ref|ZP_04889481.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1655]
 gi|184213422|gb|EDU10465.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           1655]
          Length = 452

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 67/479 (13%), Positives = 151/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATAGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +           K   +LE+ S +  +
Sbjct: 62  TQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLGFGKFIGALEAASGDPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSMANGQPLVVGAQAGKIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    +    + +          +A   G++  L +  + V+      L  +A      
Sbjct: 242 DA----AGQQTLSLTFGSQVMPLRAASLGGELLGLAEFEEEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            +++     +    PG  +                 T             ++        
Sbjct: 298 INDQLTQGFDMNGNPGKPLL----------------TYDAATGLLGVDPSVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    LI     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALIEIGSTSVDLPGI--------GDVSLGNAFATMMGKVGAASQQNKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|167567756|ref|ZP_02360672.1| flagellar hook-associated protein FlgK [Burkholderia oklahomensis
           EO147]
          Length = 452

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/476 (13%), Positives = 153/476 (32%), Gaps = 32/476 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP-ENVTVVTQRSENKNMF 63
            +     +    A+    +   N  N     Y RR  + +      V        N++  
Sbjct: 2   NLIYIGMSGLRAANWSLRATADNTSNLATSGYSRRGVLLSSGANGGVDTSATLRFNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSA---DDHYNNSPTHYISKLRDSLESYSKNLSE 120
            + L   +  +G+ +  QS+    E +++    +  + +    +     SL + S +   
Sbjct: 62  TQQLWTTNGKLGRHKASQSYLDQLERLTSISLPEGKSKTNDLGMGAFFASLNAASTDPGS 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L + V+D    + + FN     + +   + ++     +  +    + +  +N  I   
Sbjct: 122 SVLRQAVLDATGSMTKQFNNMRSTLNEQLRNIEQARVTTVEEINGRAAAIAELNAKIMSG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            A+  D    LDQRDV +  +S + G+  + + N  + V    G  L           + 
Sbjct: 182 QAAGADVSGLLDQRDVAVDALSGLAGVRVVQQPNGTVDVSLGTGQPLVLGNQAATMAVEH 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    S    + +     +    +A   G ++ L  + D V+      L  +   L   
Sbjct: 242 DA----SGRQTLSLTFGDQTMPVRTASVGGALRGLSDVEDDVLRPQMEALRSLGSQLADL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            + +     +    PG  +                 T   +         L+        
Sbjct: 298 VNTQLGKGYDMNGQPGKPL----------------ITYDPSTGMLGIDKTLKPDDLAFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + A    LI       +   +          V+L       +  +     ++  
Sbjct: 342 DPDNPGDNANLRALIELGHSKIDVPGL--------GTVSLENATAVMMAKIGSASRENKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
           L   +          + +  GV+  EE   +++ ++ Y+ + K+I   +++ +T L
Sbjct: 394 LLETADATRAQAERDWQSVSGVDKDEEAMNILRFKEMYSANMKVISVANELFETTL 449


>gi|254299680|ref|ZP_04967129.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           406e]
 gi|157809590|gb|EDO86760.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           406e]
          Length = 452

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/479 (13%), Positives = 151/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATAGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +           K   +LE+ S +  +
Sbjct: 62  TQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLGFGKFIGALEAASGDPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSMANGQPLVVGAQAGKIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    +    + +          +A   G++  L +  + V+      L  +A      
Sbjct: 242 DA----AGQQTLSLTFGSQVMPLRAASLGGELLGLAEFEEEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            +++     +    PG  +                 T             ++        
Sbjct: 298 INDQLTQGFDMNGNPGKPLL----------------TYDAATGLLGVDPSVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    L+     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALVEIGSTSVDLPGI--------GDVSLGNAFATMMGKVGAASQQNKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|320196436|gb|EFW71059.1| Flagellar hook-associated protein FlgK [Escherichia coli WV_060327]
          Length = 547

 Score =  181 bits (458), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     +L+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTNLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYIDGTAGNIEIPEKLLNTGSLGGILTFRSLDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGKDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|222032835|emb|CAP75574.1| flagellar hook-associated protein 1 [Escherichia coli LF82]
 gi|312945644|gb|ADR26471.1| flagellar hook-associated protein FlgK [Escherichia coli O83:H1
           str. NRG 857C]
          Length = 547

 Score =  181 bits (458), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     ++   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSTADPSRTTVAYIDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAGAFNTQHKAGFDANGDAGKDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|110641258|ref|YP_668988.1| flagellar hook-associated protein FlgK [Escherichia coli 536]
 gi|191172473|ref|ZP_03034014.1| flagellar hook-associated protein FlgK [Escherichia coli F11]
 gi|300982573|ref|ZP_07176195.1| flagellar hook-associated protein FlgK [Escherichia coli MS 200-1]
 gi|110342850|gb|ABG69087.1| flagellar hook-associated protein 1 [Escherichia coli 536]
 gi|190907357|gb|EDV66955.1| flagellar hook-associated protein FlgK [Escherichia coli F11]
 gi|300307154|gb|EFJ61674.1| flagellar hook-associated protein FlgK [Escherichia coli MS 200-1]
 gi|324013281|gb|EGB82500.1| flagellar hook-associated protein FlgK [Escherichia coli MS 60-1]
          Length = 547

 Score =  181 bits (458), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     ++   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSTADPSRTTVAYIDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAGAFNTQHKAGFDANGDAGKDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNNKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|117928040|ref|YP_872591.1| flagellar hook-associated protein FlgK [Acidothermus cellulolyticus
           11B]
 gi|117648503|gb|ABK52605.1| flagellar hook-associated protein FlgK [Acidothermus cellulolyticus
           11B]
          Length = 463

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/489 (14%), Positives = 162/489 (33%), Gaps = 49/489 (10%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE--------------- 48
               + A        +      +NI NA    Y R+  +                     
Sbjct: 5   FGSLSTALTALQAERKALEVTGQNIANASTSGYTRQRAVFQGIGGSVVPAMYSRSDGVGA 64

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
            V V   +       ++  +  +  +   +  Q   A  E     +         ++   
Sbjct: 65  GVVVSEVQRLQNAFLEQRANTENGTLAFLQGSQQTLADIENSFG-EPSTTGIQSLLTTFW 123

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +  +  + N ++      +I +A+ +    N +A  +    A + + ++  +  +     
Sbjct: 124 NGWDDVANNPADTAARTALIGDAQALASGLNVAAGALSAQWASSRQSLQSVVDQVNAAAQ 183

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
           ++  +N AI   T++ +  +D  DQRDVL++K++ ++G++T  + +    V     + + 
Sbjct: 184 DIAALNKAIVAATSAGNQPNDLEDQRDVLIRKLASLVGVTTKPKTDGSTDVLLGGSSLVS 243

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
            ++ R +      +    S +    +      +   +AV  G+  ALL   +  +P +  
Sbjct: 244 GSLARQLQLGGGTAIDQVSTTP---VTLTWTDTGTTAAVSSGQGAALLTALNVTIPSYAG 300

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
           QLD +A  L+ + + +  +  +     G    D        +   I++   V        
Sbjct: 301 QLDSVANQLVTTVNTQHQLGYDLNGNAGGNFFDPTGTTAATIKVAITDPALVAASSVPPS 360

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
           +        + + L N+                                       R  I
Sbjct: 361 AGQPSLDGGNAQALANMSGTGADA------------------------------AYRKMI 390

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             L    +         Q V N +  S  +  GV+L EE + LI  + +Y+ + K +   
Sbjct: 391 VALGSESNTIQQRTTTQQSVVNQVEASRDSASGVDLDEEQTNLITFQHAYDAAAKYLSVI 450

Query: 469 DKMLQTLLE 477
           D +L TL+ 
Sbjct: 451 DSILDTLIN 459


>gi|331657144|ref|ZP_08358106.1| flagellar hook-associated protein FlgK [Escherichia coli TA206]
 gi|324007922|gb|EGB77141.1| flagellar hook-associated protein FlgK [Escherichia coli MS 57-2]
 gi|331055392|gb|EGI27401.1| flagellar hook-associated protein FlgK [Escherichia coli TA206]
          Length = 547

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYIDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAGAFNTQHKAGFDANGDAGKDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|323967023|gb|EGB62449.1| flagellar hook protein FlgK [Escherichia coli M863]
 gi|327253481|gb|EGE65119.1| flagellar hook-associated protein FlgK [Escherichia coli STEC_7v]
          Length = 547

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNLEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|190890383|ref|YP_001976925.1| flagellar hook-associated protein [Rhizobium etli CIAT 652]
 gi|190695662|gb|ACE89747.1| flagellar hook-associated protein [Rhizobium etli CIAT 652]
          Length = 495

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 164/493 (33%), Positives = 260/493 (52%), Gaps = 15/493 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N AQ+I NN   Q + +  NI NA NK+YVRR  M T S     VV      +
Sbjct: 1   MSLTSALNTAQSIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGSQVVKIDRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           +   +     SS    Q+ L S     + +   + Y  SP+ Y+   +  L+++  +   
Sbjct: 61  DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGNDYETSPSTYLGVFQQKLQAFRTSPGS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +  +  I  A++V  + N +++ VQ +RA ADK+I   +  L   LS+    N+A+K  
Sbjct: 121 TVAAQGAITAAQDVANSLNNASQSVQDVRAGADKQIATAVDTLNTLLSQFENANNAVKTA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  D    LD+R+  L++IS+I+G+S   R+NNDMV+ T DGT LFET+PR + F+  
Sbjct: 181 TATGADPSSALDEREKTLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFQAQ 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + Y  +   N +++DGV +    GS    +G +++LLQ+RD + P FQ QLDE+AR L+ 
Sbjct: 241 DVYNASITGNSVYVDGVALPRGSGSTTTAQGSLQSLLQVRDEIAPNFQKQLDEIARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN----PQYRSNPSFLRDGG 355
            F E++     +        + G  D       G++ TI V+         +P  LRDGG
Sbjct: 301 LFKEQNTAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTISVSSRVITSQGGDPMRLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA----------GINTNVTLLEYAR 405
                 + N   L+GY   ++    +   +  FDP A          GI++NV+++EYA 
Sbjct: 361 VNVNGVVNNPTGLSGYTTDLDRLYTALGSDIDFDPAAGPAVGFDATTGIDSNVSIMEYAT 420

Query: 406 NSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLI 465
           NS+GWLE+ RS++      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++
Sbjct: 421 NSLGWLEQYRSNATTAAENTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL 480

Query: 466 MFTDKMLQTLLEG 478
              D+ML++LL+ 
Sbjct: 481 NAVDEMLKSLLDI 493


>gi|153949847|ref|YP_001399640.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           IP 31758]
 gi|152961342|gb|ABS48803.1| flagellar hook-associated protein FlgK [Yersinia pseudotuberculosis
           IP 31758]
          Length = 453

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/481 (13%), Positives = 151/481 (31%), Gaps = 43/481 (8%)

Query: 9   KAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQRSE 58
            A +          +   NI N     Y R+    +           +   V V   R  
Sbjct: 6   TAFSGMQATQAHLNATSMNIANIHTPGYSRQRAEQSAIGADGQGGINAGNGVNVDAIRRL 65

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
           +K          +S        + +    E+M +++  + S    ++    SL + ++  
Sbjct: 66  SKQYVVMQEWQANSQQQYYEAGEQYLKAVELMVSNE--STSLATGLNNFFSSLSAATQMP 123

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
               + + +I++A  +   FN     + + +    ++ ++ I  +      +   N  I 
Sbjct: 124 DSTPMRQQIIESANAMALRFNNVNNFIAQQKNSIGQQRDISIKEINSLTRSIADYNQQIL 183

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
              +  ++ +D LD++++ ++K+S +I        +    V    G  L           
Sbjct: 184 KNRSDGNNINDLLDKQELQIKKLSGLIETQVNQAEDGTYRVSVKQGQPLVNGAVAAELAV 243

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
              S       +         ++   +    G++  +     + +   Q     MA+ + 
Sbjct: 244 DTRSADTKINIH------FSGTTQGMNMSCGGQLGGINDYEFTTLKKLQASTQGMAKTVA 297

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
             F+ +  +  +     G  +        N + Q                          
Sbjct: 298 DEFNTQLKLGSDFTGANGRDLFVFNPGDPNGMLQL------------------------- 332

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                    LAG  +      + F    I         +V L + A   +G++    + +
Sbjct: 333 SAITAEQLALAGRGEPSGDSSNLFKLIDIKQKNVVGMNSVRLDDAATTLVGYIAITSNRN 392

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
           +     ++   N  +    +  GVN  EE   L++ +++Y  + K+I   DK+   LL  
Sbjct: 393 YSELENAENTLNQATRYRESISGVNNDEEAINLMEYQRAYQSNMKVIATGDKLFSDLLAL 452

Query: 479 V 479
           +
Sbjct: 453 I 453


>gi|126463724|ref|YP_001044838.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105388|gb|ABN78066.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 481

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 91/490 (18%), Positives = 168/490 (34%), Gaps = 21/490 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MS+    + A +  N  S+   +   N+ NA  + + RR+   T        + V  V  
Sbjct: 1   MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSYGGGGQGVRTVGI 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                           +A G +    +F       + D     S    IS    SL + +
Sbjct: 61  DRMMNMALVADRRLADAATGDRDTRAAFYQALADATGDTG-GGSLLARISAFSASLVTAA 119

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                    + V+D A+ +      ++  V + R  AD  I  +I  L   L+ +  +N 
Sbjct: 120 SRPESQARLQDVLDRAQSLAAGLRAASDAVLEARRAADASIADQIKTLTATLARVQQMNA 179

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     +  D+    D+R  L+  IS I+ +  + R N  + ++T+ G  L +    DI
Sbjct: 180 TITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLDGRVADI 239

Query: 236 NFEKMN-----SYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            FE        S     +   + ++G+ +  +  G  +  G + A   +RD + P  Q +
Sbjct: 240 AFEPEPGLVAASSVAAGDLGLLTVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAEQAR 299

Query: 290 LDEMARVLIGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
           LD +A+ LIG  +  D         +     A         L   +S     +P      
Sbjct: 300 LDALAQDLIGRMAAADGSLGAGDAGLFTDDGAAFDPAAPAGLASRLSVNALADPDRGGAL 359

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             LRDG     +       L                        G++   +    A  ++
Sbjct: 360 WHLRDGLQRPSEGDSGDPTLLNALAAA-------LDARTPHAANGLSGTFSFSGLAAETV 412

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
                    +      +    + +        GV+   E+  L+ +E++Y  + K++   
Sbjct: 413 SGAAVALVSAEAEASFASARRDELQALILAD-GVDTDREMEQLLLLERAYAANAKVVTAC 471

Query: 469 DKMLQTLLEG 478
           D +LQ LLE 
Sbjct: 472 DDLLQYLLEM 481


>gi|77464882|ref|YP_354386.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           2.4.1]
 gi|77389300|gb|ABA80485.1| putative flagellar hook protein [Rhodobacter sphaeroides 2.4.1]
          Length = 481

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 91/490 (18%), Positives = 169/490 (34%), Gaps = 21/490 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----SPENVTVVTQ 55
           MS+    + A +  N  S+   +   N+ NA  + + RR+   T        + V  V  
Sbjct: 1   MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSYGGGGQGVRTVGI 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                           +A G +    +F       + D     S    IS    SL + +
Sbjct: 61  DRMVNMALVADRRLADAATGDRDTRAAFYQALADATGDTG-GGSLLARISAFSASLVTAA 119

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                    + V+D A+ +      ++  V + R  AD  I  +I  L   L+ +  +N 
Sbjct: 120 SRPESQARLQDVLDKAQSLAAGLRAASDAVLEARRAADASIADQIKTLTATLARVQQMNA 179

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     +  D+    D+R  L+  IS I+ +  + R N  + ++T+ G  L +    DI
Sbjct: 180 TITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLDGRVADI 239

Query: 236 NFEKMN-----SYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
            FE        S     +   + ++G+ +  +  G  +  G + A   +RD + P  Q +
Sbjct: 240 AFEPEPGLVAASSVAAGDLGLLKVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAEQAR 299

Query: 290 LDEMARVLIGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
           LD +A+ LIG  +  D         +     A         L   +S     +P      
Sbjct: 300 LDALAQDLIGRMAAADASLGAGDAGIFTDDSAAFDPAAPAGLAGRLSVNALADPDRGGAL 359

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             LRDG     +       L            +           G++   +    A  ++
Sbjct: 360 WHLRDGLQRPSEGDSGDPTLLNALAAALDARTAH-------AANGLSGTFSFSGLAAETV 412

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
                    +      +    + +        GV+   E+  L+ +E++Y  + K++   
Sbjct: 413 SGAAVALVSAEAEASFASARRDELQALILAD-GVDTDREMEQLLLLERAYAANAKVVTAC 471

Query: 469 DKMLQTLLEG 478
           D +LQ LLE 
Sbjct: 472 DDLLQYLLEM 481


>gi|84502375|ref|ZP_01000511.1| flagellar hook-associated protein [Oceanicola batsensis HTCC2597]
 gi|84389187|gb|EAQ01984.1| flagellar hook-associated protein [Oceanicola batsensis HTCC2597]
          Length = 470

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 93/480 (19%), Positives = 171/480 (35%), Gaps = 13/480 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-ISPENVTVVTQRSEN 59
           MS+L     +++     SQ+   +  NI +A ++NY  R    T      V V+      
Sbjct: 1   MSILTAILASRSGLQANSQRAQLVSTNIAHAQDENYSHRSLEVTEALGGGVRVIGVARAM 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
               D +     S   +Q  + +   +      +     S  + +S  ++ L   S +  
Sbjct: 61  DTAMDALYRTEMSFAAKQDAMATTLGVYGAELGELDTETSIPNLLSAFQNDLGLLSNDPG 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           +  L + V  +A+ +     ++   +  +   A   I  +IS     L EL  +N  I  
Sbjct: 121 DASLQQEVYLSAKALTGAIRSANSALNTVETTAVNGIGNDISAANEALRELARINADIGK 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
                       D+R   L K++ I+ I      +    V+ + G +L      +     
Sbjct: 181 TEQGTETYAALEDRRAAELDKLANIVQIQVSYDTDGRANVHAAGGQSLVVAGHVNEFSFD 240

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
             + T+ S    +                +G +   + + + VVP  + +LDE+AR LI 
Sbjct: 241 RPTGTLYSGDQDVTPGVAGRRGA-----EQGSLSGYVTLLNDVVPQQRLELDEIARGLIQ 295

Query: 300 SFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
            F + D   A     +           +   L   I+    ++P    + S LRD     
Sbjct: 296 GFEDADTSLAPGQAGLFTNGGMALGSPVTPGLAGRIAVNDAIDPFRGGDLSLLRD----- 350

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                     A     +  + D F+    FDP AG     T++++   +I   +  R D+
Sbjct: 351 -GIGAVTTGAASDNTQVLAFLDFFDTQVAFDPAAGQGATGTIMDFTTGAISQQQARRVDA 409

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
                           +  N  GVN+  EL  L  +EQSYN +++ +    +M+ TLL  
Sbjct: 410 ESNLNSLIASSETYRAARLNARGVNIDTELQNLSLIEQSYNANSQALRVASEMIDTLLNM 469


>gi|134280799|ref|ZP_01767509.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           305]
 gi|125657224|gb|ABN48712.1| flagellar hook-associated protein [Burkholderia pseudomallei]
 gi|134247821|gb|EBA47905.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           305]
          Length = 452

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 66/479 (13%), Positives = 151/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATGGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +           K   +LE+ S +  +
Sbjct: 62  TQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLGFGKFIGALEAASGDPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSMANGQPLVVGAQAGKIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    +    + +          +A   G++  L +  + V+      L  +A      
Sbjct: 242 DA----AGQQTLSLTFGSQVMPLRAASLGGELLGLAEFEEEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            +++     +    PG  +                 T             ++        
Sbjct: 298 INDQLTQGFDMNGNPGKPLL----------------TYDAATGLLGVDPSVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    L+     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALVEIGSTSVDLPGI--------GDVSLGNAFATMMGKVGAASQQNKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|218689035|ref|YP_002397247.1| flagellar hook-associated protein FlgK [Escherichia coli ED1a]
 gi|218426599|emb|CAR07427.1| flagellar hook-filament junction protein 1 [Escherichia coli ED1a]
          Length = 547

 Score =  180 bits (455), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 65/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAGAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASAEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|215486291|ref|YP_002328722.1| flagellar hook-associated protein FlgK [Escherichia coli O127:H6
           str. E2348/69]
 gi|312968844|ref|ZP_07783051.1| flagellar hook-associated protein FlgK [Escherichia coli 2362-75]
 gi|215264363|emb|CAS08720.1| flagellar hook-filament junction protein 1 [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312286246|gb|EFR14159.1| flagellar hook-associated protein FlgK [Escherichia coli 2362-75]
          Length = 547

 Score =  180 bits (455), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 63/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   +  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSSAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     ++   +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 STARQLAAVPSTADPSRTTVAYIDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 291 DEMARVLI--------------------------------GSFSEKDPIAGNSENVPGLF 318
            ++A                                       +    I     +   + 
Sbjct: 299 GQLALAFAGAFNTQHKAGFDANGDAGKDFFAIGKPAVLQNTKNNGDVAIGATVTDASAVL 358

Query: 319 IADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYP------ 372
             D     DN   Q              + +       +   F         +       
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 373 ----------------------DLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
                                    +   +      +      +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|167725936|ref|ZP_02409172.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           DM98]
          Length = 452

 Score =  180 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 66/479 (13%), Positives = 150/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATGGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +           K   +LE+ S +  +
Sbjct: 62  TQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLGFGKFIGALEAASGDPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSMANGQPLVVGAQAGKIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    +    + +          +A   G++  L +  + V+      L  +A      
Sbjct: 242 DA----AGQQTLSLTFGSQVMPLRAASLGGELLGLAEFEEEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
             ++     +    PG  +                 T             ++        
Sbjct: 298 IDDQLTQGFDMNGNPGKPLL----------------TYDAATGLLGVDPSVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    L+     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALVEIGSTSVDLPGI--------GDVSLGNAFATMMGKVGAASQQNKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|220934400|ref|YP_002513299.1| flagellar hook-associated protein FlgK [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995710|gb|ACL72312.1| flagellar hook-associated protein FlgK [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 637

 Score =  180 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 68/446 (15%), Positives = 143/446 (32%), Gaps = 33/446 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           MS   V     +      +       NI N+  + Y R+    +               V
Sbjct: 7   MS-SGVLGIGVSGLLAFQRALGVTGNNIANSATEGYSRQRIDLSTQIPQFAGNGYFGSGV 65

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V           +  L   +SA  Q  L   F    + + AD   ++     + +   +
Sbjct: 66  QVSGVNRIFDQFVETQLRNSTSASEQYALYYDFARRVDNLLADP--DSGLAPGLQQFFAA 123

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           ++  + + + +   + +I  AE +V  F+   + +++ R   + +I+  ++ +      +
Sbjct: 124 VQDVANDPTSNAARQVLISEAESLVDRFSFLNQRLEEQRNLVNGQIQTTVAEINSLAEAI 183

Query: 171 TVVNDAIKFK--TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +N+ I            +D LDQRD L+ ++SE++ ++TI +++  + V+  +G  L 
Sbjct: 184 ADLNEDIVSALGRGGGAPPNDLLDQRDRLVLQLSELVSVNTIEQDDGALNVFIGNGQNLV 243

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                 +                    G  V  +  S +  G++ ALL +R SV+ + QN
Sbjct: 244 LGNRPTVLVADGLGPDPAQMQVGYVSPGATV--DITSYMTGGRLGALLDLRTSVLDVAQN 301

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
            L   A  L  +F+++  +  +     G                  +           + 
Sbjct: 302 SLGRTAIGLAQAFNDQHVLGQDLNGQLGEAFFRVPAPEAIAGASNAATGDLQVEIQDYSA 361

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSI 408
             L D         W ++   G                     A       L+E      
Sbjct: 362 LTLSDYRLRFDGADWQLRREPG----------------GQLLGAVAPGGTLLIEGLSIDT 405

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISE 434
             +    +    L   ++   N I  
Sbjct: 406 SGIAGAATGDTFLIRPTRGGANQIDT 431



 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/430 (8%), Positives = 101/430 (23%), Gaps = 6/430 (1%)

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           + +   +    L + ++       L  F    + +   +         +      ++   
Sbjct: 208 QRDRLVLQLSELVSVNTIEQDDGALNVFIGNGQNLVLGNRPTVLVADGLGPDPAQMQVGY 267

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            +     +  T       +    +     +   +    +                  +N 
Sbjct: 268 VSP-GATVDITSYMTGGRLGALLDLRTSVLDVAQNSLGRTAIGLAQAFNDQHVLGQDLNG 326

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            +                 +     +   I   + +  ++  + +      L       +
Sbjct: 327 QLGEAFFRVPAPEAIAGASNAATGDLQVEIQDYSALTLSDYRLRFDGADWQLRREPGGQL 386

Query: 236 NFEKMNSYTVTSESNPIFIDG-VVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                   T+  E   I   G    ++     +   +  A         P        + 
Sbjct: 387 LGAVAPGGTLLIEGLSIDTSGIAGAATGDTFLIRPTRGGANQIDTVISDPRMVAAASPVR 446

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
               G  +    +               +    N             P   S  + +   
Sbjct: 447 ASPDGDNTGPAIVRSVIAVDRDALDLTPVTVTYNAGASQFEIGGDTYPLDPSGVTVINHN 506

Query: 355 G----SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           G            +   +      +    ++     + D    +    TL       +  
Sbjct: 507 GWELTIEGVPDDGDAFQVGPNIGGVGDNRNALALAGLQDQRMMVGGTATLEGTYNTLVAE 566

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +      +         + +       +  GVNL EE + L++ +Q+Y  + ++I  T+ 
Sbjct: 567 VGTRTRQAEIAARAQVKLLDEARAQRESISGVNLDEEAANLLRYQQAYQAAAQVISVTNS 626

Query: 471 MLQTLLEGVK 480
           +  TL+  V+
Sbjct: 627 LFDTLINAVR 636


>gi|83944166|ref|ZP_00956622.1| flagellar hook-associated protein [Sulfitobacter sp. EE-36]
 gi|83845033|gb|EAP82914.1| flagellar hook-associated protein [Sulfitobacter sp. EE-36]
          Length = 472

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 91/483 (18%), Positives = 177/483 (36%), Gaps = 15/483 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN---VTVVTQRS 57
           MSL    N A    +    Q      N+ NA    YVRR+ +   +        +   R 
Sbjct: 1   MSLSGALNSATAGLHTTQGQSRIAADNVSNAMTPGYVRREAVLVTASGGQGGAVISEVRR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
           E      ++    +S + Q + +Q                 SP    +  ++SL +    
Sbjct: 61  EVDATLQRMSRLENSRMTQYQSIQEGLTTYTAYLGQPGDGTSPADRFNDFQNSLTTLVNM 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S +    +V   AE++V++   +A  +     D + EI  E+++L   L +L  +N + 
Sbjct: 121 PSSNGAQTSVALAAEDLVRSVKGAATTLSTTLNDVNMEIRYEVADLNTALYQLRDLNASG 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              T    +A  F ++ D +L +IS I+       +N  + +YT  G  L E        
Sbjct: 181 SGFTPGSLEAAQFDEKVDTILDQISGIVDTRIHRSSNGSISLYTVSGAALLEGRV----- 235

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            +  ++  +  +       +    +    +  G +  L +++   +P F  QLDE AR L
Sbjct: 236 VQDVTFNPSDGTLMAGNQDITPFKDGVRGIQHGSLAGLSELKRETIPQFSQQLDEYARGL 295

Query: 298 IGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           I +F + D   A     +               L   +     ++    +    +RD   
Sbjct: 296 IQTFEDADASLAPGEAGLFTDNGNAFDPANITGLASRLQINSKISSTGDAEVWRIRD--- 352

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
                             IN +    +         GI   VTL +++   I      R+
Sbjct: 353 ---GLGATSPGAGSETVQINAFLAGLDTAMNAATGTGIPAEVTLRDFSAEMITSQAATRA 409

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            + +    +      +  +  N+ GVN+ +E+  L+ +EQSY  +++++    +M+ TL+
Sbjct: 410 RAENDFNAAASAAEVVMSARRNSEGVNIDDEMQQLLLIEQSYAANSRVLTAVSEMIDTLI 469

Query: 477 EGV 479
             V
Sbjct: 470 AAV 472


>gi|167905095|ref|ZP_02492300.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           NCTC 13177]
          Length = 452

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 66/479 (13%), Positives = 151/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATGGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +           K   +LE+ S +  +
Sbjct: 62  TQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLGFGKFIGALEAASGDPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSMANGRPLVVGAQAGKIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    +    + +          +A   G++  L +  + V+      L  +A      
Sbjct: 242 DA----AGQQTLSLTFGSQVMPLRAASLGGELLGLAEFEEEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            +++     +    PG  +                 T             ++        
Sbjct: 298 INDQLTQGFDMNGNPGKPLL----------------TYDAATGLLGVDPSVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    L+     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALVEIGSTSVDLPGI--------GDVSLGNAFATMMGKVGAASQQNKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|182680456|ref|YP_001834602.1| flagellar hook-associated protein FlgK [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636339|gb|ACB97113.1| flagellar hook-associated protein FlgK [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 493

 Score =  179 bits (454), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 125/492 (25%), Positives = 221/492 (44%), Gaps = 13/492 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKN-YVRRDT-MTTISPENVTVVTQRSE 58
           MSL +     Q+  +  S + +   RNI  A++   Y R+   + + +   V V++    
Sbjct: 1   MSLTSAMGVTQSALSAFSAETSVTSRNIAGANSTGLYSRKSIDVVSSNNSGVEVLSVTRA 60

Query: 59  NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNL 118
                   L   ++   +Q  L S          D   + SP   +S L++SL++ + + 
Sbjct: 61  QNQALFGDLLGSTAVSAKQDALSSGLDALYQTIGDTTDSISPAALLSNLQNSLQTLAASP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
           S+ +  + V+  A+ +    N ++  VQ +R  AD  +   +S +   L +   +N  I 
Sbjct: 121 SDMVQAQDVVGKAQALTDGLNNASSTVQSVRQQADGNMASSVSTINSLLGQFQTLNTQIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
               S  D  D LD RD +LQ++S  +GI+T   ++N M ++T  G TLF+   R + F 
Sbjct: 181 SGGKSGADVTDLLDSRDNILQQLSHQVGITTTSNSDNSMSIFTDSGVTLFQDKARTVTFV 240

Query: 239 KMNSYTVTSESNPIFIDGVVVSS-NQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
              +Y   +  N + +DGV ++  +    +  GK+  L  +RD+V   +Q QLD +A  L
Sbjct: 241 PTTTYVAGTIGNSVMVDGVPITGKSSPMPIQSGKLAGLADLRDNVTTTYQAQLDGIAGTL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLD-------NKLCQGISETICVNPQYRSNPSF 350
           I +F+E D             +                 L  GI     V+P+   N + 
Sbjct: 301 INAFAESDQSGATPPAASQPGLFTYSGAPALPSSLNMTGLAAGIRVNSNVDPKQGGNLTL 360

Query: 351 LRDGGS---VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
           LRDGG     S  + +N    A Y   +N    +F++   F   A ++T+ +L +++  S
Sbjct: 361 LRDGGISDPASTTYTYNTTGAASYVGRLNGMLAAFDQTQSFSNAANLSTSSSLTDFSTAS 420

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
             WL   R  +       + V + ++ + SN  GV+L  E+S ++ +EQSY+ S KL+  
Sbjct: 421 AAWLNGQRQSASTASDYQKTVVSSVTSALSNATGVSLDTEMSKMLDLEQSYSASAKLMST 480

Query: 468 TDKMLQTLLEGV 479
            + M Q+LL  V
Sbjct: 481 INTMFQSLLTAV 492


>gi|227820876|ref|YP_002824846.1| flagellar hook-associated protein FlgK [Sinorhizobium fredii
           NGR234]
 gi|227339875|gb|ACP24093.1| predicted flagellar hook-associated protein FlgK [Sinorhizobium
           fredii NGR234]
          Length = 476

 Score =  179 bits (454), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 164/483 (33%), Positives = 257/483 (53%), Gaps = 10/483 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    AQ+  +  + Q A++ +N+ NA N +Y RR  M   + +   +V+      
Sbjct: 1   MSLSSAIAIAQSAFSTTASQTATVSKNVANASNADYSRRMAMLGTTADGAQIVSIYRAQN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
               K      S    Q  L S   L +     + Y  +P+ Y+S  RDSL++++     
Sbjct: 61  EALLKQNLTSISQSSAQSSLLSGLELLKSALGGNDYETAPSTYLSAFRDSLQTFASTPGN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             +  TV+ +A ++  + + +A  VQ +R D DK+I  E+ NL   L+     N+A+K  
Sbjct: 121 STIAATVVADASDLANSISKTATAVQDLRLDTDKQIAEEVDNLNALLASFETANNAVKQA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  DA   LD+RD LL+++SE++GIST+ R +ND V+YTSDGT LFET  R + F   
Sbjct: 181 TATGADATAALDERDKLLKQLSELVGISTVTRADNDTVIYTSDGTVLFETQARQVTFTAT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           +++  ++  N IFIDGV +S+  G+    +GK+ +LLQ+RD + P FQ+QLDEMAR L+ 
Sbjct: 241 SAFDASTTGNAIFIDGVSLSAGAGADTTAEGKLASLLQLRDDIAPTFQSQLDEMARGLVS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS- 358
            F E                 DG    D  +  GI+ T+ VN   ++NP  LRDGG    
Sbjct: 301 LFQEDGAPGL-------FTWEDGTLPADGTVEPGIAATLSVNAAAQTNPFLLRDGGFNGL 353

Query: 359 -KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
                      +GY DL++ +  + + +  FD  AG+++  +++E+A +SIGW E+ RS 
Sbjct: 354 VSNPGGATDPNSGYTDLLDGFITAMDGDMDFDAAAGLDSTSSIMEFAASSIGWFEQIRSA 413

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +         +     E+  N  GV++ EELS L+ +EQSY  S KLI   D M+ +LLE
Sbjct: 414 ASTADDNKTALLARTEEALGNVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLE 473

Query: 478 GVK 480
            V+
Sbjct: 474 AVR 476


>gi|83955134|ref|ZP_00963790.1| flagellar hook-associated protein [Sulfitobacter sp. NAS-14.1]
 gi|83840463|gb|EAP79636.1| flagellar hook-associated protein [Sulfitobacter sp. NAS-14.1]
          Length = 472

 Score =  179 bits (454), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 93/483 (19%), Positives = 177/483 (36%), Gaps = 15/483 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN---VTVVTQRS 57
           MSL    N A    +    Q      N+ NA    YVRR+ M   +        +   R 
Sbjct: 1   MSLSGALNSATAGLHTTQGQSRIAADNVSNAMTPGYVRREAMLVTASGGQGGAVISEVRR 60

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
           E      ++    +S + Q + +Q                 SP    +  ++SL +    
Sbjct: 61  EVDATLQRMSRLENSRMTQYQSIQEGLTTYTAYLGQPGDGTSPADRFNDFQNSLTTLVNM 120

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
            S +    +V   AE++V++   +A  +     D + EI  E+++L   L +L  +N + 
Sbjct: 121 PSSNGAQTSVALAAEDLVRSVKGAATTLSTTLNDVNMEIRYEVADLNTALYQLRDLNASG 180

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              T    +A  F ++ D +L +IS I+       +N  + +YT  G  L E        
Sbjct: 181 SGFTPGSLEAAQFDEKVDTILDQISGIVDTRIHRSSNGSISLYTVSGAALLEGRV----- 235

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
            +  ++  +  +       +    +    +  G +  L +++   +P F  QLDE AR L
Sbjct: 236 VQDVTFNPSDGTLMAGNQDITPFKDGVRGIQHGSLAGLSELKRETIPQFSQQLDEYARGL 295

Query: 298 IGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           I +F E D   A     +               L   +     ++    +    +RD   
Sbjct: 296 IQTFEEADASLAPGEAGLFTDNGIAFDPANITGLASRLQINSKISSTGDAEVWRIRD--- 352

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
                             IN +    +         GI   VTL +++   I      R+
Sbjct: 353 ---GLGATSPGAGSETVQINAFLAGLDTAMNAATGTGIPAEVTLRDFSAEMITSQAATRA 409

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            + +    +      +  +  N+ GVN+ +E+  L+ +EQSY  +++++    +M+ TL+
Sbjct: 410 RAENDFNAAASAAEVVMSARRNSEGVNIDDEMQQLLLIEQSYAANSRVLTAVSEMIDTLI 469

Query: 477 EGV 479
             V
Sbjct: 470 AAV 472


>gi|158422272|ref|YP_001523564.1| flagellar hook-associated protein FlgK [Azorhizobium caulinodans
           ORS 571]
 gi|158329161|dbj|BAF86646.1| FlgK protein [Azorhizobium caulinodans ORS 571]
          Length = 485

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 137/485 (28%), Positives = 227/485 (46%), Gaps = 5/485 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL + F+ A+N   N + Q ++  +NIENA N +Y R++          T V       
Sbjct: 1   MSLTSAFSTARNSLLNTATQLSTSAKNIENASNTSYSRKNANLVSGDAGNTSVVVARAGD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                 +   +S   +   L +     +    D   + S    +S  + +L SY+     
Sbjct: 61  AALFLKMLDATSNSSKYAALLTGLTTLQSTIGDTETDTSVAARLSTFQTALSSYANAPDN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           D LG+  I  AE +    N+S R VQ +RA+AD  I   +S +   LS+  + NDA+   
Sbjct: 121 DTLGQAAITAAENLATALNSSTRTVQSVRAEADANIANSVSKVNDLLSQFKIANDAVIAG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D LD RD +L K+SE +G++T++  NNDM +YT  G TLF+  PR + F   
Sbjct: 181 TVKGDDISDALDARDAVLSKLSEEMGVTTVLGQNNDMKLYTDGGATLFDQSPRSVTFVPS 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            ++  T+  N +++DGV V+ ++    +  G I    ++RD     +Q+QLDE+AR LI 
Sbjct: 241 ATFDGTTVGNAVYVDGVAVTGASSVMPLKSGAIAGYAEMRDVTTVTYQDQLDEVARGLIS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ----YRSNPSFLRDGG 355
           +F E D   G      GLF       +   L + ++ TI VN         + S LRDGG
Sbjct: 301 AFQETDQSGGGGAAKSGLFTNGIDTTVAGGLTRNLAATITVNTAAVVSKGGSVSTLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNR 415
                + +N  N A +   +     +      F     + + V+L  +A +S+ WLE  R
Sbjct: 361 MNGAAYAYNTTNAASFGTRLAALQTAIKAQQTFSSTTQLTSGVSLQTFASSSVSWLEGLR 420

Query: 416 SDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTL 475
           + + +     + + +  S + SN  GVN  +E +  +++E+SY  S+K++     M   L
Sbjct: 421 TSTTNKSETQKTLLSQASTAVSNASGVNTDQEYATQLQLEKSYQASSKILSAVQSMYDAL 480

Query: 476 LEGVK 480
              ++
Sbjct: 481 FSAIR 485


>gi|197285504|ref|YP_002151376.1| flagellar hook-associated protein 1 [Proteus mirabilis HI4320]
 gi|194682991|emb|CAR43432.1| flagellar hook-associated protein 1 [Proteus mirabilis HI4320]
          Length = 547

 Score =  179 bits (453), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 76/548 (13%), Positives = 169/548 (30%), Gaps = 74/548 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS   + N A +  N A    ++I  NI N     Y R+ T+   +             V
Sbjct: 1   MS-NNLINTAMSGLNAAQAAMSTISNNIANQKVNWYNRQMTVFNENGGTMTSNGYIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V     E        ++   +            +    + AD    N  +  I     S
Sbjct: 60  NVSRIHREYNEFLAGQMNRAVTKQSALNSYNKNISQINNLLAD--KGNDVSSAIDDFFTS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L + + N  ++    T++  AE +V  FN + + ++ +  D + ++     N+  +  ++
Sbjct: 118 LPNVTNNAEDNPARTTILGKAEAMVNMFNKADQSLRDLEKDINSQVTNTTKNINEYSKQI 177

Query: 171 TVVNDAIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I      +  + +D LDQRD L+Q+++ ++ +    ++   + V  ++G  L  
Sbjct: 178 AKLNQEISRSQGFNGAEPNDLLDQRDRLIQELNTLVDVQVTQQDGGFVNVSFANGLPLVA 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      +S                V       +  G++    + R+ V+   +NQ
Sbjct: 238 GTRSYEVSAIPSSKNSERLVVGYSNGIDEVREVDAKRINGGELGGAYRSRNEVLDASRNQ 297

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           L+++A VL   F+++     +     G    +          +   +         +   
Sbjct: 298 LNQLALVLGDQFNKQHEQGFDLNGDKGDKFFNLGGAHTMPNGKNKGDATFDVKYTDTREV 357

Query: 350 FLRDGGSVSKKFLWNVKNLAGYP------------------DLINHYCDSFNKNFIFDPV 391
              D     +   WNV    G                     +  +       + +   V
Sbjct: 358 KAADYTVKYEGGKWNVTVEPGNRKFTATPNATTGELEFEGMSIKVNGAAQEGDSIVVQSV 417

Query: 392 AGINTNVTLLEYARNSIGWLEKNRSD---------------------------------- 417
             +   +++     + I       S                                   
Sbjct: 418 GNVIAGMSVAISDPSKIAAAGTKDSGPSDNENMKKLFELPDEKLIDGKATIAGGYGSLIS 477

Query: 418 --------SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
                   +   +     + + I     +  GVNL EE   + ++++ Y  + K+I   +
Sbjct: 478 MVGNKVNTAQVDYDAQNAITSSILTQQQSVSGVNLDEEYGEMYRIQEYYMANAKVIQTAN 537

Query: 470 KMLQTLLE 477
            M   +++
Sbjct: 538 TMFDAIMQ 545


>gi|256833255|ref|YP_003161982.1| flagellar hook-associated protein FlgK [Jonesia denitrificans DSM
           20603]
 gi|256686786|gb|ACV09679.1| flagellar hook-associated protein FlgK [Jonesia denitrificans DSM
           20603]
          Length = 463

 Score =  179 bits (453), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 63/497 (12%), Positives = 144/497 (28%), Gaps = 61/497 (12%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS  +  + A +  N          +NI N +   Y R+    T                
Sbjct: 1   MSTFSGLSTALSSLNAQRAAMEITGQNIANVNTPGYTRQRADMTPVSAGQTASLFSQGAK 60

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
               V +           D  +   +S+              E  + ++  ++  +  ++
Sbjct: 61  IGNGVRITDISRLGDIFLDARVRTTTSSASYLTARAEVYERLES-TINEPSDDGISAQLN 119

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           KL  S +  S N       + V++NA++V Q   +    V         E+E  ++ +  
Sbjct: 120 KLWTSFQDLSNNPQTLATKQVVLENAKQVQQGIASGYSAVSTQWNQVRAEVEAHVTEVNT 179

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             + +  +N  I+    S  + ++ +DQR  LL  +S + G +   +++    VY     
Sbjct: 180 TATAVAELNGQIRQTLVSGGNPNELIDQRGQLLNSLSALTGSTVRFQDDGTADVYVGGNP 239

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKA-----LLQIRD 280
            +     R +      + T  +++            N   +   G+I             
Sbjct: 240 LVQANASRTLTVAGATAITGATDAASAVKVVWDRPGNPAVSFDGGQIAGKLSALAPATDG 299

Query: 281 SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICV 340
            ++    N  + +A  L    +         +   G + A                    
Sbjct: 300 GILTTAANHYNTIAESLADKVNALHNAPPLFDLGAGPYAATL------------------ 341

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
                     + +   +    +          D ++    + +        A I T    
Sbjct: 342 -------SVAITNPADIQAGAVGAGDFDGSVADALSQLGIATDGPDALWQTAAIAT---- 390

Query: 401 LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNI 460
                            + D    +    +     +     V+  EE   L+  +++Y  
Sbjct: 391 -----------GVAAKATADSATVAYAAQSTAEGLHIAATSVDTDEETVNLLSYQRAYQA 439

Query: 461 SNKLIMFTDKMLQTLLE 477
           + +++   D+ML  L+ 
Sbjct: 440 AARVMTTVDEMLDQLIN 456


>gi|227355995|ref|ZP_03840387.1| flagellar hook-associated protein 1 [Proteus mirabilis ATCC 29906]
 gi|227163983|gb|EEI48885.1| flagellar hook-associated protein 1 [Proteus mirabilis ATCC 29906]
          Length = 547

 Score =  179 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/548 (13%), Positives = 169/548 (30%), Gaps = 74/548 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS   + N A +  N A    ++I  NI N     Y R+ T+   +             V
Sbjct: 1   MS-NNLINTAMSGLNAAQAAMSTISNNIANQKVNWYNRQMTVFNENGGTMTSNGYIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V     E        ++   +            +    + AD    N  +  I     S
Sbjct: 60  NVSRIHREYNEFLAGQMNRAVTKQSALNSYNKNISQINNLLAD--KGNDVSSAIDDFFTS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L + + N  ++    T++  AE +V  FN + + ++ +  D + ++     N+  +  ++
Sbjct: 118 LPNVTNNAEDNPARTTILGKAEAMVNMFNKADQSLRDLEKDINSQVTNTTKNINEYSKQI 177

Query: 171 TVVNDAIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I      +  + +D LDQRD L+Q+++ ++ +    ++   + V  ++G  L  
Sbjct: 178 AKLNQEISRSQGFNGAEPNDLLDQRDRLIQELNTLVDVQVTQQDGGFVNVSFANGLPLVA 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      ++                V       +  G++    + R+ V+   +NQ
Sbjct: 238 GTRSYEVSAIPSNKNSERLVVGYSNGIDEVREVDAKRINGGELGGAYRSRNEVLDASRNQ 297

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           L+++A VL   F+++     +     G    +          +   +         +   
Sbjct: 298 LNQLALVLGDQFNKQHEQGFDLNGDKGDKFFNLGGAHTMPNGKNKGDATFDVKYTDTREV 357

Query: 350 FLRDGGSVSKKFLWNVKNLAGYP------------------DLINHYCDSFNKNFIFDPV 391
              D     +   WNV    G                     +  +       + +   V
Sbjct: 358 KAADYTVKYEGGKWNVTVEPGNRKFTATPNATTGELEFEGMSIKVNGAAQEGDSIVVQSV 417

Query: 392 AGINTNVTLLEYARNSIGWLEKNRSD---------------------------------- 417
             +   +++     + I       S                                   
Sbjct: 418 GNVIAGMSVAISDPSKIAAAGTKDSGPSDNENMKKLFELPDEKLIDGKATIAGGYGSLIS 477

Query: 418 --------SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
                   +   +     + + I     +  GVNL EE   + ++++ Y  + K+I   +
Sbjct: 478 MVGNKVNTAQVDYDAQNAITSSILTQQQSVSGVNLDEEYGEMYRIQEYYMANAKVIQTAN 537

Query: 470 KMLQTLLE 477
            M   +++
Sbjct: 538 TMFDAIMQ 545


>gi|238794003|ref|ZP_04637621.1| hypothetical protein yinte0001_21180 [Yersinia intermedia ATCC
           29909]
 gi|238726635|gb|EEQ18171.1| hypothetical protein yinte0001_21180 [Yersinia intermedia ATCC
           29909]
          Length = 555

 Score =  179 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 81/556 (14%), Positives = 176/556 (31%), Gaps = 81/556 (14%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS  ++ N A +  + A    +++  NI N     Y R++T+   +             V
Sbjct: 1   MS-NSLMNTAMSGLSAAQYALSTVSNNITNFQVAGYNRQNTIFAQNGGTLSPAGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V     E  +     L   SS      L   ++ + ++ +   + +N+ +  +     +
Sbjct: 60  AVTGVNREYNSFITNQLR--SSQTQSSGLTTYYQQISQIDNLLSNSSNNLSSTMQDFFSN 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D   KTV+  AE +V  F  + + ++ +    +++I   ++ +  +  ++
Sbjct: 118 LQNLVSNSGDDAARKTVLGKAEGLVNQFQNADKYLRDMDTGVNQKITESVTQINNYADQI 177

Query: 171 TVVNDAIKFKT-ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I     +S  + +  LDQRD L+ ++++I+G++   ++ +   V  ++G  L +
Sbjct: 178 AKLNDQITRLRGSSGSEPNALLDQRDQLVTELNQIVGVTVTQQDGDAYNVSFANGLPLVQ 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      +S   T  +         V     S +  G +   L+ R   +   +NQ
Sbjct: 238 GPDSYKVQAIPSSSDATRLTIGYKYGSGDVLEVDESRLTTGTLGGTLKFRSEALDSARNQ 297

Query: 290 LDEMARVLIGSFSEKD--------------------------------------PIAGNS 311
           L ++A V+  SF+ +                                             
Sbjct: 298 LGQLALVMADSFNTQHKAGFDTSGEPGTDFFSFAQPNVLKNARNQGDASLTVSYTDTSKV 357

Query: 312 ENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGY 371
           +        DG      +L                N + L   G             A  
Sbjct: 358 KASDYSVEFDGTDWQVTRLSDNTKVPANPVKDGSGNTTGLSFDGVAVSVDNGTTGAQARD 417

Query: 372 PDLINHYCDSFNKNFIFDPVAG-----------------------------INTNVTLLE 402
             ++           +    +                              ++   TL  
Sbjct: 418 KFIVKTVSSVAANLQVEITDSSKIAAAGTADGGASDNVNAQALLSLQTKKLVDGKATLSG 477

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
                +  +    S +         +   ++    +  GVNL EE   L + +Q Y  + 
Sbjct: 478 AYAGLVSNVGNQTSTAKTNSTAQANIVKQLTAEQQSISGVNLDEEYGDLQRFQQYYLANA 537

Query: 463 KLIMFTDKMLQTLLEG 478
           ++I     +   LL  
Sbjct: 538 QVIQTASTLFNALLSL 553


>gi|149191159|ref|ZP_01869417.1| putative flagellar hook-associated protein [Vibrio shilonii AK1]
 gi|148834997|gb|EDL51976.1| putative flagellar hook-associated protein [Vibrio shilonii AK1]
          Length = 459

 Score =  179 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 62/480 (12%), Positives = 142/480 (29%), Gaps = 39/480 (8%)

Query: 8   NKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----------PENVTVVTQR 56
           N   +          +  +N  N +   Y R+      +              V V    
Sbjct: 5   NIGLSGVLANRVALNTTAQNTANVNTPGYSRQVVSLEATSSGNFVNGINLGAGVEVGDII 64

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
              +      L   + +    +      +  E +        S T  ++    +++  S 
Sbjct: 65  RIAEQSSINRLREATESAQYSQSYFDGLSNIENLLG--ADGLSLTQGLNGFFAAIDEASV 122

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
                   + V+ NA+ + Q FN+ + ++ +  A   +     +S++   L  +  +N  
Sbjct: 123 TPESIAFRQQVLTNADALAQQFNSVSAQLSQQEAAQSERYGAIVSHVNSQLESIAALNQK 182

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           ++             D+ D  L ++S+++ +  I        + T +G  L         
Sbjct: 183 LQEDALLGKGVAGLQDEMDKQLNELSKLLDVQVIYTAGGVE-LSTPNGQPLVIGGFSASL 241

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
               +S    S    I    +  + +       G++ AL  ++ S     +  L ++A+ 
Sbjct: 242 TRDFSSGDPYSTDLSITFQSMTTAVDDS---LGGELGALEALKLSQYEPIKATLADLAKG 298

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           L    +       +     G  +       +       S        + S+ +       
Sbjct: 299 LADGVNNALNTGFDLNGAAGQSLFTYTAGSEAHSLAIDSAISAQELAFSSSATL------ 352

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
                       +G  D++               V G     T        +G +     
Sbjct: 353 ------------SGNGDVLKDLSMLSQTPLTNGSVVGK----TPYSAYSGLLGDIGIFTR 396

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +      +Q+       +  +   VN  EE + ++    +Y  + K+I   ++M QTLL
Sbjct: 397 QAESEATAAQISVEDAQVARDSVSAVNSDEEAANMLLYLNAYEANMKVISTANQMFQTLL 456


>gi|300722675|ref|YP_003711965.1| flagellar hook-filament junction protein 1 [Xenorhabdus nematophila
           ATCC 19061]
 gi|297629182|emb|CBJ89778.1| flagellar biosynthesis; hook-filament junction protein 1
           [Xenorhabdus nematophila ATCC 19061]
          Length = 546

 Score =  179 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/548 (13%), Positives = 175/548 (31%), Gaps = 73/548 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVT--------- 51
           MS  ++ N A +  N A      +  NI N+ + +Y R+ T+ T +   ++         
Sbjct: 1   MS-NSLMNTAMSGINAAQVAMGVVGNNIANSKSADYNRQTTVMTQNNGTMSPVGFVGNGV 59

Query: 52  -VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V     E      +  +A  +     +           + AD   + S ++ I  L  S
Sbjct: 60  VVSGINREYSEFITQQHNAAQTKYAALKTYDQQITKINDLLAD--KDTSLSNSIEDLFKS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L +   N  +     TV+  AE ++  F  +   +++I    + +IE  +  + ++  E+
Sbjct: 118 LGTVESNAEDSAARTTVLGKAEGLISRFKETDEYLRQIDNSINSQIEQNVQEINKYAEEI 177

Query: 171 TVVNDAIKFKTASKH-DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +ND I+    + + +    LD+RD  + ++++++ ++ I ++     V    G TL  
Sbjct: 178 AKLNDEIRRMRGTGNGEPLALLDKRDEAVNRLNQLVEVNVIQQDGGAYNVSFGGGMTLVS 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      +S      +                 V +G +   LQ+R  VV   +N+
Sbjct: 238 GNKPYQLEAIPSSTDSARITLGYNNGTSGTREIDERFVSQGALGGALQVRREVVDKTRNE 297

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN-- 347
           L+++A V+   F++      +     G+   +  K                     ++  
Sbjct: 298 LNQLALVMADQFNQVQHSGFDLNGDKGVDFFNFTKPEIISNSNNKGSAGITVEYADTSKV 357

Query: 348 -----------------------------------PSFLRDGGSVSKKFLWNVKNLAGYP 372
                                                 L+     +K    +   L    
Sbjct: 358 KASDYTLKFDGRDWKVQRVSDKAMLPVKPTGDTLEFDGLKVKIDAAKAEANDTHTLKTVS 417

Query: 373 DLINHYCDSFNKNFIFDPVAGINTNVT---------------LLEYARNSIGWLEK---- 413
           +++     +   +         +   +               L++   +  G        
Sbjct: 418 NVVATLEVNLKDSSQLATAGAKDGGPSDNRNAKKFLELQDKRLIDGKSSFAGAYASLVSK 477

Query: 414 ---NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
              + +           + + +  +  +  GVN+ EE   L +++Q Y  + ++I     
Sbjct: 478 VGSDANKVKVGFEAQGHIVDKLHSTRQSISGVNMDEEYGELQRLQQYYLANARVIQTAST 537

Query: 471 MLQTLLEG 478
           +   +L  
Sbjct: 538 LFDAILGI 545


>gi|94500248|ref|ZP_01306781.1| Flagellar hook-associated protein [Oceanobacter sp. RED65]
 gi|94427547|gb|EAT12524.1| Flagellar hook-associated protein [Oceanobacter sp. RED65]
          Length = 991

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/443 (12%), Positives = 137/443 (30%), Gaps = 18/443 (4%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           +  +     +              NI N D + Y R+D                     V
Sbjct: 1   MAGILEIGISGLRVHQTALTVTGNNIANVDTEGYSRQDASIVSQNPQFQGGVWIGGGARV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              R          L   +S       L +     + + AD          I  +  + +
Sbjct: 61  DDVRRIYDEFLVGQLQKDTSTFNYFDTLSTNAEQIDKLLADP--GTGIQPGIENMFGAFQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   + S     + V+  ++ +V  F +    ++      + ++    + L      ++ 
Sbjct: 119 AAIDDPSSLPARQVVLSESQGLVDRFASIDDRLRDSNNILNGQMGTLATQLNTLAESISE 178

Query: 173 VNDAIKFKTAS--KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +N  I+F TAS   +  ++ LD+RD+ +++ISE++ ++   ++N+ + ++  +G  L   
Sbjct: 179 LNTQIQFATASAQGNYPNELLDKRDLAIKEISELVSVTVATQDNDSVNIFIGNGQPLVVG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
              +           +   N ++ +   V  N  + V  GK+  LL  R  V+    +Q+
Sbjct: 239 KDVNRVSVAPGQQDPSR--NALYFERDGVVQNITNEVEGGKLGGLLAYRREVLDPVISQI 296

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
              A  L  + +E+  +  + +   G    + + D      + I +     P  R     
Sbjct: 297 GRAAIALQFNMNEQHALGIDIDGQRGGLFFNDVNDPLLASSRVIGDADNEMPDDRDIKVN 356

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           + D   ++                         +               +  +  +    
Sbjct: 357 ITDPNELTDSDYKIEFVGPNDYTFRVTRVKDGEEMLTTALSTEFPETFNIDGF--DISFE 414

Query: 411 LEKNRSDSHDLHMKSQVVFNHIS 433
               ++        ++     + 
Sbjct: 415 AGSFKAGDQFYLTPTRNGAKDLD 437



 Score = 83.2 bits (203), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 49/374 (13%), Positives = 111/374 (29%), Gaps = 10/374 (2%)

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L +++ +    +  K  ++  E       T  +  +    +    I+      R   +  
Sbjct: 621 LTNFTDDPVGFLEQKLFLNGVELTDSLPPTQIKYDESYPDEVPNPIDANFLADRINANFD 680

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
                 +     SK        +   +  +      I      +  +   T  G    E 
Sbjct: 681 FQEQGIVARSDGSKLTIIALNGEDLSIEFQGDNGDSIDVGNGQDTYL---TPTGQAFSEP 737

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
           + +   F+       T E +        +  N+        IK +    +  +  +  +L
Sbjct: 738 LSKYEGFDFTEGGPYTFEFDVPGQGTFNIELNEEYTTGPDLIKGIEDKINDTLFSYNGEL 797

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
                       + + +  + + V G         +  +L +GI              + 
Sbjct: 798 QVDIDEKGNILFQ-NRLEISPKGVNGSAKLTMGGQVKVELDEGIEFRTQPPGSNLFEENP 856

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN------TNVTLLEYA 404
            +       +   +     G    ++   D+   N     + GI        ++T  E  
Sbjct: 857 EQKPTYFGYELSMDGVPKEGDAFYVDFNDDAVTDNRNGVLLGGIQKKEIIEGDMTFSESY 916

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
             ++  +    + +      S+V+  +  ++ S   GVNL EE   LI+ E  YN S ++
Sbjct: 917 GKTVEEVGSITARAQINTESSKVLLQNSEDNVSAVSGVNLDEEAGKLIQYELGYNASAQV 976

Query: 465 IMFTDKMLQTLLEG 478
           I     +  TL+  
Sbjct: 977 ISVARDLFSTLIGI 990


>gi|256376483|ref|YP_003100143.1| flagellar hook-associated protein FlgK [Actinosynnema mirum DSM
           43827]
 gi|255920786|gb|ACU36297.1| flagellar hook-associated protein FlgK [Actinosynnema mirum DSM
           43827]
          Length = 459

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/491 (14%), Positives = 151/491 (30%), Gaps = 53/491 (10%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN------------ 49
           S  +    A      A +      +NI NA  + Y R+   T                  
Sbjct: 3   STFSGITSALGGMQAARRGLEVAGQNIANARTEGYSRQRVETAAVGGTANAAFYATPPAT 62

Query: 50  ---VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V V           +       S        +   A  E +  D+  +N     ++ 
Sbjct: 63  AGSVEVTGITRMADAFLEARGRTEHSKQAYLDGREEILATTEGLF-DEPSDNGLQAQLTG 121

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
           +  S    + N  +  +   ++ ++  V    N  A+ +     D    ++  +S +   
Sbjct: 122 MWKSWTDTADNPGDSAVRNQLVVSSGVVADRLNNLAQTLGGEYNDTRGRLDSTLSEINTG 181

Query: 167 LSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTT 226
              L  +N A+         A++ LDQRD L  ++ E+ G +T    +  + V     + 
Sbjct: 182 ARRLADLNTAVVQAKQHGLPANELLDQRDQLALRLVELTGGTTSTGADGSLDVQLGGVSL 241

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF 286
           +  +  R +      + T  +            S+   + +  G   ALL+   +++P +
Sbjct: 242 VSGSTARSLTLTGSATLTGAAGDPATVRWSDDASA---APLTGGSGGALLEGLTTIMPDY 298

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRS 346
             QLD++A  L    +++           G                              
Sbjct: 299 LAQLDQVASKLATGVNQQHKAGFTPTGAAGGDFF-------------------------- 332

Query: 347 NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARN 406
             S              +    +          ++   + +     G + +       R 
Sbjct: 333 --SGTTAATIKVALTSGDQVATSSSATRALDGSNADAISALARSATGPDAS------YRQ 384

Query: 407 SIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIM 466
           ++  +      +         +   +  +  ++ GVNL EEL+ ++  ++SY  + +++ 
Sbjct: 385 TVVKIGMAVQTAASRSATQASITAQVDAARQSSAGVNLDEELTSMLTYQRSYEAAARVMS 444

Query: 467 FTDKMLQTLLE 477
             D ML TL+ 
Sbjct: 445 AVDSMLDTLIN 455


>gi|126445158|ref|YP_001061252.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           668]
 gi|126224649|gb|ABN88154.1| flagellar hook-associated protein FlgK [Burkholderia pseudomallei
           668]
          Length = 452

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/479 (13%), Positives = 151/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATGGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY---ISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +           K   +LE+ S +  +
Sbjct: 62  TQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLGFGKFIGALEAASGDPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSMANGQPLVVGAQAGKIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    + S       + + +        G++  L +  + V+      L  +A      
Sbjct: 242 DAAGQQTLSLAFGSQVMPLRAAS----LGGELLGLAEFEEEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            +++     +    PG  +                 T             ++        
Sbjct: 298 INDQLTQGFDMNGNPGKPLL----------------TYDAATGLLGVDPSVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    L+     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALVEIGSTSVDLPGI--------GDVSLGNAIATMMGKVGAASQQNRQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|283834449|ref|ZP_06354190.1| flagellar hook-associated protein FlgK [Citrobacter youngae ATCC
           29220]
 gi|291069996|gb|EFE08105.1| flagellar hook-associated protein FlgK [Citrobacter youngae ATCC
           29220]
          Length = 458

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 163/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+  +T+           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTDGYTRQVAITSTIGASSGSANSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYNTQQEYLTQLETVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  +  +    + +   +    ++   + +  ++ +    S +   N
Sbjct: 120 TTSPDDSALREQVISESGALALRVDNTLDYIDSQSSEIVSQEKAMVAQVNTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S I+ +   + +  +  V   +G  L       
Sbjct: 180 QQIAEAEANGDNASALYDARDQMVEQLSGIMDVQVNIDDEGNYNVTLQNGQPLVSGQESS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                       ++           +++  +    G + AL   ++ V+      ++ MA
Sbjct: 240 -----TIELDTNADGTQSMSLTFAGTTSSMNTDTGGSLGALFDYQNEVLTPLTGTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +    ++  +   +   +       + S+P      
Sbjct: 295 EQFADAVNTQLAQGYDLNGNPGEPLFIYDENSSDGPLEVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +    + +     +VT+ E   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLDIEGL----GSVTVGEACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I     +  +
Sbjct: 393 SQQNQTEAEAAANVYSEAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISTGADIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|253990121|ref|YP_003041477.1| flagellar hook-associated protein FlgK [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781571|emb|CAQ84734.1| flagellar hook-associated protein 1 flgK [Photorhabdus asymbiotica]
          Length = 547

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 78/550 (14%), Positives = 175/550 (31%), Gaps = 73/550 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS  ++ N A +    A     ++  N+ N     Y R+ T+   +             V
Sbjct: 1   MS-NSLINTAMSGLQAAQIALGTLSNNVANMRVPGYNRQSTVINQNGGTMTSVGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           TV +   +     ++ L +  +  G         +  + + AD    N+ ++ I     S
Sbjct: 60  TVASINRQYNEFINQQLSSAQAKQGALTTYSQQISQIDNLLAD--KANNLSNTIDDFFTS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D    T I  A+ ++    ++   ++K+  + ++ I     ++  +  ++
Sbjct: 118 LQNVVSNAEDDAARTTTIGKAKGLMNQLKSADTFLRKMENNINRGIANSADDINNYAQQI 177

Query: 171 TVVNDAIKFKTASKHD-AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I           +  LDQRD L+ ++++++G+S   ++ +   V  + G TL +
Sbjct: 178 AKLNGEITRMRGGGSAEPNSLLDQRDQLVNELNKLVGVSVTQQDGDTYNVTFAGGLTLVQ 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                      ++   +  +         V       + KG++   L+ R  V+   +NQ
Sbjct: 238 GTTAYRVEAISSNADSSRITLGYDRGFGDVVEIDERHIDKGELSGTLRARSEVLDNSRNQ 297

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKD-----------------LDNKLCQ 332
           L+++A VL   F++      + +   G       K                    +    
Sbjct: 298 LNQLALVLGDQFNQVHRSGFDLKGRQGEDFFTINKPDIIANGKNKGSADFKVEYTDTSAV 357

Query: 333 GISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA 392
             S+                D   +S K   N     G    IN         +    V 
Sbjct: 358 KASDYHLSYDGANWKIQRAADKADISAKVTGNTLEFDGLKVEINPTDVKEYDRYTLKAVN 417

Query: 393 GINTNVTLLEYARNSIGWLEKNRSD----------------------------------- 417
           G+   + +     + +                                            
Sbjct: 418 GVIGGMEINIKDASQLAAAGTKDGGPSDNVNAKKLIELQSKKLVEGKASFSGAYASMVST 477

Query: 418 -------SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
                  ++      + + N +     +  GVN+ EE   L  ++Q Y  + ++I     
Sbjct: 478 IGNQTSTANVDLETQRNITNQLRVEQQSVSGVNIDEEYGALQSLQQYYLANAQVIQTATT 537

Query: 471 MLQTLLEGVK 480
           +   +L+  +
Sbjct: 538 LFNAILDLRR 547


>gi|37525847|ref|NP_929191.1| flagellar hook-associated protein FlgK [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785276|emb|CAE14217.1| Flagellar hook-associated protein 1 (HAP1) [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|37681983|gb|AAQ97871.1| FlgK [Photorhabdus luminescens]
          Length = 549

 Score =  177 bits (448), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 75/552 (13%), Positives = 170/552 (30%), Gaps = 75/552 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NV 50
           MS  ++ N A +    A     ++  N+ N+    Y R+ T+   +             V
Sbjct: 1   MS-SSLINIAMSGLQAAQIALGTVSNNLANSKVPGYNRQSTVVNQNGGTMTSVGFIGNGV 59

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           TV +   +     ++ L    +  G+        +  + + AD    N+ ++ I     S
Sbjct: 60  TVTSINRQYNEFINQQLSEARAKQGEFTTYSQQISQIDNLLAD--KANNLSNTIDDFFTS 117

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L++   N  +D    T I  ++ +V    ++   ++K+  + ++ I     ++  +  +L
Sbjct: 118 LQNVVSNAEDDAARTTAIGKSKGLVNQLQSADAFLRKMENNINRGIANSAESINNYAQQL 177

Query: 171 TVVNDAIKFKTASKHD-AHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
             +N  I           +  LDQRD L+ ++++++G+S I ++ +   V  + G TL +
Sbjct: 178 AKLNGEITRMRGGGSAEPNALLDQRDQLVNELNKLVGVSVIQQDGDSYNVSFAGGLTLVQ 237

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQ----GSAVPKGKIKALLQIRDS---- 281
                      ++   +  +         V              G ++A  ++ D+    
Sbjct: 238 GTTAYRVEAISSNADSSRITLGYDRGFGDVVEIDEKFIDKGQLGGTLRARSEVLDNSRNQ 297

Query: 282 ------VVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGIS 335
                 V+    NQ+      L G   E      N + +                   + 
Sbjct: 298 LNRLALVLGDQFNQVHRAGFDLKGKPGEDFFTFNNPDVIANSKNKGSANFKVEYTDTSVV 357

Query: 336 ETICVNPQYRSNPSFLRDGGS-------------------------------VSKKFLWN 364
           +    +  Y      ++                                     +  L  
Sbjct: 358 KDSDYHISYDGANWKIQHASGKVKVDIAAKVTGNTLEFDGLKVEIDPTNVKENDRYTLKT 417

Query: 365 VKNLAGYPDLINHYCDSFNKNFIFDPVAGIN----------------TNVTLLEYARNSI 408
           V  + G   +              D  A  N                 N +      + +
Sbjct: 418 VSGVIGNMAVNIKDASKLAAAGNKDGGASDNVNAKKLIELQNKKLVEGNASFSGAYASMV 477

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +    S+++        +   +     +  GVN+ EE   L  ++Q Y  + ++I   
Sbjct: 478 STIGNQTSEANVDLETQNNITKQLYADQQSVSGVNVDEEYGALQNLQQYYLANAQVIQTV 537

Query: 469 DKMLQTLLEGVK 480
             +   +LE  +
Sbjct: 538 TTLFNAILELRR 549


>gi|222099583|ref|YP_002534151.1| Flagellar hook-associated protein 1 [Thermotoga neapolitana DSM
           4359]
 gi|221571973|gb|ACM22785.1| Flagellar hook-associated protein 1 [Thermotoga neapolitana DSM
           4359]
          Length = 860

 Score =  177 bits (447), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 57/454 (12%), Positives = 131/454 (28%), Gaps = 37/454 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS+  + N A             +  NI NA+   Y R+  +                  
Sbjct: 6   MSMFGILNTALTGIYTHKLAMNVVGHNIANANTPGYSRQRPVIEATPPIPLTTLTQPSIP 65

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                   V T         D      ++       + S     E + + +   N     
Sbjct: 66  LQMGTGSRVRTIVRLRDAFLDIQYRQVNNRYNYWDTILSNLHFIEQLLS-EPGENGIRSL 124

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +    ++ +    + +       V+  A+++V         ++++R D D EI   +S +
Sbjct: 125 VDNFWNAFQEVISDPTNTASKAEVVSRAQQMVSQMKDLYGRLEQLREDIDNEIVQRVSEI 184

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            + +  L  +N+ I+     K   +D LD+RD +L ++S+++ I+     +  + +   +
Sbjct: 185 NQMIKRLADLNNKIRIGMTLKSPPNDLLDERDRILDELSDLVNINYTEAEDGQITLRIGN 244

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              L  +   ++   +          + +F+    +          GK+KALL +RDS +
Sbjct: 245 QIVLNGSTYNEV---RALERPYGRGYHELFVGNAKLIL------SDGKLKALLDLRDSTI 295

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
             +  +LDE       + +        S  V          +  +               
Sbjct: 296 VKYMRKLDEFVLFTTDAINLIHRDGFESGGVTTNLDFFKKIESFSDDPAIFRIK------ 349

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
              N                                   +          +++  T+ + 
Sbjct: 350 --GNRKLEMGPYHTVTGIHSATSVSEITGKTFTSDDLILSFGGGTSSALAVSSGSTINDL 407

Query: 404 AR--NSIGWLEKNRSDSHDLHMKSQVVFNHISES 435
               N +G        +    +  +     +   
Sbjct: 408 ISSWNLLGTTLSTGQHAGGYRLYLEDTSGDLRNK 441



 Score =  109 bits (272), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 48/433 (11%), Positives = 109/433 (25%), Gaps = 27/433 (6%)

Query: 74  IGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL----RDSLESYSKNLSEDILGKTVID 129
           +  +               D                       S S  + +  +  T+ D
Sbjct: 429 LYLEDTSGDLRNKIFFSLGDSLSKMGFETETRGFLTIKESDFSSLSPGIYKVSVEYTLKD 488

Query: 130 NAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHD 189
            +++        +  V      +     L +                I        D   
Sbjct: 489 GSKQSETIPIDLSSGVSLSNIASSINSSLHLRAQVYTDPATGENMLVIVPDEFLNFDPSA 548

Query: 190 FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSES 249
                D      +     +  V    D +     G T F+               +    
Sbjct: 549 VNVLSDDSFFTEANAFVRNYEVLKYRDTLENVFYGQTGFDPTRAFTITINSTDIEIDPVV 608

Query: 250 NPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIF------QNQLDEMARVLIGSFSE 303
           + +      ++      +          +R + +  F                L     +
Sbjct: 609 DTLETLVEKINEKGTGVLADLTPHNSFVLRATSLYDFDLRMMEIKGPQGFFEALGLIDPD 668

Query: 304 KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLW 363
            DP   +        ++        +    +S+ +  +      P  + +   VS     
Sbjct: 669 NDPTTFDWT-NSYTLVSKNDDFDTLRDRFRVSDILTFDRAPHDEPLNIVNQFEVSSSLAS 727

Query: 364 NVKNLAGYPDLINHYCDSFNKNFIFDPVAG----------------INTNVTLLEYARNS 407
           N  NLA          D    +      A                  N   +  E+    
Sbjct: 728 NPNNLAVDIGYALENSDWNAVDIRPTGAANPKLLEMVQNLYTRKMLSNGKESFYEFFGGV 787

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           +  L      +  L   ++++   I        GV+L EE++ +I+ + +++ + K+I  
Sbjct: 788 VAELGVEAETASSLKTNTEILRQEIDNERERVKGVSLDEEMANMIEYQHAFSAAAKVIST 847

Query: 468 TDKMLQTLLEGVK 480
            D+M+QT++  V+
Sbjct: 848 VDEMIQTVINMVR 860


>gi|265993604|ref|ZP_06106161.1| FlgK [Brucella melitensis bv. 3 str. Ether]
 gi|262764474|gb|EEZ10506.1| FlgK [Brucella melitensis bv. 3 str. Ether]
          Length = 418

 Score =  177 bits (447), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 126/417 (30%), Positives = 205/417 (49%), Gaps = 5/417 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +    A++     S+Q + + RNI  A + +Y RR       P     V       
Sbjct: 1   MSLSSALLTAKSSLAATSKQTSVVSRNISGAKDADYSRRTASLVSGPYGSLYVGISRSAD 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     +SA      L         + + D+Y+ SP+  I  LRD+L++Y  + S 
Sbjct: 61  EAMFNRYIQSNSAASASSTLADGRDRLSALYSADNYSGSPSGLIGDLRDALQTYVASPSN 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
             LG +V+  A+ +    N   R+VQ +R DAD+EI   ++N+   L++    N  +   
Sbjct: 121 SALGDSVVSVAQSLANALNDCTRQVQSLRNDADREIADSVANINDLLAKFEKANQNVVGG 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T    D  D+LDQRD LL++ S  IGI+T++R +NDMV++  +G TLFET  R + FE+ 
Sbjct: 181 TRMGRDVSDYLDQRDALLKQRSGEIGITTMMRGDNDMVIFAENGVTLFETTARKVTFEQS 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQ-GSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
              T       + +DGV +S +        G++  LLQ+RD + P +Q QLDE+AR L+ 
Sbjct: 241 AVLTPGVAGKAVTVDGVPLSHDTFDQPFGTGRLSGLLQLRDQIAPQYQMQLDEIARGLVT 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETIC----VNPQYRSNPSFLRDGG 355
            F+E D    + +       +         L  GI+ TI            +   LRDGG
Sbjct: 301 VFAESDQTGSSPDQTGLFSWSGSPAIPGAGLSAGIAGTIEVSVPFIASEGGSALLLRDGG 360

Query: 356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           +    + +NV+  AG+ D +    ++F++  +FD  AGI+++ +L+ Y+ +S+GWLE
Sbjct: 361 ANGANYKYNVQGAAGFSDRLRALNEAFSEPMVFDAAAGISSSSSLIGYSASSLGWLE 417


>gi|170680262|ref|YP_001742379.1| lateral flagellar hook associated protein 1 [Escherichia coli
           SMS-3-5]
 gi|170517980|gb|ACB16158.1| lateral flagellar hook associated protein 1 [Escherichia coli
           SMS-3-5]
          Length = 458

 Score =  176 bits (445), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 160/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 LQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSEAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|114798876|ref|YP_758980.1| flagellar hook-associated protein FlgK [Hyphomonas neptunium ATCC
           15444]
 gi|114739050|gb|ABI77175.1| flagellar hook-associated protein FlgK [Hyphomonas neptunium ATCC
           15444]
          Length = 483

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 102/491 (20%), Positives = 185/491 (37%), Gaps = 21/491 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPEN-----VTVVTQ 55
           MS+ A    A++     SQ+   +  N+ NA    YVRR  +            V     
Sbjct: 1   MSISAAILAARSGLQVTSQKAEIVATNVANASTPGYVRRSLVVGELVNGSQTAGVMANGV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                +         +S + Q  +L S          +           S    +L +  
Sbjct: 61  ARAGDDAIKAQRRELTSDVAQATVLASTWQTISQRVGNTSSGGGLFRSFSNFETALSAAV 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            +      G  ++D A+ V +  N+ +    + RA+AD EI   +  +   L ++  +N 
Sbjct: 121 TSPESTANGSALLDAAKSVARELNSLSEYGAQARAEADSEIAQGVETVNTALKQVQDLNK 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL-FETVPRD 234
            I     +   A   +D+R  +L  I+E + I T+ R+   + V T+ G  L   +  R 
Sbjct: 181 RIASIDRTSEQAATLMDERQRVLDTIAEFLPIQTVQRDAGTIDVLTTQGVYLINGSTARQ 240

Query: 235 INFEKMNSYT-----VTSESNPIFIDGVVVSSNQGSA--VPKGKIKALLQIRDSVVPIFQ 287
           I F   +++T        + + I +DG+ +++   S   V  G   AL  +RD  VP F 
Sbjct: 241 IEFTPSSAFTSGQTLANGDLSGISVDGIDLTTGSTSFGAVSGGLFGALFTLRDQDVPAFM 300

Query: 288 NQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
           +QLD +A  +I   S+       +    GLF+      L   L   IS    V+P    +
Sbjct: 301 DQLDMVANDIITRLSDDAIDPTKTPGEQGLFVDPDAAGLSG-LASRISVNAAVDPAQGGD 359

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              LRD                G    ++   D+F +    +   GI    +  + A   
Sbjct: 360 IWRLRD------GLGATASGPPGNSATLSAIYDAFTQVKSLNAN-GIQGAFSASDLAAQL 412

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
              + + R     +   +Q     + E+  +  GV++  E+  L+ +EQ+Y  + ++I  
Sbjct: 413 SSVVGQKRVYQDSVLASTQAQHVTLVEAEQSLTGVDVDVEMESLLLIEQAYAANARVIQV 472

Query: 468 TDKMLQTLLEG 478
              M+  L+E 
Sbjct: 473 ARDMIGILMEL 483


>gi|325497610|gb|EGC95469.1| flagellar hook-associated protein FlgK [Escherichia fergusonii
           ECD227]
          Length = 548

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 60/549 (10%), Positives = 154/549 (28%), Gaps = 75/549 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  + A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLSAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + + + +   N+ +  +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTTRYEQMSKIDNLLSSET--NNVSTSLQGFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  A+ +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKADGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    +D LDQRD L+ ++++++G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNDLLDQRDQLVNELNKVVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPI-------------------------------------- 252
                     +    +  +                                         
Sbjct: 239 SSARQLAAVPSHADPSRVTVAYVDATAGEIEIPEKLLTSGTLGGMLTFRSQDLDQSRNTL 298

Query: 253 ---------------FIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
                                  +        GK   L   +++     + ++   ++VL
Sbjct: 299 GQLALAFADAFNKQHQAGFDATGAKGEDFFAIGKPLVLSNTQNNSDAAIKAEVINGSQVL 358

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
              ++     AG  +            + D                   + +        
Sbjct: 359 ATDYTITWQGAGKWQVTRLASNTSFTVEPDAAGNVEFDGLKLTFSGTPKDNNSFTLKPVS 418

Query: 358 SKKFLWNVKN--------LAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                 +VK                 +   +      +      +    +  +     + 
Sbjct: 419 DAVVNMDVKVKDESQIALAQEAGAGDSDNRNGQKLLDLQSNGKTVGGAKSFNDAYATLVS 478

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   +
Sbjct: 479 DVGNKTATLKTSSTTQNNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTAN 538

Query: 470 KMLQTLLEG 478
            +   L+  
Sbjct: 539 TLFDALINI 547


>gi|291288372|ref|YP_003505188.1| flagellar hook-associated protein FlgK [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290885532|gb|ADD69232.1| flagellar hook-associated protein FlgK [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 584

 Score =  176 bits (445), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 78/579 (13%), Positives = 192/579 (33%), Gaps = 100/579 (17%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PEN 49
           MS L+ +F+   +    +         NI N + + Y R+  +   +             
Sbjct: 1   MSNLMHIFSTGVSGLFASQAGIDVTGNNISNVNTEGYSRQRVVLETANPEKNSQGVFGRG 60

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V+V T      +M    +   SS +     LQS  +   +   +    +     +    D
Sbjct: 61  VSVETVERIYDDMLASSIRNESSDLAYYETLQSALSKVTIYFNELEDGSGLGEAMQNYFD 120

Query: 110 SLESYSKNLSEDI-----LGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
           +    +    ++         T++++A  +      S   +++I+ +++  +   ++ + 
Sbjct: 121 AWGDLANTAPDESDEALIKRATLVESASVLADKIQASYASLEEIKNESNLLVSDYVNEIN 180

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
                +  +N  I    +    A+DF DQR VLL +++EI  +S   R+N  + VY    
Sbjct: 181 NISENIAYLNKEIARIESGGDTANDFRDQRQVLLNRLAEISNMSVTERSNGQVAVYIGGN 240

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             + E    ++  E+ +  +                 +  +A   G+I   L +RD ++ 
Sbjct: 241 AIVDEATRFELKAEQADEDSDDVSIFWGTEGQSNKLVDITNAFTSGEIAGELYVRDELIQ 300

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC------------- 331
            +Q+QLDE+A V+I   ++   +   +  +  +  ++G+ +                   
Sbjct: 301 GYQDQLDELANVMITETNKIHSLGQGTNRLTQISSSNGVTNPTYTFSEPAGAFPIEIQAG 360

Query: 332 -------------------------QGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVK 366
                                      ++  I        NP+      S+S        
Sbjct: 361 TLRISIYDTEGNKVEDLDIVIDPAKDNLNSVIAKISAADGNPNGGMIQASMSSGNTIKFT 420

Query: 367 NLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL--LEYARNSIGWLEKNRSDSHDLHMK 424
           + +GY         +F            +   T+   +   ++  ++  +++ +   +  
Sbjct: 421 SGSGYDFTFAEDTSNFLVASGTYGFFAGSDASTIAVSDIIMSNNSYIATSQTGAAGDNQN 480

Query: 425 SQVVFNHISESYSNTVGVNLQE-------------------------------------- 446
           +  + +    +   ++ V + E                                      
Sbjct: 481 AAAIADLKDTNIMTSMDVTVDEFYAYFAASIGSDKATVDIYVTTKTQAMSELELKLEEVK 540

Query: 447 ------ELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                 E++ L+K ++++  S++ I   D+ML+ L+  +
Sbjct: 541 GVSMDEEMTNLMKFQRAFEASSRFITVVDEMLEKLVNSL 579


>gi|331671810|ref|ZP_08372606.1| flagellar hook-associated protein FlgK [Escherichia coli TA280]
 gi|331070799|gb|EGI42158.1| flagellar hook-associated protein FlgK [Escherichia coli TA280]
          Length = 458

 Score =  176 bits (445), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 161/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSEAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|182412215|ref|YP_001817281.1| flagellar hook-associated protein FlgK [Opitutus terrae PB90-1]
 gi|177839429|gb|ACB73681.1| flagellar hook-associated protein FlgK [Opitutus terrae PB90-1]
          Length = 484

 Score =  175 bits (444), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 68/497 (13%), Positives = 165/497 (33%), Gaps = 47/497 (9%)

Query: 1   MS-LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------N 49
           MS L A  N      +  S+   +  +N+ N +N +Y R+  +                 
Sbjct: 1   MSGLFASLNSTVGALSAHSRSIETAGKNLANVNNASYARQRVVYGDRGTIVTPDGAYSLG 60

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADD-------------HY 96
           +  +  +     + D  +   +S        Q      +     D               
Sbjct: 61  LEALGVQQLRDMLIDNQVTRETSLTSYFAAQQKAYQRAQAALGQDISSVGSSVSASASTS 120

Query: 97  NNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEI 156
           +      +  L ++ + ++ N ++  + ++++  A  +      + + + +++AD   +I
Sbjct: 121 DAGIGAGLDDLFNAFQGFASNPTDTGIRQSLLQTASILTDRVQLADKRLAQVQADLHSQI 180

Query: 157 ELEISNLRRFLSELTVVNDAIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNN 215
           + ++    + L+ ++ +N+ I          A D  DQR   L+K++  + I     +  
Sbjct: 181 QTDVGEANKLLATISDLNNQIARFEVERPGSAVDLRDQRQAALEKLATKLTIDVQEISTG 240

Query: 216 DMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
            ++V +       +     +     +S T     +P        +      +  G I+  
Sbjct: 241 QVIVSSP------DANGAPVVLVDSDSITGPVSFDPATDTISAGTPTTVLGLTSGAIQGS 294

Query: 276 LQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGIS 335
           L   +  V   ++QL  +A+ L  S +E                 DG  D        ++
Sbjct: 295 LSAHNEGVQPLRDQLTLIAQQLTASVNEIYNPG-GVAADDFFATLDGNGDPITAGTFQLA 353

Query: 336 ETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGIN 395
             +     + ++                     AG   +         + F         
Sbjct: 354 SGLTAFSLHAND---------------GTAGAPAGDNSVALAIAQLATRRFSTTGAPPDL 398

Query: 396 TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVE 455
            + TL  +  +++  L +  + +       + +   +        GV+L EELS L+K +
Sbjct: 399 IDGTLSSFYSSAVSGLGQATAGATTRLNSQESIEQLVRSQRDAVSGVSLDEELSDLLKYQ 458

Query: 456 QSYNISNKLIMFTDKML 472
           +++  S+++    DK+L
Sbjct: 459 RAFQASSRVFQTIDKLL 475


>gi|294635619|ref|ZP_06714095.1| flagellar hook-associated protein FlgK [Edwardsiella tarda ATCC
           23685]
 gi|291091002|gb|EFE23563.1| flagellar hook-associated protein FlgK [Edwardsiella tarda ATCC
           23685]
          Length = 552

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/555 (13%), Positives = 161/555 (29%), Gaps = 83/555 (14%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           +  + N A +  N A    A    NI +     Y R+      +             V V
Sbjct: 1   MANLINNAMSGLNAAQTALAVTSNNINHVYTAGYNRQSVSFAENNGTSTPAGFIGNGVVV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
                E        L    S +          +  + + AD    NS +  +     +L+
Sbjct: 61  SGINREYNQFIVNQLRQGQSTLATTATYHQQISQIDDLLAD--STNSLSANMQNFFKNLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +     S+    +TVI NA  +   F T+   ++ + ++ +  +      +  +  ++  
Sbjct: 119 NLVSYPSDSAARQTVISNANGLTAQFKTTDAYLRNLESNTNLTVSNSAEQINDYAKQIAS 178

Query: 173 VNDAIKFKTAS--KHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +N+ I   T +      +D LDQRD +  ++++II +   +++     +  + G +L + 
Sbjct: 179 LNNRISELTGASGGTAPNDLLDQRDQMASELNQIIDVDISMQDGAM-NISFAGGLSLVQG 237

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQI--------RDSV 282
                     +S   +      +  G  +S    + +  G +  + +         R+ +
Sbjct: 238 GDAYGVKAVPSSSDPSRT-TLAYDRGNGLSEVPEARIRGGSLAGVYRFRSEALDNTRNQL 296

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP 342
             I  +      +V            G+              +          E I    
Sbjct: 297 GQIALSMAHAFNQVQAEGVDLNGEKGGDLFGFAQPESLANGNNTSKASLSASYEDIDKVQ 356

Query: 343 QYR-------------------------------------------------SNPSFLRD 353
                                                               ++   LR 
Sbjct: 357 ATDYRVDFKDGKWNITRLADGSQQTVTPKKDGSDTVLKFDGLKVKINDTPAENDSFKLRT 416

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG----------INTNVTLLEY 403
             +V   F   + + A             +     +  A           +    TL   
Sbjct: 417 TSTVVSGFDVKISDPAKIAAASLASGTGKDHEVGDNTNAQKMLDLQNKKLVGGKATLSGA 476

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
               +G +    + S   +   + V   ++++  +  GVNL EE   L++ +Q Y  +++
Sbjct: 477 YAGLVGTVGNQTNSSKVDNKAQENVVKQLTKAQQSVSGVNLDEEYGNLVRFQQYYMANSQ 536

Query: 464 LIMFTDKMLQTLLEG 478
           +I     M   LL  
Sbjct: 537 VIQTATTMFNALLSI 551


>gi|300114793|ref|YP_003761368.1| flagellar hook-associated protein FlgK [Nitrosococcus watsonii
           C-113]
 gi|299540730|gb|ADJ29047.1| flagellar hook-associated protein FlgK [Nitrosococcus watsonii
           C-113]
          Length = 647

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 60/430 (13%), Positives = 133/430 (30%), Gaps = 17/430 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           M    +     +    A +  A+   NI N +   + R+                    V
Sbjct: 1   MPSSDLLGIGASGLLAAQRALATTSHNIANVNTPGFSRQRAELAARLPEFTGQGFIGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V T R    +   +     +S   Q +      A  + + AD       +       ++
Sbjct: 61  DVTTVRRAYDSFLTEQARHATSEYAQSKAFHDLAAQVDNLFAD--SETGLSTSSQHFFNA 118

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            ++ + + S     + ++   E       +    + ++    +  ++  ++ +    S +
Sbjct: 119 AQALANDPSSPAARQMLLTEGETFEARVRSLDGRLSELDEGINTRLQATVAEVNTLSSSI 178

Query: 171 TVVNDAIK--FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +N  I+      +    +D LDQRD L+Q +S+   ++ + +++  + V+   G +L 
Sbjct: 179 AGLNQQIRDLRGQHNDQPPNDLLDQRDQLIQDLSQKAAVTVLPQDDGSLNVFIGKGQSLV 238

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                       NSY  +         G V   +   ++  G++ ALL  RD V+   +N
Sbjct: 239 TGDHSHSLTTLANSYEASRLEVGYATKGGVTPISD--SIQGGELGALLSFRDEVLEPSRN 296

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
            L ++A  +  SF+E+  +  + +   G      I             T         + 
Sbjct: 297 ALGQLAVGVAQSFNEQHRLGMDPQGELGGDFFAPIDSNTAVSLPRADNTGDGVIAVAISD 356

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSF-NKNFIFDPVAGINTNVTLLEYARNS 407
           +                  L    D       +F       D +    T+ ++       
Sbjct: 357 ASKLTDSDYRLDRNGAGFTLTRLSDNQAFSLSAFPGGAETVDGLTLNLTSGSINGGDSYL 416

Query: 408 IGWLEKNRSD 417
           I         
Sbjct: 417 IQPTRTAAQQ 426



 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/389 (12%), Positives = 107/389 (27%), Gaps = 9/389 (2%)

Query: 91  SADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA 150
                 ++S          S        S + LG+  +  A+   +          ++  
Sbjct: 266 GGVTPISDSIQGGELGALLSFRDEVLEPSRNALGQLAVGVAQSFNEQHRLGMDPQGELGG 325

Query: 151 DADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI 210
           D    I+   +              A+    ASK    D+   R+     ++ +      
Sbjct: 326 DFFAPIDSNTAVSLPRADNTGDGVIAVAISDASKLTDSDYRLDRNGAGFTLTRLSDNQAF 385

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
             +       T DG TL  T     +    +SY +          G+ + ++       G
Sbjct: 386 SLSAFPGGAETVDGLTLNLT---SGSINGGDSYLIQPTRTAAQQFGMAL-TDSARIAAAG 441

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
            I+    + +                L    + +  +  ++              LD   
Sbjct: 442 PIRTEANLGNGGTGQISAAAVTNTTGLPLPPNGEVTLTYDAAARQFNVSGGPGGTLDFDP 501

Query: 331 CQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP 390
               +      P        +            +   L      +    ++ +   +   
Sbjct: 502 ATESNGKEFDLPSVGGLNFIIS-----GVPADGDTFMLQNNTGGVGDNRNALSLAGLQTK 556

Query: 391 VAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSF 450
               +  ++  E     +  +      +       + + +          GVNL+EE + 
Sbjct: 557 PIFQDGTMSYQEQYGRLVAEVGARTRQAEANQDTHKTLLDQAVAEKEGVSGVNLEEEAAN 616

Query: 451 LIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           LI+ +Q++  + ++I   D M QTLL  V
Sbjct: 617 LIRFQQAFQAAARVISTADTMFQTLLGAV 645


>gi|170021354|ref|YP_001726308.1| flagellar hook-associated protein FlgK [Escherichia coli ATCC 8739]
 gi|169756282|gb|ACA78981.1| flagellar hook-associated protein FlgK [Escherichia coli ATCC 8739]
          Length = 458

 Score =  175 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 161/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASSVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|188492642|ref|ZP_02999912.1| flagellar hook-associated protein FlgK [Escherichia coli 53638]
 gi|188487841|gb|EDU62944.1| flagellar hook-associated protein FlgK [Escherichia coli 53638]
          Length = 458

 Score =  175 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 161/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|291526818|emb|CBK92404.1| flagellar hook-associated protein FlgK [Eubacterium rectale M104/1]
          Length = 569

 Score =  175 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 82/566 (14%), Positives = 170/566 (30%), Gaps = 91/566 (16%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----------------S 46
              F    +   N+     +   N+ N +   YVR+    +                  S
Sbjct: 5   FGSFYVGSSGLKNSQNALNTTANNMANVNTTGYVRQQVRFSDKHYITRNNPTAGTNIQQS 64

Query: 47  PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V+V           DK     +   G    L S  +  E +   +         IS+
Sbjct: 65  GLGVSVSDVAHVRDIFLDKSYRQENGRKGFYSTLYSTTSYVEDIMQ-EMNGAEFKESISE 123

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
           L  + + Y K+ +       +I  +E  +   NT   ++QK +++ + +I+ ++  +   
Sbjct: 124 LWQAFQEYGKDPTNSTKQNLIIQKSELFLTRCNTVYSDLQKYQSNINLQIKDQVDRINEI 183

Query: 167 LSELTVVNDAIKFKTASK-HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             ++  +N  I+   +     A    D RD L+ +++    I     +   + +      
Sbjct: 184 GDKIYALNLEIQKTESGGVETAMTARDARDSLIDELAGYAKIEAEEDSTGYVRIKLEGQQ 243

Query: 226 TLFETVPRDINFEK----------MNSYTVTSESNPIFID-------------GVVVSSN 262
            + +     I   +              T      P+F D                 +  
Sbjct: 244 FVQDNKCNHIGLTEEKGTGFYTPYWPHITTQESYMPVFSDVALPSALAERVGCTQTTNIA 303

Query: 263 QGSAVPKGKIKALLQIR-------------------DSVVPIFQNQLDEMARVLIGSFSE 303
                  G +KALL  R                   D+VV   Q ++  +AR ++ + ++
Sbjct: 304 TSLNNDIGSLKALLVSRGSEYGTYDFMSEENYSRVEDNVVMETQAEISYLARNIMMAMND 363

Query: 304 ----------------------KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN 341
                                    +  +    P    A    D   ++     +    N
Sbjct: 364 IFCPNTTYTAADGTTYTVLDTANCSVGADGSLPPHELFAREGYDRYTQMEIDGKQFYVYN 423

Query: 342 PQYRSNPSFLRDGGSVSKKFLWNV-----KNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
            + ++N S     G+VS             +            D   K +  + +     
Sbjct: 424 DETKANNSSWYKLGNVSVNPKLAAQVTLMPSYKQDGSANYGLADQITKAWSAENLYINPK 483

Query: 397 NVT---LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIK 453
           + +      Y    I  L  N S               I    +  +GV+  EEL+ +IK
Sbjct: 484 DTSKCNFEGYYDKIISHLGTNGSIYKASSDTMTSTAAAIDNQRNQIMGVSSDEELTNMIK 543

Query: 454 VEQSYNISNKLIMFTDKMLQTLLEGV 479
            + +YN S++ I    +M + +++ +
Sbjct: 544 YQSAYNASSRFITVISQMTELIVQLI 569


>gi|118589965|ref|ZP_01547369.1| flagellar hook-associated protein K [Stappia aggregata IAM 12614]
 gi|118437462|gb|EAV44099.1| flagellar hook-associated protein K [Stappia aggregata IAM 12614]
          Length = 454

 Score =  175 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 123/443 (27%), Positives = 209/443 (47%), Gaps = 10/443 (2%)

Query: 48  ENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKL 107
             + V        +     L + +S    Q  + +        + D     S    +  L
Sbjct: 12  GGLKVDGIGRVTDSALYSSLLSSTSTGSSQEAVLAGLIRLAETTGDTQNQMSAAAKLGAL 71

Query: 108 RDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFL 167
           + SL+SY+ + S  I  + V+  ++++V+   + +  VQ +R  AD ++   +  +   L
Sbjct: 72  KLSLQSYASDPSNAIQAQDVLQASKDMVRTLQSGSELVQDVRTKADADMATSVREINTLL 131

Query: 168 SELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL 227
            +L  +N  I   T S  D  D  D RD +L K+SE IGI+T+ R+N D+VVYT  G TL
Sbjct: 132 KQLEDLNSVIVRGTQSGADVTDAHDSRDQVLLKLSEEIGITTLNRSNGDIVVYTDSGVTL 191

Query: 228 FETVPRDINFEKMNSYTVTSESNPIFIDGVVV-SSNQGSAVPKGKIKALLQIRDSVVPIF 286
           FET  R + FE    Y   +  N + +D V V        +  G+++ L ++RD V   +
Sbjct: 192 FETKARSVTFEPTIVYGAATTGNSVMVDDVPVAGPGALMEIKSGRLQGLAELRDEVAVTY 251

Query: 287 QNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC------QGISETICV 340
           Q+QLDE+AR LI +F+E D   G + +  GLF   G   +             I+     
Sbjct: 252 QSQLDEIARGLIEAFAESDQSGGGNPDQAGLFTWSGAPAVPASGTLVTGLAAEIAVNANA 311

Query: 341 NPQYRSNPSFLRDGGSV---SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTN 397
           +P    +   LRDGG        + +N    AG+ D +     +F+K+ +FD    ++  
Sbjct: 312 DPDQGGDLDRLRDGGISDPLDPNYNYNPSGAAGFSDRLQELVSAFDKDTVFDSGVELDAT 371

Query: 398 VTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQS 457
            +L  +A +S+ WLE  R           V+ +  +E+ +N  GVN+ EE++ L+++E+S
Sbjct: 372 DSLSGFAASSVSWLEAGRKTMTSNVEVQTVILSRTAENLNNKTGVNIDEEMTLLLEIERS 431

Query: 458 YNISNKLIMFTDKMLQTLLEGVK 480
           Y+ + +LI   D ML+ LL   +
Sbjct: 432 YSAATRLISAVDAMLEDLLAAAR 454


>gi|331645424|ref|ZP_08346528.1| flagellar hook-associated protein FlgK [Escherichia coli M605]
 gi|59889786|emb|CAH19142.1| Lateral flagellar hook associated protein 1 (FlgK-like)
           [Escherichia coli]
 gi|284920050|emb|CBG33107.1| lateral flagellar hook associated protein 1 (FlgK-like)
           [Escherichia coli 042]
 gi|331045586|gb|EGI17712.1| flagellar hook-associated protein FlgK [Escherichia coli M605]
          Length = 458

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 160/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|327254560|gb|EGE66176.1| flagellar hook-associated protein FlgK [Escherichia coli STEC_7v]
          Length = 458

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 155/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYNTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLQNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMTLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                                +    +           G   +VT+ +   + I  +   
Sbjct: 349 ----------------DESGNSDNLQALINISTEPLEIGNLGSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 TQQNQTEVTAASNVYSEAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|296445195|ref|ZP_06887155.1| flagellar hook-associated protein FlgK [Methylosinus trichosporium
           OB3b]
 gi|296257369|gb|EFH04436.1| flagellar hook-associated protein FlgK [Methylosinus trichosporium
           OB3b]
          Length = 495

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 149/495 (30%), Positives = 234/495 (47%), Gaps = 16/495 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSEN 59
           MSL      A       S Q + + RNI  A    Y  + ++ + +    V V       
Sbjct: 1   MSLSNAGAIANQSLGAISSQISLVSRNIAGASTTGYAAKTSLLSTNASGGVDVNGVARAT 60

Query: 60  K-NMFDKVLHAHSSAIGQQRLLQSFEALKEMMS------ADDHYNNSPTHYISKLRDSLE 112
              +F   L A S       L    + L ++         D   + SP   ++ L  +L+
Sbjct: 61  SLALFQNALQATSGQAASSALSSGLDQLDQLYGLSTSTATDTSSSRSPAALVAALSSALQ 120

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           SYS + S+    ++V+  A+ + Q+ N  +  VQ +RA AD +I   + ++   L +   
Sbjct: 121 SYSASPSDLTTAQSVLTAAQSLAQSLNDGSTAVQNMRAQADGDIATAVDDINSLLGQFQK 180

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVP 232
            N AI   T +  D     DQRD LL K+S  IG+ TI R NNDMV+YT  G TLFET  
Sbjct: 181 ANAAIVSGTQTGRDVSALEDQRDELLNKLSADIGVRTITRANNDMVIYTDSGATLFETTA 240

Query: 233 RDINFEKMNSYTVTSESNPIFIDGVVVSS-NQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
           R+++F     Y+ ++  + +++DGV V+  +    +  GK++ L Q+RD V P FQNQLD
Sbjct: 241 RNVSFTATAGYSASTVGSSVYVDGVPVTGADAAMPIQSGKLQGLTQLRDVVAPQFQNQLD 300

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLF----IADGIKDLDNKLCQGISETICVNPQYRSN 347
           E+AR LI SF+E D   G +                  +   L   I+     +P    +
Sbjct: 301 ELARGLIVSFAETDQTGGGASAPGLFTYSDATDVPSVGIIPGLAGQITVNANADPTKGGS 360

Query: 348 PSFLRDGGS---VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYA 404
              LRDGG     +  F +N    AGY D IN    + +    FD  AG+ TN ++ +YA
Sbjct: 361 LDRLRDGGISDPGNSAFDYNATGDAGYTDRINQLITALSTPQDFDTTAGVGTNQSVADYA 420

Query: 405 RNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKL 464
            +SIGWLE  R  +       + + +  S++ SN  GVNL +++S ++ +E +Y+ S KL
Sbjct: 421 SSSIGWLEAQRQQASSSASYQETLVSQTSQALSNATGVNLDDQMSQMLDLENAYSASAKL 480

Query: 465 IMFTDKMLQTLLEGV 479
           +   D M + L + +
Sbjct: 481 LAAVDAMYKALFQAL 495


>gi|315125990|ref|YP_004067993.1| lateral flagellar hook-associated protein [Pseudoalteromonas sp.
           SM9913]
 gi|315014504|gb|ADT67842.1| lateral flagellar hook-associated protein [Pseudoalteromonas sp.
           SM9913]
          Length = 435

 Score =  174 bits (441), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 82/481 (17%), Positives = 164/481 (34%), Gaps = 50/481 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISP---ENVTVVTQRS 57
           MS+    N A +  N A+       +N+ NA  + Y R+      S      V V +   
Sbjct: 1   MSM---LNNALSGLNAANIALTVSGQNVANAAVEGYSRQQAQFKTSNVYLGGVEVASVDR 57

Query: 58  ENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKN 117
                 +  +   +S        QS+    E +   D  N    + ++ L D+L + +  
Sbjct: 58  VVDAFLNDDIWRTNSDTTYYENKQSYLGFIEQIIGTDSLN--LNNSLASLTDALNAAATK 115

Query: 118 LSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAI 177
                  +  + +AE  +Q+       +       + ++     N+     ++  +N +I
Sbjct: 116 PDSQAFRQQFLSSAEGFMQDIAQINGALAGQATKLNAQMSNVALNVSSITKQIAEINSSI 175

Query: 178 KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF 237
              TA+K    +  D R+ L+ ++S  IG+S + R+N  + + T  G  L          
Sbjct: 176 GLATANKQSTAELKDNRERLVNQLSGHIGVSIVERDNGFIDISTLSGAPLVVGSKAASIS 235

Query: 238 EKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
               + T         +D              G+   L+ + + V+      L+ +   L
Sbjct: 236 VNGTTVTSNFIGQEFTLD----------KNVGGQFGGLISVDNDVIKPTLATLNSLVADL 285

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSV 357
               +       +  N PG  +                 TI +NP   ++    +D  + 
Sbjct: 286 ADDMNGALQSGFDLNNDPGEALFTYNPLNP-------LGTIEINPAITTDKLGFKDSSTS 338

Query: 358 SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSD 417
                 N+ N+                      +AG     TL       +G L      
Sbjct: 339 GPGDNSNIANIVA-------------------SMAGKGDKFTL------LVGDLAITSKQ 373

Query: 418 SHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           + +    +  +  +   +  +  GVNL EE + L+  +Q Y+ + K+I   D+M ++LL+
Sbjct: 374 NLNSITTATNLSENAIAARDSYSGVNLDEEAANLMHFQQMYSANAKVISTADQMFKSLLQ 433

Query: 478 G 478
            
Sbjct: 434 M 434


>gi|238922533|ref|YP_002936046.1| flagellar hook-associated protein FlgK [Eubacterium rectale ATCC
           33656]
 gi|238874205|gb|ACR73912.1| flagellar hook-associated protein FlgK [Eubacterium rectale ATCC
           33656]
 gi|291526373|emb|CBK91960.1| flagellar hook-associated protein FlgK [Eubacterium rectale DSM
           17629]
          Length = 569

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 82/566 (14%), Positives = 170/566 (30%), Gaps = 91/566 (16%)

Query: 4   LAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI-----------------S 46
              F    +   N+     +   N+ N +   YVR+    +                  S
Sbjct: 5   FGSFYVGSSGLKNSQNALNTTANNMANVNTTGYVRQQVRFSDKHYITRNNPTAGTNIQQS 64

Query: 47  PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISK 106
              V+V           DK     +   G    L S  +  E +   +         IS+
Sbjct: 65  GLGVSVSDVAHVRDIFLDKSYRQENGRKGFYSTLYSTTSYVEDIMQ-EMNGAEFKESISE 123

Query: 107 LRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRF 166
           L  + + Y K+ +       +I  +E  +   NT   ++QK +++ + +I+ ++  +   
Sbjct: 124 LWQAFQEYGKDPTNSTNQNLIIQKSELFLTRCNTVYSDLQKYQSNINLQIKDQVDRINEI 183

Query: 167 LSELTVVNDAIKFKTASK-HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             ++  +N  I+   +     A    D RD L+ +++    I     +   + +      
Sbjct: 184 GDKIYALNLEIQKTESGGVETAMTARDARDSLIDELAGYAKIEAEEDSTGYVRIKLEGQQ 243

Query: 226 TLFETVPRDINFEK----------MNSYTVTSESNPIFID-------------GVVVSSN 262
            + +     I   +              T      P+F D                 +  
Sbjct: 244 FVQDNKCNHIGLTEEKGTGFYTPYWPHITTQESYMPVFSDVALPSALAERVGCTQTTNIA 303

Query: 263 QGSAVPKGKIKALLQIR-------------------DSVVPIFQNQLDEMARVLIGSFSE 303
                  G +KALL  R                   D+VV   Q ++  +AR ++ + ++
Sbjct: 304 TSLNNDIGSLKALLVSRGSEYGTYDFMSEENYSRVEDNVVMETQAEISYLARNIMMAMND 363

Query: 304 ----------------------KDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN 341
                                    +  +    P    A    D   ++     +    N
Sbjct: 364 IFCPNTTYTAADGTTYTVLDTANCSVGADGSLPPHELFAREGYDRYTQMEIDGKQFYVYN 423

Query: 342 PQYRSNPSFLRDGGSVSKKFLWNV-----KNLAGYPDLINHYCDSFNKNFIFDPVAGINT 396
            + ++N S     G+VS             +            D   K +  + +     
Sbjct: 424 DETKANNSSWYKLGNVSVNPKLAAQVTLMPSYKQDGSANYGLADQITKAWSAENLYINPK 483

Query: 397 NVT---LLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIK 453
           + +      Y    I  L  N S               I    +  +GV+  EEL+ +IK
Sbjct: 484 DTSKCNFEGYYDKIISHLGTNGSIYKASSDTMTSTAAAIDNQRNQIMGVSSDEELTNMIK 543

Query: 454 VEQSYNISNKLIMFTDKMLQTLLEGV 479
            + +YN S++ I    +M + +++ +
Sbjct: 544 YQSAYNASSRFITVISQMTELIVQLI 569


>gi|323171070|gb|EFZ56719.1| flagellar hook-associated protein FlgK [Escherichia coli LT-68]
          Length = 458

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +               + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPNITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|327192295|gb|EGE59260.1| flagellar hook-associated protein FlgK [Rhizobium etli CNPAF512]
          Length = 486

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 158/485 (32%), Positives = 259/485 (53%), Gaps = 8/485 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N  Q+I N   QQ + I  NI N  N +YVRR+   T S     VV+     +
Sbjct: 1   MSLTSALNSVQSIFNTTGQQSSVISTNIANVGNSDYVRREASITTSLSGAQVVSISRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     ++    Q+ L +     + +   + Y  SP+ Y+S  + +L++++ + S 
Sbjct: 61  TALLAQYLQSNAKDSAQQTLVTGLESLKSLVGGNDYETSPSTYLSAFQQALQTFATSPSS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
               ++ +  A+++  + NT++  VQ IR +AD EI  ++S+L   LS+    N+A+K  
Sbjct: 121 TTSAQSAVTAAQDLANSLNTASDGVQSIRTEADAEIATQVSSLNTLLSQFETANNAVKLA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  D    LD+R+ LL++IS I+G++++VR+NNDM +YTSDGT LFETVPR + F   
Sbjct: 181 TATGADTSSALDEREKLLKQISSIVGVTSVVRDNNDMALYTSDGTVLFETVPRTVTFVPT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ+QLD++A+ L+ 
Sbjct: 241 TTYVAGTEGNAIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQDQLDQIAKALVQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLD------NKLCQGISETICVNPQYRSNPSFLRD 353
            FSE D              +    +          +   IS  + V      + + LRD
Sbjct: 301 VFSETDGSTSAPGLFVWTTASGTAGETPSESDDITGIASTISVNLAVVTSEGGDATKLRD 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
            G++S     N    +G+ D ++    +  +   F   AG++++ +L +YA  SIGWLE+
Sbjct: 361 -GTISGITDLNTSGDSGFSDNLDALYTALTEQRTFSADAGLSSSQSLTDYASASIGWLEQ 419

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   D+M Q
Sbjct: 420 YRSDATSASETTAAALSRSDEAYSNEAGVNLDEELTLLLDIEQSYKAATKILNVIDEMFQ 479

Query: 474 TLLEG 478
           +LL+ 
Sbjct: 480 SLLDI 484


>gi|88799029|ref|ZP_01114610.1| Flagellar hook-associated protein [Reinekea sp. MED297]
 gi|88778256|gb|EAR09450.1| Flagellar hook-associated protein [Reinekea sp. MED297]
          Length = 1025

 Score =  174 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 53/383 (13%), Positives = 118/383 (30%), Gaps = 21/383 (5%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           MSL    + A            +   NI NA+   Y R++ +   +           + V
Sbjct: 1   MSL---LSTAITGIKAHQTALETTGHNISNANTPGYSRQEAVMATNNPLFRGVGYIGQGV 57

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            + T R          L   +S     +  +      + + ADD         + +   +
Sbjct: 58  NISTVRRVTDEFLTIQLRQDTSTFHDLQTYRESIEQVDRILADDA--TGLQPQLDRYFAA 115

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           L+  + N +       V+  A+ +V  F T +R +Q I +  + +++     +      +
Sbjct: 116 LQGAADNPAYIPSRDVVLGEAQGLVDRFETISRYLQDINSTLNGQLKTSTEQVNAIAKGI 175

Query: 171 TVVNDAIKFK--TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +N+ I      A+    +D  D+RD L++++SE++ +  +        +   +G  L 
Sbjct: 176 AELNEEIVTARGDAAAQPPNDLYDKRDELVRQLSELVEVDVVKVGETY-NIAIGNGQPLV 234

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                +      +                  + +    +  G I   L+ R   + +  N
Sbjct: 235 LKYDANRLEATPSLEDPNRYGIRYT--SKTENLDITDNITGGSIGGRLEFRSEALDLAVN 292

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIAD-GIKDLDNKLCQGISETICVNPQYRSN 347
            L  +A   +   + +     + E   G                     T         N
Sbjct: 293 SLGRLAVAFVQETNAQHKQGIDLEGRFGNDFFRDMNDPSLTGDRVYAYGTNKPPNDRVFN 352

Query: 348 PSFLRDGGSVSKKFLWNVKNLAG 370
            +F       + ++  N+     
Sbjct: 353 VTFENTKELTTSEYTLNLPGPDA 375



 Score = 97.4 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 55/448 (12%), Positives = 116/448 (25%), Gaps = 16/448 (3%)

Query: 34   KNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSAD 93
              Y             V  VT R+  +        ++S+             ++  ++  
Sbjct: 590  TGYGASAYEIAEELNLVEGVTARAYTEVQLSNF--SNSTDTSGAPTYNPHNPMEVWVNGF 647

Query: 94   DHYNNSPTHYISKLRDSLESYS---KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA 150
            +     P    +   D          N +            +++     +    +     
Sbjct: 648  ELTQEIPNQNQNIYMDGFPVEVPEEMNPNFLADRINHHYELQQLGITAKSDGETLTITDE 707

Query: 151  DADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI 210
            + +  +     +         V++ A         +  D++D  D       E   +   
Sbjct: 708  NGNDILVEMRGD-----KPQPVISGAPVLPPGIPGNVTDYIDPGDTFEISTGESWSVDPF 762

Query: 211  VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
               N +  +   +G    E  P        +  T T   + I+ DG  V +         
Sbjct: 763  E-GNTNGQLSNLNGYDFSEGGPYRYEMYLPDGRTGTVRLDGIYADGDAVKAAFEEQ---- 817

Query: 271  KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
             I+A L            Q +   +V +                  + +           
Sbjct: 818  -IQAQLDSPGRAEVDIDEQGNVSYKVFMRVEGTGTQAVSRVNVGGQVDVVMADGIRLETD 876

Query: 331  CQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP 390
             +       V     S   F    G   +                N            D 
Sbjct: 877  PEVGGIFNGVPDARSSYMGFQFQVGGRPEAGDEFTIEWNDAGVSDNRNALDLVGLETTDT 936

Query: 391  VAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSF 450
            +  I+  +T  E    ++  +    S +      S+ V         +  GVNL EE + 
Sbjct: 937  INDIDGGMTFTESYSQTVEQIGTLTSQAQIRSDASRAVLEGTQSEVDSVQGVNLDEEAAR 996

Query: 451  LIKVEQSYNISNKLIMFTDKMLQTLLEG 478
            LI+ + +YN + K+I    ++  ++L  
Sbjct: 997  LIEFQVAYNANAKVIAVAQELFDSILAA 1024


>gi|269796409|ref|YP_003315864.1| flagellar hook-associated protein FlgK [Sanguibacter keddieii DSM
           10542]
 gi|269098594|gb|ACZ23030.1| flagellar hook-associated protein FlgK [Sanguibacter keddieii DSM
           10542]
          Length = 475

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/499 (13%), Positives = 148/499 (29%), Gaps = 53/499 (10%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-------------- 46
           MS  +  + A +      Q      +N+ N +   Y R+                     
Sbjct: 1   MSTFSGLSTALSSLITQRQALEVAGQNLANINTPGYTRQRVDMQSVSAGQGATMFSQGNQ 60

Query: 47  -PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
               V  V          D  +   SS+              E   A +   N  +  + 
Sbjct: 61  VGNGVQAVGVARLGDIFMDARVRTTSSSAAYLAARTDAFKRLESTIA-EPGANGISADLD 119

Query: 106 KLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRR 165
           KL  S      + + D +G  +++N+  V ++ +T    V         + E  +S++  
Sbjct: 120 KLWASWSDVVNSPTSDAVGAVLLENSAAVQRSISTGYTAVVTQWDQTRSKAESLVSDVNS 179

Query: 166 FLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGT 225
             + + ++N+ I+  T S  +A++ +DQR+VL   +S + G +  ++ N    V    G 
Sbjct: 180 AAASVALLNEQIQQITVSGGNANELIDQRNVLTTALSSLAGATVRLQPNGTADVNI-GGN 238

Query: 226 TLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQI------- 278
            +             +   V +  N + ++     +   + +  G++  +L +       
Sbjct: 239 PIVSGSSAQKLKLVGSREMVGATGNEVRVEWDRTPAGTPAPLEGGQLAGVLSVLAPASGG 298

Query: 279 RDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETI 338
              ++       + +A  L  S +       +     G+       D             
Sbjct: 299 AGGMLAEAAESYNVLATKLATSVNTLHSAGADRAGTTGVDFYSLPTDGT----------- 347

Query: 339 CVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNV 398
              P        +     ++ +   N  N     D I     S +               
Sbjct: 348 ---PAALGLRVAITSPSQIAVRNPANGANDTSVADAIGQLGASKDGPDTV---------- 394

Query: 399 TLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSY 458
                    +         +      ++               V+  EE   ++  +++Y
Sbjct: 395 -----WSTFVVSTGVKAKAALQSATVAEAARQTAEGLQLAQTSVDQDEESINMLSFQRAY 449

Query: 459 NISNKLIMFTDKMLQTLLE 477
             + +++   D+ML  L+ 
Sbjct: 450 QGAARVMTAVDEMLDQLIN 468


>gi|323976263|gb|EGB71356.1| flagellar hook protein FlgK [Escherichia coli TW10509]
          Length = 458

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 160/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYNTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLQNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMTLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 TQQNQTEVTAASNVYSEAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|83716869|ref|YP_438395.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           E264]
 gi|167614843|ref|ZP_02383478.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           Bt4]
 gi|257141428|ref|ZP_05589690.1| flagellar hook-associated protein FlgK [Burkholderia thailandensis
           E264]
 gi|83650694|gb|ABC34758.1| flagellar hook-associated protein 1, putative [Burkholderia
           thailandensis E264]
          Length = 452

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 67/479 (13%), Positives = 151/479 (31%), Gaps = 32/479 (6%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-PENVTVVTQRSENKNMF 63
            +     +    A+Q   +  +N  N     Y RR  + +      V        N++  
Sbjct: 2   NIIYIGMSGIRAANQSLLAASQNTANIATGGYSRRGVLLSTGLTGGVDASGLLRLNESYK 61

Query: 64  DKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNN---SPTHYISKLRDSLESYSKNLSE 120
            + L   +   G+    Q++    E +   +  +    +      K   +LE+ S N  +
Sbjct: 62  TQQLWQTAGQYGRYDAAQTYFDQLEALFGGNPVDGKTKANDLGFGKFIGALEAASGNPGD 121

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
            +L   VID A  + + FN     +       +++    +  +      +  +N  I   
Sbjct: 122 SVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQVNGLAKTVAELNGKIAAG 181

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
            AS  D    +DQRD  +  +S   G+  + + N  + V  ++G  L             
Sbjct: 182 QASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGTVDVSMTNGQPLVVGAQAGRIELGR 241

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
           ++    +    + +     +    +    G++  L +    V+      L  +A      
Sbjct: 242 DA----AGQQTLSLTFGSQTMPLRTGSLGGELLGLAEFEGEVLRPQMEALRTLAVRTAEL 297

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
            +++     +    PG  +                 T             ++        
Sbjct: 298 INDQLTQGFDMNGNPGKPL----------------ITYDAATGLLGIDPDVKPEELGFSG 341

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
              N  + +    LI     S +   I         +V+L       +G +      +  
Sbjct: 342 DPANPGDNSNLLALIEIGSTSIDLPGI--------GDVSLGNAFATMMGKVGAASQQNKQ 393

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
               ++ V       + +  GV+  EE+  +++ +  YN + K+I    ++ +T L  +
Sbjct: 394 AKGAAEAVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL 452


>gi|284007169|emb|CBA72453.1| flagellar hook-associated protein FlgK [Arsenophonus nasoniae]
          Length = 545

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/546 (13%), Positives = 179/546 (32%), Gaps = 74/546 (13%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE-----NVTVVTQ 55
           MS  ++ N A +    A    ++I  NI N+  ++Y R+ T             V V   
Sbjct: 1   MS-SSLMNTAMSGLKVAQTALSTIGSNIANSKVESYHRQTTTLATDGSNNNINGVKVSGI 59

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
           + E     +   +   +  G++++   F    + +      +      +++   SL++ S
Sbjct: 60  QREYDEFINAHYNKAVTEQGERKIYAEFALELDKLM--SASDTDLASSMTEFFTSLQTLS 117

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
            + +   L   VI+ A+ ++  F +  ++   +    +  I      + +   ++  +N 
Sbjct: 118 TDAASAPLRTEVINKAQAMISRFKSVEQQFNTMEQRLNGNIGQMADKVSQLAQQVAKLNG 177

Query: 176 AIKFKTA-SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
            +        +  ++ LD+RD L +++S + GIS I +++    +  ++G +L      +
Sbjct: 178 EMTKIKGLQGYVPNEMLDRRDQLTRELSTVAGISVIRQDDTI-NINLANGLSLVNGTKAN 236

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                 ++      +                ++  G++   L +RD V+   + +++++ 
Sbjct: 237 KITAISSAADPAQITLAYDDGINPPREIDTRSITGGELAGALAVRDEVLQPNRQKINQLG 296

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISET--------------ICV 340
            +L  S ++      + +   G  +    K       Q    +              I  
Sbjct: 297 LILTESINQVQQAGFDLQGNAGQALFQTGKPSIISHNQNQGTSSFATQFTDATQVKGIDY 356

Query: 341 NPQYRSNPSFLRDGGSVS------------------------------------------ 358
              +  N   +    + +                                          
Sbjct: 357 AMMFDGNNWVVTQQSTGASVNVTSTAATANHGKKLTFDGMEIAPTSAPQAGDKFIIKSVD 416

Query: 359 ---KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA-----GINTNVTLLEYARNSIGW 410
                    + N AG            +   I + +A      +N   TL +      G 
Sbjct: 417 EVISGLSVAITNPAGIAAASQAGTGQADNTNIKNLLALQDKKLVNGTSTLSKAYTAVAGD 476

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    + +        V+     +   +  GVNL EE   + ++++ Y  + K+I   + 
Sbjct: 477 VASKANQAKADFTAQSVITKSYLQKQQSVSGVNLDEEYLEMSRMQEFYMSNAKVIQTANS 536

Query: 471 MLQTLL 476
           + +TL+
Sbjct: 537 LFETLM 542


>gi|297618069|ref|YP_003703228.1| flagellar hook-associated protein FlgK [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145906|gb|ADI02663.1| flagellar hook-associated protein FlgK [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 618

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 57/439 (12%), Positives = 139/439 (31%), Gaps = 39/439 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S+       +               N+ NA+ + Y R+  +   +               
Sbjct: 3   SMFLGLEIGRRAIMTQQTALDVTGHNVANANTEGYSRQVAVMVTTPAYHSPALTQNLSVG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   R       D  +   ++  G  + LQ+     E +  ++  +      +
Sbjct: 63  QIGTGVKVSEIRRLRDGFVDMQVRDETNTTGYWQALQTALDKIEAV-INEPSDEGLRGVL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                + +  S++   + + + V      V   F+    ++Q++R D + +++ ++  L 
Sbjct: 122 DNFWQAWQDLSESPENESVRQVVAQRGMAVADTFHHIYNQLQELREDLNSQVKAKVDELN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            + +++  +N  I+  T +  + +D  D+RD+LL ++++I+    +   +  + V     
Sbjct: 182 SYATQIADLNLQIQAITIAGKEPNDLKDRRDLLLDQLAKIVDAKIVYELDGMVTVMVGGT 241

Query: 225 TTLFETVPRDINFE---------KMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKAL 275
             +       +              +          I  D           +  G++  L
Sbjct: 242 PLVQGITTMKVGLNADTNGIYKVVWDPDPSGHPGTSITGDPADDPGYTELHLKSGELLGL 301

Query: 276 LQIRD-----------SVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIK 324
           L+ R            ++VP   N+L+ MA+ ++ + +       +  N           
Sbjct: 302 LEARGPADHSTLGSERNLVPDLMNRLNLMAKTVVMTTNALHRAGYSLNNTTPYPDGLDFF 361

Query: 325 DLDNKLCQGISE-TICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFN 383
              N+         I V  +  S+P  +    + +     N  N     + +        
Sbjct: 362 KQANEDSITEWAKYIQVADEIVSDPKNIAAALNRTSDDTGNPVNFGDGANALKIAQLKHT 421

Query: 384 KNFIFDPVAGINTNVTLLE 402
            N      A    +VT  +
Sbjct: 422 LNRNEYWTASDEIDVTFPD 440



 Score = 98.6 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/251 (11%), Positives = 71/251 (28%), Gaps = 2/251 (0%)

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
              + +  +   Y   ++        +  + N+ S      +          +   ++ L
Sbjct: 363 QANEDSITEWAKYIQVADEIVSDPKNIAAALNRTSDDTGNPVNFGDGANALKIAQLKHTL 422

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           +           +                  G+                       +   
Sbjct: 423 NRNEYWTASDEIDVTFPDSTQFQGNFTVRYGGVDYEITMSAPAEPYQDFQEVVNAISGQL 482

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVA--GINTNVTLLEYARNSI 408
              G +V  +            D              F  VA   +   VT+ +Y R+ +
Sbjct: 483 EAMGLNVGVRAEGKRLVFYSSSDQFQGVTGGTFPASGFSNVAARTMIQQVTVDDYWRSQV 542

Query: 409 GWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFT 468
             +     ++  +    +V+ + +      T GV+L EE+  +IK + +YN + + I   
Sbjct: 543 SSVGVISQEATRMVENQEVLLDQLEAKRQATSGVSLDEEMVNMIKFQHAYNAAARYITVI 602

Query: 469 DKMLQTLLEGV 479
           D+ +  ++  +
Sbjct: 603 DEAVDVIVNRM 613


>gi|256020234|ref|ZP_05434099.1| flagellar hook-associated protein FlgK [Shigella sp. D9]
 gi|300817263|ref|ZP_07097481.1| flagellar hook-associated protein FlgK [Escherichia coli MS 107-1]
 gi|332281396|ref|ZP_08393809.1| lateral flagellar hook associated protein 1 [Shigella sp. D9]
 gi|300530239|gb|EFK51301.1| flagellar hook-associated protein FlgK [Escherichia coli MS 107-1]
 gi|332103748|gb|EGJ07094.1| lateral flagellar hook associated protein 1 [Shigella sp. D9]
          Length = 458

 Score =  173 bits (438), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 160/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTSTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|146311252|ref|YP_001176326.1| flagellar hook-associated protein FlgK [Enterobacter sp. 638]
 gi|145318128|gb|ABP60275.1| flagellar hook-associated protein FlgK [Enterobacter sp. 638]
          Length = 546

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 75/547 (13%), Positives = 166/547 (30%), Gaps = 73/547 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  + A     ++  NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINSAMSGLSAAQASLNTVSNNISSYNVAGYTRQTTVLGAANSTLTGGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            A  + + +D     S +  +     SL+
Sbjct: 61  NGVQREYDAFITNQLRAAQNQSSGLTTRYQQMAKIDDVLSDTT--KSLSTTLQGFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    +TV+  A+ +V  F  + + ++      +  I   +  +  + +++  
Sbjct: 119 TLVSNAEDPAARQTVLGKADGLVNQFKVTDQYLRDQDKQVNTAIATSVDQINSYATQIAT 178

Query: 173 VNDAIKFKT--ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     V   +G TL + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVDVSVQDGGTYNVSFGNGYTLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     ++      +                A+  G +  L+  R+  +   +N L
Sbjct: 239 SSVTKLAAMPSNADPARMTVAYVDPAAGNVEIPDKALNTGSLGGLITFRNEDLDKTRNNL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL-------------------- 330
           ++MA     S +++     ++ +  G  +         +                     
Sbjct: 299 NQMALAFADSMNQQHEKGFDANHDAGGKLFSFGTPSVMENGKNTGSATVTATIDDSSKVQ 358

Query: 331 ----------CQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD 380
                            +     + + P    D      K   +         ++    D
Sbjct: 359 ATDYKLEYNGSDWTVTRLSDKTTFTATPDASGDMTFDGVKINVSGAAANKDSFVVKPVVD 418

Query: 381 SFNK-----------NFIFDPVAGINTN---------------VTLLEYARNSIGWLEKN 414
           +                  D  AG + N                    Y       +   
Sbjct: 419 TIVNMELLIKDESKLAMASDATAGESDNRNGKALLALQSTKTVGGNKSYNDAYAALVSSV 478

Query: 415 RSDSHDLHMKS---QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKM 471
            S +  L   S     V   +S    +  GVNL EE   L + +Q Y  + +++     +
Sbjct: 479 GSQTAALKTSSATKTNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTASTL 538

Query: 472 LQTLLEG 478
              ++  
Sbjct: 539 FDAIINI 545


>gi|324113877|gb|EGC07851.1| flagellar hook protein FlgK [Escherichia fergusonii B253]
          Length = 548

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 70/549 (12%), Positives = 161/549 (29%), Gaps = 75/549 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  + A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLSAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + + + +   N+ +  +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTTRYEQMSKIDNLLSSET--NNVSTSLQGFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  A+ +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKADGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKT--ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    +D LDQRD L+ ++++++G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNDLLDQRDQLVSELNKVVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +       +                 +  G +  +L  R   +   +N L
Sbjct: 239 SSARQLAAVPSHADPFRVTVAYVDATAGEIEIPEKLLTSGTLGGMLTFRSQDLDQSRNTL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
            ++A     +F+++     ++    G       K L     Q  S+          +   
Sbjct: 299 GQLALAFADAFNKQHQAGFDATGAKGEDFFAIGKPLVLSNTQNNSDAAIKAEVINGSQVL 358

Query: 351 LRDGGSV-SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
             D          W V  LA           + N  F    +    T      +    + 
Sbjct: 359 ATDYTITWQGAGKWQVTRLASNTSFTIEPDAAGNVEFDGLKLTFSGTPKDNNSFTLKPVS 418

Query: 410 WL---------------------------------------EKNRSDSHDLHMKSQVVFN 430
                                                     K    +   +     + +
Sbjct: 419 DAVVNMDVKVKDESQIALAQEAGAGDSDNRNGQKLLDLQSNGKTVGGAKSFNDAYATLVS 478

Query: 431 HI---------------------SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +                     S    +  GVNL EE   L + +Q Y  + +++   +
Sbjct: 479 DVGNKTATLKTSSTTQNNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTAN 538

Query: 470 KMLQTLLEG 478
            +   L+  
Sbjct: 539 TLFDALINI 547


>gi|306813297|ref|ZP_07447490.1| flagellar hook-associated protein FlgK [Escherichia coli NC101]
 gi|305854060|gb|EFM54499.1| flagellar hook-associated protein FlgK [Escherichia coli NC101]
          Length = 458

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQEYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTASMTLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|114706627|ref|ZP_01439528.1| flagellar hook-associated protein K [Fulvimarina pelagi HTCC2506]
 gi|114538019|gb|EAU41142.1| flagellar hook-associated protein K [Fulvimarina pelagi HTCC2506]
          Length = 469

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 128/488 (26%), Positives = 221/488 (45%), Gaps = 30/488 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT-TISPENVTVVTQRSEN 59
           MSLL+VFN A++  +  SQQ A + RN+ NAD+    R+     +     V +      +
Sbjct: 1   MSLLSVFNNARSSLSVTSQQSALVARNVANADDPTATRKYASQVSERLGAVDIRAISQSS 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                + L +  +++G    L         +  D   + SP+  I+ L+D+L   + +  
Sbjct: 61  DPALYRSLISAQASLGTNETLAEALDRVRDVIGDVDASTSPSASIAALKDALTDLAASPE 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
              L +T +D A  +  N N +   VQ +RADAD+E++     L   LS+L  +N  +  
Sbjct: 121 NSQLQRTAVDAARSLATNLNNATMSVQTMRADADRELDEGAKRLNELLSQLETLNSKVVA 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
            TA+  D  D +DQRD ++ +IS  +G+S  +R NND+V+ T  G  +FET  R + F +
Sbjct: 181 GTATGADVTDEVDQRDRIVSEISSYVGVSVRLRANNDLVLSTDSGIVMFETRARSVEFTR 240

Query: 240 MNSYTVTSESNPIF---------IDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
             S+  +   +            IDGV +      AV  G + A L++RD V   FQN+L
Sbjct: 241 TQSFDPSIRLDSAVAANRPGEFKIDGVSIGGTSSMAVRDGSLVAALKLRDEVGVEFQNRL 300

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           D+    L+     ++   G  E                     I+    V+ +   NP+ 
Sbjct: 301 DQTGDTLVNETFAENGAPGLYE---------------RTGPATIAIAASVDYRIGGNPAL 345

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           +RD G ++    +N    +G+ D +N     F+    F          TL ++  +S+ W
Sbjct: 346 IRD-GGINGSPTFNTAGESGFADRLNALVARFSDQHTFANGEL----GTLGDFTASSMAW 400

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
            E  R+ +        ++     ++ SN  G+NL +E+S L+++E++Y  S KL+    +
Sbjct: 401 FEGRRATASKDASYQSIMVTRARDTLSNKTGINLDDEMSHLLELERTYQASTKLVQTVGE 460

Query: 471 MLQTLLEG 478
           +L  LL  
Sbjct: 461 LLDRLLAI 468


>gi|281412143|ref|YP_003346222.1| flagellar hook-associated protein FlgK [Thermotoga naphthophila
           RKU-10]
 gi|281373246|gb|ADA66808.1| flagellar hook-associated protein FlgK [Thermotoga naphthophila
           RKU-10]
          Length = 858

 Score =  173 bits (437), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 59/446 (13%), Positives = 134/446 (30%), Gaps = 30/446 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS+  + N A    +        +  NI NA    Y R+  +                  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNVVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPSFP 63

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                   V T         D      ++       + S     E + A +   +     
Sbjct: 64  LQMGTGAKVKTIVRLRDAFLDVQYRQVNNRYNYWDTVLSNLHFIEQLLA-EPGEDGIRSL 122

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +    ++ +    + S       V+  A+++V         ++++R D D EI   +S +
Sbjct: 123 VDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDDEIVQRVSEI 182

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            + +  L  +N+ I+         +D LD+RD +L ++S +  I+     +  + +   +
Sbjct: 183 NQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQITLRIGN 242

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              L  +  R++   +          + +F+    +          GK+KAL+ +RDS +
Sbjct: 243 QIVLNGSTYREL---RALERPYGKGYHELFVGNSQLIL------SDGKLKALMDLRDSSI 293

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
             +  +LDE    +  S +        S  V          +  +              +
Sbjct: 294 VKYMRKLDEFVLFITDSLNLVHRDGFESNGVTTNLNFFKKIEAFSDDPSIFRIKGSRKLE 353

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
                +      + S+  +   +  +    ++  +    +          I   V     
Sbjct: 354 MGPYHTVTGIHSASSQVEIEGRRFNSDD--IVLSFGGGSSNVLNVSAGTTIGDLVGSWNL 411

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVF 429
              S+  +  +          S    
Sbjct: 412 LGTSL-KVGTHAGGYRLYLEDSTGSL 436



 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/436 (14%), Positives = 120/436 (27%), Gaps = 35/436 (8%)

Query: 74  IGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
           +  +    S      +   D                  ES    LS  +    V    E+
Sbjct: 427 LYLEDSTGSLRNRLFLSLGDSLSQMGFDTETKGYITIKESDLSGLSSGVYNINVEYTLED 486

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQ 193
             +   T + ++      ++ E       +         +               D    
Sbjct: 487 GTRQTETISVDLSSGVNLSNIEAS-----INSSSHLRAQIYADPSTGENMLVIVPDEQLS 541

Query: 194 RDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIF 253
            D    K+       T                TL         F+    +T+T  S  I 
Sbjct: 542 FDPSAVKVLSDDDFFTKSNAFVRNYEVLEYKDTLENIFYGQTGFDPTRPFTITINSTDIE 601

Query: 254 IDGVVVSSNQGSAVPKGKIKALLQ---------IRDSVVPIFQNQLDEM--ARVLIGSFS 302
           ID  V +          K   +L           R S +  F  ++ E+   +    +  
Sbjct: 602 IDPAVDTLETLVEKINEKNTGVLADLTPHHSLVFRASSLYDFDLRMMEIKGPQGFFEAVG 661

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKLC---QGISETICVNPQYRSNPSFLRDGGSVSK 359
             DP    +            K  D         +++ +  +      P  + +   VS 
Sbjct: 662 FVDPDGDPNTFDWSSSFTLVSKSDDFTTLSERFKVADILTFDRAPYDEPLNIVNQFEVSS 721

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG----------------INTNVTLLEY 403
               N  NLA          D    +      A                  N   +  E+
Sbjct: 722 SLAANPANLAVDVGYALENSDWNATSIKPSGGANPELLETIQNLYTRKILSNGKESFYEF 781

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
               +  L      + +L   ++++   I  +     GV+L EE++ +IK + +++ + K
Sbjct: 782 FGGVVSELGVEAETASNLKNNTEILRQEIDNAREEVKGVSLDEEMANMIKYQHAFSAAAK 841

Query: 464 LIMFTDKMLQTLLEGV 479
           +I   D+M+QT++  V
Sbjct: 842 VITAVDQMIQTVINMV 857


>gi|300936133|ref|ZP_07151072.1| flagellar hook-associated protein FlgK [Escherichia coli MS 21-1]
 gi|300458711|gb|EFK22204.1| flagellar hook-associated protein FlgK [Escherichia coli MS 21-1]
          Length = 458

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLQNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTASMTLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSEAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|307313513|ref|ZP_07593134.1| flagellar hook-associated protein FlgK [Escherichia coli W]
 gi|306906681|gb|EFN37192.1| flagellar hook-associated protein FlgK [Escherichia coli W]
 gi|315059548|gb|ADT73875.1| flagellar hook-filament junction protein 1 [Escherichia coli W]
 gi|323181553|gb|EFZ66973.1| flagellar hook-associated protein FlgK [Escherichia coli 1357]
 gi|323379893|gb|ADX52161.1| flagellar hook-associated protein FlgK [Escherichia coli KO11]
          Length = 458

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTSTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +               + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPNITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|310816851|ref|YP_003964815.1| flagellar hook-associated protein [Ketogulonicigenium vulgare Y25]
 gi|308755586|gb|ADO43515.1| flagellar hook-associated protein [Ketogulonicigenium vulgare Y25]
          Length = 468

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 102/491 (20%), Positives = 172/491 (35%), Gaps = 36/491 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MSL      A +     S+Q   I  NI NA  + Y RR+   + S        VTV   
Sbjct: 1   MSLTYSLGNALSGLAAVSRQTEVISSNISNALTEGYARREVALSASSIGGRGAGVTVDGV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                        A  + +     L    A  E+         S    I  L  +L + +
Sbjct: 61  TRAVNAAITADRRAAQTHMSGALALSDGLARLEVAMGSAADAGSIAGRIGALEQALVAAA 120

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
              S D   +      + VV   N SA +VQ++R DAD +I  +I  L   L+++  +N 
Sbjct: 121 AEPSSDAGLQAAQQALQAVVSTLNASAAKVQQMRVDADADIATQIKALNTSLTQIAALNT 180

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     +  DA   +DQR +L+ +++ ++ ++ + R+N  + +    G  L +      
Sbjct: 181 QISRALTTGADAAGLMDQRAILIDQVASLVPLTEVPRDNGAVALMAPGGVMLVDNSAATF 240

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSS------NQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
           +F   ++ T         + GV+V             +  G + A   +RD+V+   Q+ 
Sbjct: 241 SFTHSHTITADMTLENGLLSGVLVDGRPLDASGGMGKLAGGTLGAAFALRDTVLTAAQSG 300

Query: 290 LDEMARVLI--GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSN 347
           LDE+A  L      S  DP       +               L   +     ++P    +
Sbjct: 301 LDEIAADLALKFQDSANDPSIAGGLGLFTDSGGLVDPSDATGLSARLRLNTLIDPAQGGS 360

Query: 348 PSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
              LRDG       + +   L  +   +                            A   
Sbjct: 361 AQLLRDGLYGGGTAVGSAVQLNRWSSALGQSSA----------------------LAAGV 398

Query: 408 IGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMF 467
           +  +   R  S         +FN +        GV+   E+  L+ +E SY  + K++  
Sbjct: 399 LNDIAAARVSSDREASYQSALFNSLYS-AEAAQGVDTDREMQKLLLIETSYAANAKVLQA 457

Query: 468 TDKMLQTLLEG 478
            D MLQTLLE 
Sbjct: 458 VDGMLQTLLEI 468


>gi|218549190|ref|YP_002382981.1| flagellar hook-associated protein FlgK [Escherichia fergusonii ATCC
           35469]
 gi|218356731|emb|CAQ89359.1| flagellar hook-filament junction protein 1 [Escherichia fergusonii
           ATCC 35469]
          Length = 548

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 69/549 (12%), Positives = 161/549 (29%), Gaps = 75/549 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  + A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLSAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + + + +   N+ +  +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTTRYEQMSKIDNLLSSET--NNVSTSLQGFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  A+ +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKADGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKT--ASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    +D LDQRD L+ ++++++G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNDLLDQRDQLVSELNKVVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +    +  +                 +  G +  +L  R   +   +N L
Sbjct: 239 SSARQLAAVPSHADPSRVTVAYVDATAGEIEIPEKLLTSGTLGGMLTFRSQDLDQSRNTL 298

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
            ++A     +F+++     ++    G       K L     Q  S+          +   
Sbjct: 299 GQLALAFADAFNKQHQAGFDATGAKGEDFFAIGKPLVLSNTQNNSDAAIKAEVINGSQVL 358

Query: 351 LRDGGSV-SKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
             D          W V  L            + N  F    +    T      +    + 
Sbjct: 359 ATDYTITWQGAGKWQVTRLVSNTSFTVEPDAAGNVEFDGLKLTFSGTPKDNNSFTLKPVS 418

Query: 410 WL---------------------------------------EKNRSDSHDLHMKSQVVFN 430
                                                     K    +   +     + +
Sbjct: 419 DAVVNMDVKVKDESQIALAQEAGAGDSDNRNGQKLLDLQSNGKTVGGAKSFNDAYATLVS 478

Query: 431 HI---------------------SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +                     S    +  GVNL EE   L + +Q Y  + +++   +
Sbjct: 479 DVGNKTATLKTSSTTQNNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTAN 538

Query: 470 KMLQTLLEG 478
            +   L+  
Sbjct: 539 TLFDALINI 547


>gi|323976545|gb|EGB71633.1| flagellar hook protein FlgK [Escherichia coli TW10509]
          Length = 547

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 61/548 (11%), Positives = 154/548 (28%), Gaps = 74/548 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTV 52
           + ++ N A +  N A     +   NI + +   Y R+ T+                 V V
Sbjct: 1   MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
              + E        L A  +            +  + M +     +S    +     SL+
Sbjct: 61  SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLST--STSSLATQMQDFFTSLQ 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           +   N  +    + +I  +E +V  F T+ + ++      +  I   +  +  +  ++  
Sbjct: 119 TLVSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIAS 178

Query: 173 VNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
           +ND I   T   +    ++ LDQRD L+ ++++I+G+   V++     +  ++G +L + 
Sbjct: 179 LNDQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQG 238

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQI------------ 278
                     +S   +  +                 +  G +  +L              
Sbjct: 239 STARQLAAIPSSADPSRTTVAYVDGTAGNLEIPEKLLNTGSLGGILTFRSQDLDQTRNTL 298

Query: 279 ------------------RDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIA 320
                              D+     ++        ++ + +    +A  +       + 
Sbjct: 299 GQLALAFAEAFNAQHNKGYDANGKEGEDFFAIGKPAVLQNTNNNGSVAIGATVTDASAVL 358

Query: 321 DGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCD 380
                +     Q     +  N  +   P           +  +           +    D
Sbjct: 359 ATDYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSD 418

Query: 381 SFNKNFI------------------------------FDPVAGINTNVTLLEYARNSIGW 410
           +     +                                    +    +  +   + +  
Sbjct: 419 AIVNMDVLITDEAKIAMASAEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSD 478

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +    +           V   +S    +  GVNL EE   L + +Q Y  + +++   + 
Sbjct: 479 IGNKTATLKTSSTTQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANA 538

Query: 471 MLQTLLEG 478
           +   L+  
Sbjct: 539 IFDALINI 546


>gi|254445805|ref|ZP_05059281.1| flagellar hook-associated protein FlgK [Verrucomicrobiae bacterium
           DG1235]
 gi|198260113|gb|EDY84421.1| flagellar hook-associated protein FlgK [Verrucomicrobiae bacterium
           DG1235]
          Length = 486

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 79/508 (15%), Positives = 173/508 (34%), Gaps = 56/508 (11%)

Query: 1   MS---LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SP 47
           MS   +      A    +       +   N+ N +N +Y R+  +               
Sbjct: 1   MSSSNIFGDLANATKALSAHRFGVTTAGNNLANVNNPDYARQRVLIGEEGMIQTIAGPQG 60

Query: 48  ENVTVVTQRSENKNMFDKVLHAHSS-----------------AIGQQRLLQSFEALKEMM 90
             V VV  +     + D+ +   +S                 ++GQ+          +  
Sbjct: 61  MGVEVVGFQHMRDAVLDREVLRETSLNASLTAQQAALGKAESSLGQEINRSGDSPFIDGA 120

Query: 91  SADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA 150
           +AD   +      ++   ++  S S N   D   ++++  AE + +  N ++     +R 
Sbjct: 121 TADGGGSGGIAETLNNFFNAFHSLSANPGSDAEKESLLQKAEILTEKLNVTSERFSDLRE 180

Query: 151 DADKEIELEISNLRRFLSELTVVNDAIKFKTAS-KHDAHDFLDQRDVLLQKISEIIGIST 209
               E+E ++ +  + + E+  +N  I    +S    A    DQR  +L+ +SEI+ I T
Sbjct: 181 ALTLEVETDLDSANQMIEEIATLNAEIARAESSHAGQALSLRDQRQAVLRDLSEIMQIKT 240

Query: 210 IVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPK 269
              +++   +      T+    P+     +    TV  + + +     V        V  
Sbjct: 241 ENIDDSAGQIRVYI-PTIGGDSPQLDLVSRGRFQTVDLDDSGVNPVFTVGEDAIQIDVRG 299

Query: 270 GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNK 329
           G +   L+ RD  +  +Q  LD++A+ L+   +       +  +                
Sbjct: 300 GSVHGALKSRDGAIAEYQRGLDDLAKELVTQVNGLYNSGVSPNDTNFF------------ 347

Query: 330 LCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD 389
                        ++ +    L    + S     N     G   L     +  + N    
Sbjct: 348 ------SDTSDPSEFTAAGITLASDLTASTLRTSNASTDLGDNSLTLAIAELDDTNQAAL 401

Query: 390 PVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELS 449
                  N     + R+ +  L +N +          +VF  + +      GV++ EE++
Sbjct: 402 ------GNRNFGTFYRSIVTDLGENVAAVDSRLEDENIVFELLKQQQDAVSGVSIDEEMT 455

Query: 450 FLIKVEQSYNISNKLIMFTDKMLQTLLE 477
            ++K ++++  + KLI   D+ML  ++ 
Sbjct: 456 DMMKFQRAFQATGKLIQTIDEMLDVIVN 483


>gi|218703531|ref|YP_002411050.1| lateral flagellar hook associated FlgK-like protein [Escherichia
           coli UMN026]
 gi|293403361|ref|ZP_06647452.1| predicted protein [Escherichia coli FVEC1412]
 gi|298378972|ref|ZP_06988853.1| flagellar hook-associated protein 1 FlgK [Escherichia coli
           FVEC1302]
 gi|300899458|ref|ZP_07117706.1| flagellar hook-associated protein FlgK [Escherichia coli MS 198-1]
 gi|218430628|emb|CAR11494.1| Lateral flagellar hook associated protein 1 (FlgK-like)
           [Escherichia coli UMN026]
 gi|291429214|gb|EFF02234.1| predicted protein [Escherichia coli FVEC1412]
 gi|298280085|gb|EFI21589.1| flagellar hook-associated protein 1 FlgK [Escherichia coli
           FVEC1302]
 gi|300356937|gb|EFJ72807.1| flagellar hook-associated protein FlgK [Escherichia coli MS 198-1]
          Length = 458

 Score =  172 bits (436), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  N     Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANTMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|331666552|ref|ZP_08367426.1| flagellar hook-associated protein FlgK [Escherichia coli TA271]
 gi|331065776|gb|EGI37660.1| flagellar hook-associated protein FlgK [Escherichia coli TA271]
          Length = 458

 Score =  172 bits (436), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   V     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYVDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTSTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +               + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPNITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|315186992|gb|EFU20749.1| flagellar hook-associated protein FlgK [Spirochaeta thermophila DSM
           6578]
          Length = 624

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 62/425 (14%), Positives = 148/425 (34%), Gaps = 29/425 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S        +      +Q  A++  N+ NA  + Y R+                      
Sbjct: 3   STFMSIEIGKRGLLAHTQGLATVGHNMSNASVEGYSRQRVNFEAMDPLYMPGLNREETPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              + V++ +       + +  + A ++  G      S+  + E    ++  + S    +
Sbjct: 63  QIGQGVSIQSIERIRDEILEGRIAAQTNVGGYWETRNSYLLMVEKTY-NEPSDVSVRSLL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               D+ +  S +  E      VI+NA+ +V   +     +  IR   ++++++ ++ + 
Sbjct: 122 DAFWDAWQELSIHPDEVAARHAVIENAKALVDGIHGRYHALSSIRKMIEEDVQVTVNEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +++ +  +N+ I    A   + +D +D+RD+L++K++++I I+   R+ ++  ++    
Sbjct: 182 DYIARIAHLNEQIVKVKAMGDNPNDLMDRRDLLVEKLAKLINITVDKRDPDEFTIHVGGR 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +   V      +           N  F   +   S +   +  GK+ ALL++RD  V 
Sbjct: 242 HLVQGKVYHPFILDP-------RPQNEGFSAVLWEGSTEEVRLEGGKLAALLELRDGDVR 294

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
               +LD M   L+   +E    A       G+        + N +              
Sbjct: 295 GEIQKLDTMTVNLVNLVNEVHRNAYGLNGQTGVDFFVEHPAVLNAVGNYDRNGDGEFDST 354

Query: 345 R----SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
                   + L     V  + +  +    G   +  +  D+          +G   + + 
Sbjct: 355 YLFRIHGTNVLDPNAQVGIEGVITLSGTEGDVQIAYYPTDTVQDIVNRINTSGAEVSASF 414

Query: 401 LEYAR 405
               R
Sbjct: 415 DRLGR 419



 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 96/343 (27%), Gaps = 15/343 (4%)

Query: 142 AREVQKIRADADKEIELEISNLRRFLSELTVVNDA----IKFKTASKHDAHDFLDQRDVL 197
             +V+      D      ++ +         +N         +  +  +A    D+    
Sbjct: 290 DGDVRGEIQKLDTMTVNLVNLVNEVHRNAYGLNGQTGVDFFVEHPAVLNAVGNYDRNGDG 349

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV 257
               + +  I      + +  V      TL  T   D+      + TV    N I   G 
Sbjct: 350 EFDSTYLFRIHGTNVLDPNAQVGIEGVITLSGTEG-DVQIAYYPTDTVQDIVNRINTSGA 408

Query: 258 VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
            VS++            L ++     P       +     +    +            G 
Sbjct: 409 EVSASFDR---------LGRLVLKATPSGDVAFPDFVIRHVEDSGQFLSGYAGILGGSGP 459

Query: 318 FIADGIKDLDNKLCQGISETICVNP-QYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLIN 376
             A   + +D  L         V P  + S    L          +       G P    
Sbjct: 460 ENAYDWETVDAVLTLRGGAEYGVAPFAHPSGWVVLNPEVERDPASVAAGFGQGGRPAPPG 519

Query: 377 HYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESY 436
               +     +      I   +T  +Y   ++  +      +       +++   + +  
Sbjct: 520 DGSAALAIANLRTEPVMIGRLMTFDDYFAEAVSEIGLKGQQAQIADETQKLIMKDLKDLR 579

Query: 437 SNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            +  GVN+ EEL+ +IK +  Y  S + I   + ML  L+  +
Sbjct: 580 ESISGVNIDEELAQMIKFQHGYAASARFISTFNSMLDLLINRM 622


>gi|148980296|ref|ZP_01815983.1| putative flagellar hook-associated protein [Vibrionales bacterium
           SWAT-3]
 gi|145961315|gb|EDK26625.1| putative flagellar hook-associated protein [Vibrionales bacterium
           SWAT-3]
          Length = 459

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/489 (13%), Positives = 146/489 (29%), Gaps = 42/489 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----------PEN 49
           M +    N   +          +  +N  N +   Y R+      S              
Sbjct: 1   MGMT---NIGLSGALANRVALNTTAQNTANVNTPGYSRQIVTMEASLSGNAVNGINLGAG 57

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V V              L   + +    +   +  +  E +        S T  ++    
Sbjct: 58  VEVSDILRIADQSSINRLREATESAQYSQSYFNGLSNLENLLG--ADGLSLTQGMNGFFA 115

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +++  S         + V+ NA+ + Q FN+ + ++ +  A   +     ++++   L  
Sbjct: 116 AIDEASVTPESVAFRQQVLTNADALAQQFNSVSAQLSQQEAAQSERYGALVTHVNSQLES 175

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
           +  +N  ++             D  D  L ++S+ + +  I  +N  + + T +   L  
Sbjct: 176 IASLNQKLQEDALLGKSVGGLQDAMDKHLNELSKSLDVQVIY-SNGGVELSTPNVQPLVI 234

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
                     ++S    S    I    +    +       G++ AL  ++ +     +  
Sbjct: 235 GGYAASLARDLSSGDPYSTDLNITFQSMTTPVDAS---LGGELGALEALKTNQYEPIKTL 291

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           L ++A+ L    +       +   V G  +       +             +  + S+ +
Sbjct: 292 LADLAKGLADGVNSALNSGFDLNGVAGQNLFTYTLGSEALSLAIDPSLTAQDLAFSSSAT 351

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
                              AG  D++               VAG     T        +G
Sbjct: 352 L------------------AGNGDVLKDLSMLSQTPLTNGSVAG----ETPYSAYSGLLG 389

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            +      +      +QV       +  +   VN  EE + ++    +Y  + K+I   +
Sbjct: 390 DIGIFTRQAQSEATAAQVSMEDAQVARDSVSAVNSDEEAANMLLYLNAYEANMKIISTAN 449

Query: 470 KMLQTLLEG 478
           +M QTLL  
Sbjct: 450 QMFQTLLRA 458


>gi|312115279|ref|YP_004012875.1| flagellar hook-associated protein FlgK [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220408|gb|ADP71776.1| flagellar hook-associated protein FlgK [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 489

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 145/489 (29%), Positives = 232/489 (47%), Gaps = 10/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL A  + A    + AS Q A + RN+ N   +   R+           +VV+    + 
Sbjct: 1   MSLTAALDTATAGISVASSQIAVLSRNVANQSTEGASRKLANVATINGLPSVVSITRVSN 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSA--DDHYNNSPTHYISKLRDSLESYSKNL 118
               K L A ++   +   +    A  +            SPT  IS L D L +Y+ + 
Sbjct: 61  AAALKSLLAANADDARDGAVSDALARLQSTVGATSTDDTTSPTALISALSDDLSTYAASP 120

Query: 119 SEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK 178
                    +  A ++    N ++  VQ++RADAD  I   +S +   L++   VN+ I 
Sbjct: 121 ESTAAASAAVQAASDLSDALNAASDVVQQVRADADSAISDSVSTINDLLAQFQTVNETIV 180

Query: 179 FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFE 238
             T +  D  D LDQRD +LQ +S  IGIST+ R+NNDM +YT  G TLF+   R ++FE
Sbjct: 181 KGTVTGADTTDALDQRDAILQSLSAEIGISTVTRSNNDMAIYTDSGVTLFDKAARSVSFE 240

Query: 239 KMNSYTVTSESNPIFIDGVVVSSNQGSA-VPKGKIKALLQIRDSVVPIFQNQLDEMARVL 297
             N++  +++ N +++DGV V+++  S  +  GK+  L+++RD +   +Q+QLDE+AR L
Sbjct: 241 ATNAFAASTQGNAVYVDGVPVTASGASYEIKSGKLAGLVEVRDDLAVTYQDQLDEIARGL 300

Query: 298 IGSFSEKDPIAGNSENVPGLFIADGIK---DLDNKLCQGISETICVNPQYRSNPSFLRDG 354
           I +F E D  A  + +       D           + +G++  I +     + P+ LRDG
Sbjct: 301 ITAFQETDQSASGTGSAQAGLFTDSGSLVVPTSGTVSEGLAARISLASSVIATPTLLRDG 360

Query: 355 GSVSKKFL----WNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           G  +              +GY D ++   DS +    FD  AG  T+++L +YA  S  W
Sbjct: 361 GISTNGAAPYVYNPSPGQSGYTDRLDGLVDSLSSKMTFDTSAGAGTSISLSDYAAASASW 420

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           L      +      S  V +  + + SN  GVNL  ELS ++ +EQSY  S KL+   D+
Sbjct: 421 LGVKSQSASSTAAYSATVKSTAATALSNATGVNLDSELSKMLALEQSYAASAKLVSAVDQ 480

Query: 471 MLQTLLEGV 479
           M   LL  +
Sbjct: 481 MFSDLLNAI 489


>gi|323191378|gb|EFZ76640.1| flagellar hook-associated protein FlgK [Escherichia coli RN587/1]
          Length = 458

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYNTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLQNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    +   P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNANGTPTMTLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|77165832|ref|YP_344357.1| hypothetical protein Noc_2369 [Nitrosococcus oceani ATCC 19707]
 gi|254433787|ref|ZP_05047295.1| flagellar hook-associated protein FlgK [Nitrosococcus oceani AFC27]
 gi|76884146|gb|ABA58827.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gi|207090120|gb|EDZ67391.1| flagellar hook-associated protein FlgK [Nitrosococcus oceani AFC27]
          Length = 647

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/421 (14%), Positives = 135/421 (32%), Gaps = 17/421 (4%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENV 50
           M+   +     +    A +  A+   NI N +   + R+ T                  V
Sbjct: 1   MASSDLLGIGASGLLAAQRALATTSHNIANVNTPGFSRQRTELAARLPEFTGQGFIGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V T R    +   +     +S   Q ++     A  + + AD   +   +    +  ++
Sbjct: 61  DVTTVRRAYDSFLTEQARYSTSEYAQSKVFHDLAAQVDNLFAD--SDTGLSASSQRFFNA 118

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
            +  + + S     + ++          ++    + ++  D +  +   ++ +    S +
Sbjct: 119 TQELANDPSSSAARQVLLAEGGAFAARVHSLGDRLGELDEDVNTRLRDTVAEVNTLSSSI 178

Query: 171 TVVNDAIK--FKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +N  I+      +    +D LDQRD L+Q +S+   ++ + +++  + V+   G +L 
Sbjct: 179 AGLNQQIRDLRGQNNNQPPNDLLDQRDQLIQDLSQKAAVTVLPQDDGSLNVFIGKGQSLV 238

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                       N Y  +         G V   +   ++  G++ ALL  RD V+   +N
Sbjct: 239 TGDHSHSLTTLANPYEASRLEVGYAAKGGVAPISD--SIQGGELGALLSFRDEVLSSSRN 296

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNP 348
            L ++A  +  SF+E+  +  + +   G      I             T     +   N 
Sbjct: 297 ALGQLAVGVAQSFNEQHRLGVDLQGELGGDFFAAIDSNTAVSLPRADNTGDGVIEIAIND 356

Query: 349 SFLRDGGSVSKKFLWNVKNLAGYPDLIN-HYCDSFNKNFIFDPVAGINTNVTLLEYARNS 407
           +                  L    D                D +    T+ ++       
Sbjct: 357 ASKLTDSDYRLDRNGAGFTLTRLSDNQAFSLSTFPGSAETVDGLTLNLTSGSINGGDSYL 416

Query: 408 I 408
           I
Sbjct: 417 I 417



 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/390 (13%), Positives = 102/390 (26%), Gaps = 11/390 (2%)

Query: 91  SADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRA 150
                 ++S          S      + S + LG+  +  A+   +          ++  
Sbjct: 266 GGVAPISDSIQGGELGALLSFRDEVLSSSRNALGQLAVGVAQSFNEQHRLGVDLQGELGG 325

Query: 151 DADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTI 210
           D    I+   +               I    ASK    D+   R+     ++ +      
Sbjct: 326 DFFAAIDSNTAVSLPRADNTGDGVIEIAINDASKLTDSDYRLDRNGAGFTLTRLSDNQAF 385

Query: 211 VRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKG 270
             +       T DG TL  T       +        + +    +    + ++       G
Sbjct: 386 SLSTFPGSAETVDGLTLNLTSGSINGGDSYLIQPTRAAAQQFGV----MLTDSARIAAAG 441

Query: 271 KIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKL 330
            I+    + +                L    + +  +  ++              LD   
Sbjct: 442 PIRTEANLGNRGTGQVSAAAVTATAGLPLPSNGEVTLTYDAAARQFNVSGGPGGTLDFDP 501

Query: 331 CQGISETICVNPQYRS-NPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFD 389
               +      P     N +            L N     G             K    D
Sbjct: 502 ATESNGKEFHLPSVGGLNFTVSGVPADGDTFMLQNNTGGVGDNRNALSLAGLQTKPVFQD 561

Query: 390 PVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELS 449
                    T  E     +  +      +       + + +    +     GVNL+EE +
Sbjct: 562 ------GTTTYQEQYGRLVADVGARTRQAEANQDTHKTLLDQAVAAREGVSGVNLEEEAA 615

Query: 450 FLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            LI+ +Q++  + ++I   D M QTLL  V
Sbjct: 616 NLIRFQQAFQAAARVISTADTMFQTLLGAV 645


>gi|170288661|ref|YP_001738899.1| flagellar hook-associated protein FlgK [Thermotoga sp. RQ2]
 gi|170176164|gb|ACB09216.1| flagellar hook-associated protein FlgK [Thermotoga sp. RQ2]
          Length = 858

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/446 (13%), Positives = 134/446 (30%), Gaps = 30/446 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS+  + N A    +        +  NI NA    Y R+  +                  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNVVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPSFP 63

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                   V T         D      ++       + S     E + A +   +     
Sbjct: 64  LQMGTGAKVKTIVRLRDAFLDVQYRQVNNRYNYWDTVLSNLHFIEQLLA-EPGEDGIRSL 122

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +    ++ +    + S       V+  A+++V         ++++R D D EI   +S +
Sbjct: 123 VDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDDEIVQRVSEI 182

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            + +  L  +N+ I+         +D LD+RD +L ++S +  I+     +  + +   +
Sbjct: 183 NQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQITLRIGN 242

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              L  +  R++   +          + +F+    +          GK+KAL+ +RDS +
Sbjct: 243 QIVLNGSTYRELRALER---PYGKGYHELFVGNSQLIL------SDGKLKALMDLRDSSI 293

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
             +  +LDE    +  S +        S  V          +  +              +
Sbjct: 294 VKYMRKLDEFVLFITDSLNLVHRDGFESNGVTTNLNFFKKIEAFSDDPSIFRIKGSRKLE 353

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
                +      + S+  +   +  +    ++  +    +          I   V     
Sbjct: 354 MGPYHTVTGIHSASSQVEIEGRRFNSDD--IVLSFGGGSSNVLNVSAGTTIGDLVGSWNL 411

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVF 429
              S+  +  +          S    
Sbjct: 412 LGTSL-RVGSHAGGYRLYLEDSTGSL 436



 Score =  109 bits (272), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 65/467 (13%), Positives = 128/467 (27%), Gaps = 38/467 (8%)

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMS---ADDHYNNSPTH 102
                T+         +   +     +   +  L  S  +L+  +     D         
Sbjct: 396 VSAGTTIGDLVGSWNLLGTSLRVGSHAGGYRLYLEDSTGSLRNKLFLSLGDSLSQMGFDT 455

Query: 103 YISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
                    ES    LS  +    V    E+  +   T + ++      ++ E       
Sbjct: 456 ETKGYITIKESDLSGLSSGVYNINVEYTLEDGTRQTETISVDLSSGVNLSNIEAS----- 510

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           +         +               D     D    K+       T             
Sbjct: 511 INSSSHLRAQIYADPSTGENMLVIVPDEQLSFDPSAVKVLSDDDFFTKSNAFVRNYEVLE 570

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ----- 277
              TL         F+    +T+T  S  I ID  V +          K   +L      
Sbjct: 571 YKDTLENIFYGQTGFDPTRPFTITINSTDIEIDPAVDTLETLVEKINEKNTGVLADLTPH 630

Query: 278 ----IRDSVVPIFQNQLDEM--ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC 331
                R S +  F  ++ E+   +    +    DP    +            K  D    
Sbjct: 631 HSLVFRASSLYDFDLRMMEIKGPQGFFEAVGFIDPDGDPTTFDWSSSFTLVSKSDDFTTL 690

Query: 332 ---QGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIF 388
                +++ +  +      P  + +   VS     N  NLA          D    +   
Sbjct: 691 SERFKVADILTFDRALYDEPLNIVNQFEVSSSLATNPANLAVDVGYALENSDWNATSIKP 750

Query: 389 DPVAG----------------INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
              A                  N   +  E+    I  L      + +L   ++++   I
Sbjct: 751 SGGANPELLETIQNLYTKKMLSNGKESFYEFFGGVISELGVEAETASNLKNNTEILRQEI 810

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +     GV+L EE++ +I+ + +++ + K+I   D+M+QT++  V
Sbjct: 811 DNAREEVKGVSLDEEMANMIEYQHAFSAAAKVITAVDQMIQTVINMV 857


>gi|301645421|ref|ZP_07245362.1| flagellar hook-associated protein FlgK [Escherichia coli MS 146-1]
 gi|307136864|ref|ZP_07496220.1| flagellar hook-associated protein FlgK [Escherichia coli H736]
 gi|331640719|ref|ZP_08341866.1| flagellar hook-associated protein FlgK [Escherichia coli H736]
 gi|301076305|gb|EFK91111.1| flagellar hook-associated protein FlgK [Escherichia coli MS 146-1]
 gi|315616821|gb|EFU97438.1| flagellar hook-associated protein FlgK [Escherichia coli 3431]
 gi|331040093|gb|EGI12301.1| flagellar hook-associated protein FlgK [Escherichia coli H736]
          Length = 458

 Score =  172 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 67/484 (13%), Positives = 161/484 (33%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMITGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q + +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   V     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYVDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMEVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++  P        +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTPTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|222084886|ref|YP_002543415.1| flagellar hook-associated protein [Agrobacterium radiobacter K84]
 gi|221722334|gb|ACM25490.1| flagellar hook-associated protein [Agrobacterium radiobacter K84]
          Length = 491

 Score =  172 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 159/489 (32%), Positives = 260/489 (53%), Gaps = 11/489 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL    N AQ I NN+  Q + +  NI NA N +Y RR  M T       VV     N+
Sbjct: 1   MSLTTALNNAQAIFNNSGTQSSVVSNNIANAGNTDYSRRQAMLTTDMSGAQVVKIARANE 60

Query: 61  NMFDKV-LHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
               K  L + SS   QQ LL+++ +L+      +    +P  Y+S L+ ++++Y+ + S
Sbjct: 61  PALQKTFLSSTSSDAAQQSLLKAYTSLQSATLGGNDNEVAPATYLSNLQTAMQTYASSPS 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
                ++ ++ A+ +    N +   VQ +R DADK+I  ++  L   L++    NDA+K 
Sbjct: 121 SSTAAQSAVNAAQSLATALNNATTAVQSVRTDADKQIASDVDTLNGLLNQFQTANDAVKS 180

Query: 180 KTASKHDAH----DFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            TA+         D LDQRD +L++IS+I+G++T+ R+NND+ +YT+ G TLFET+PR +
Sbjct: 181 ATAASSPTSTTLSDALDQRDSILKQISQIVGVTTVTRDNNDVALYTTGGATLFETIPRSV 240

Query: 236 NFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMA 294
            F    SYT +   N ++IDGV +++ QG++   +G ++A LQ+RD V P +Q QLDE+A
Sbjct: 241 TFTPTTSYTASISGNNVYIDGVALTAGQGASTTAQGSLQASLQVRDDVAPTYQKQLDEIA 300

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVN-----PQYRSNPS 349
           R L+ +F+E +     +      +    + D    +                     +P+
Sbjct: 301 RGLVTTFAETNQTDSTTAPGLFTWSGGTVPDSATVVTGMAGSIAVNPALLTTSTQTGDPT 360

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
            LRDGG     ++ N    +GY D ++ Y    +    FDP AG + + +L++YA +SIG
Sbjct: 361 LLRDGGINGSDYVVNTTGASGYSDQLDAYITGMSTKMDFDPTAGSDASASLMDYASSSIG 420

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
           WLE  RS +      +    +  S +YSN  GVNL EEL+ ++ +EQSY    K++   +
Sbjct: 421 WLEGQRSTATTAAENTSAALSRSSTAYSNETGVNLDEELTLMMDIEQSYKAGTKILNAVN 480

Query: 470 KMLQTLLEG 478
           +MLQ++L+ 
Sbjct: 481 EMLQSVLDI 489


>gi|293408373|ref|ZP_06652212.1| flagellar hook-associated protein FlgK [Escherichia coli B354]
 gi|291471551|gb|EFF14034.1| flagellar hook-associated protein FlgK [Escherichia coli B354]
          Length = 458

 Score =  172 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 159/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q +    E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGYLTQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLQNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTASMTLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +       +       + S+P      
Sbjct: 295 SQFADAVNNQQAQGYDLNGNPGEPLFIYDASNADGPLTVNPDITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|296103605|ref|YP_003613751.1| flagellar hook-associated protein 1 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058064|gb|ADF62802.1| flagellar hook-associated protein 1 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 545

 Score =  172 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/546 (13%), Positives = 155/546 (28%), Gaps = 72/546 (13%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPE----------NVTV 52
           +  +FN A+   + A         N+ N  +  Y RR  +                    
Sbjct: 1   MNNLFNLARGGLSVAQAALRVTGDNLTNGMSGTYSRRSLIIGELGGMTTGQGFFGYGARA 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
                      +  L    S      L    E L ++ +     +++ +  ++ +  ++ 
Sbjct: 61  GGVERAYDAFANNELR--GSLSHYASLNGRMEQLSDIDNMLADESDNVSVSLNDMFKAMA 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
           + S + ++      V +    +   FN SA+ +  +    + +IE    ++  +  +L  
Sbjct: 119 TLSGDAADGPARAAVFNALGTLANRFNASAKRLTALEKSTNTQIEQSAKDINSYTQQLAE 178

Query: 173 VNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNN-DMVVYTSDGTTLFETV 231
           VN  ++    +     D LDQRD LL+K+SE IGI+         + V  SDG  L    
Sbjct: 179 VNKQLERAQGNGAPPADLLDQRDALLEKMSEHIGITVTEDKTTGRVDVLLSDGRPLVSRD 238

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                    +                  S    S++ KG++  L + R+  + I + +LD
Sbjct: 239 RAYKLQTSPSDADPNKTIVSYVDANENASPLDESSITKGRLGGLFKFRNEDLTIARQELD 298

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIAD-----------------------GIKDLDN 328
           ++A  +    +E+       +   G  +                                
Sbjct: 299 QIAFTMANRMNEQHAEGYTPDGDKGGDLFSLADIKAYANAKNTGTGKLGAINVTNYTDVK 358

Query: 329 KLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLIN------------ 376
                ++                     V     ++   +       +            
Sbjct: 359 SENYTVTSDGAGGWTVTGEDGRTVPATLVGDNLTFDGIEIDVSGGGFDDGDSFTLNPIAG 418

Query: 377 -------HYCDSFNKNFIFDPVAGINTNVTLL-----------------EYARNSIGWLE 412
                      +       D   G   N  L                  E   + +G + 
Sbjct: 419 AAEGMARSLGSAQEFAAAGDKDGGPGDNTNLEEMLKIQDQKLIGDNTLTEAYASLVGTIG 478

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
                     + ++       ++     GVN+ EE   L   +Q YN + +L+     M 
Sbjct: 479 DRARGVKSALVSAETDLRTKYDTKQALSGVNMDEEYINLDMFKQYYNANAQLLKTATDMF 538

Query: 473 QTLLEG 478
             LL  
Sbjct: 539 DALLSI 544


>gi|148269976|ref|YP_001244436.1| flagellar hook-associated protein FlgK [Thermotoga petrophila
           RKU-1]
 gi|147735520|gb|ABQ46860.1| flagellar hook-associated protein FlgK [Thermotoga petrophila
           RKU-1]
          Length = 858

 Score =  172 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 59/446 (13%), Positives = 134/446 (30%), Gaps = 30/446 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS+  + N A    +        +  NI NA    Y R+  +                  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNVVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPSFP 63

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                   V T         D      ++       + S     E + A +   +     
Sbjct: 64  LQMGTGAKVKTIVRLRDAFLDVQYRQVNNRYNYWDTVLSNLHFIEQLLA-EPGEDGVRSL 122

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +    ++ +    + S       V+  A+++V         ++++R D D EI   +S +
Sbjct: 123 VDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDDEIVQRVSEI 182

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            + +  L  +N+ I+         +D LD+RD +L ++S +  I+     +  + +   +
Sbjct: 183 NQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQITLRIGN 242

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              L  +  R++   +          + +F+    +          GK+KAL+ +RDS +
Sbjct: 243 QIVLNGSTYREL---RALERPYGKGYHELFVGNSQLIL------SDGKLKALMDLRDSSI 293

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
             +  +LDE    +  S +        S  V          +  +              +
Sbjct: 294 VKYMRKLDEFVLFITDSLNLVHRDGFESNGVTTNLNFFKKIEAFSDDPSIFRIKGSRKLE 353

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
                +      + S+  +   +  +    ++  +    +          I   V     
Sbjct: 354 MGPYHTVTGIHSASSQVEIEGRRFNSDD--IVLSFGGGSSNVLNVSAGTTIGDLVGSWNL 411

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVF 429
              S+  +  +          S    
Sbjct: 412 LGTSL-RVGSHAGGYRLYLEDSTGSL 436



 Score =  112 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 65/467 (13%), Positives = 128/467 (27%), Gaps = 38/467 (8%)

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMS---ADDHYNNSPTH 102
                T+         +   +     +   +  L  S  +L+  +     D         
Sbjct: 396 VSAGTTIGDLVGSWNLLGTSLRVGSHAGGYRLYLEDSTGSLRNKLFLSLGDSLSQMGFDT 455

Query: 103 YISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISN 162
                    ES    LS  +    V    E+  +   T + ++      ++ E       
Sbjct: 456 ETKGYITIKESDLSGLSSGVYNINVEYTLEDGTRQTETISVDLSSGVNLSNIEAS----- 510

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           +         +               D     D    K+       T             
Sbjct: 511 INSSSHLRAQIYADPSTGENMLVIVPDEQLNFDPSAVKVLSDDDFFTESNAFVRNYEVLK 570

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQ----- 277
              TL         F+    +T+T  S  I ID  V +          K   +L      
Sbjct: 571 YKDTLENIFYGQTGFDPTRPFTITINSTDIEIDPAVDTLETLVEKINEKNTGVLADLTPH 630

Query: 278 ----IRDSVVPIFQNQLDEM--ARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLC 331
                R S +  F  ++ E+   +    +    DP    +            K  D    
Sbjct: 631 HSLVFRASSLYDFDLRMMEIKGPQGFFEAVGFVDPDGDPNTFDWSSSFTLVSKSDDFTTL 690

Query: 332 ---QGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIF 388
                +++ +  +      P  + +   VS     N  NLA          D    +   
Sbjct: 691 SERFKVADILTFDRAPYDEPLNIVNQFEVSSSLAANPANLAVDVGYALENSDWNATSIKP 750

Query: 389 DPVAG----------------INTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHI 432
              A                  N   +  E+    +  L      + +L   ++++   I
Sbjct: 751 SGGANPELLETIQNLYTRKILSNGKESFYEFFGGVVSELGVEAETASNLKNNTEILRQEI 810

Query: 433 SESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
             +     GV+L EE++ +IK + +++ + K+I   D+M+QT++  V
Sbjct: 811 DNAREEVKGVSLDEEMANMIKYQHAFSAAAKVITAVDQMIQTVINMV 857


>gi|161594054|ref|NP_901379.2| flagellar hook-associated protein FlgK [Chromobacterium violaceum
           ATCC 12472]
          Length = 455

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 68/483 (14%), Positives = 152/483 (31%), Gaps = 41/483 (8%)

Query: 7   FNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVTQR 56
            N A +    A     +  +NI N     Y R+  +             +   V V   R
Sbjct: 4   INNALSGAQAAQVALNTASQNIANQQTPGYSRQGVVLATQAPGAGDPLSAGYGVNVSNVR 63

Query: 57  SENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSK 116
             + +  + +    +S +G +   Q +    E +       +S +    +   +L + S 
Sbjct: 64  RFSDDYKNLLQWQAASNVGSRAAAQPYFTQLEKVMG--SKGSSLSDGFDQFFAALNAASL 121

Query: 117 NLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA 176
           +   + +   VI +A+ + Q FN     +    A   ++    ++ +    + L  +N+ 
Sbjct: 122 D--SNTMRDQVIRSADALAQRFNNLDGVLTSQLAAISEQRNATLTQINSATANLAALNEK 179

Query: 177 IKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDIN 236
           +    A   +     D+RD  +  +S +I +  + + +    +   +G  L         
Sbjct: 180 LMSAKAQGINTSGLEDERDRQVDALSSLIEVRVVAQPDGSKSISLKNGLPLVTGDSAATL 239

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
             +            + +               G++  L +     +   Q Q+  +A  
Sbjct: 240 SSEAQPDGSQQ----LKLAFGTEKYAMPGGDLGGQLGGLNRFETENLRPVQAQVRTLAGE 295

Query: 297 LIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGS 356
           L    +++     +    PG  +                               L     
Sbjct: 296 LATRVNDQLAKGYDMNGQPGKPLFQYD---------------------AGAAHGLLQTTG 334

Query: 357 VSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRS 416
           +    L    + A   +  N       K   F        NVTL +     IG L  +  
Sbjct: 335 ILSAELGFSADPAKPGNNDNLREVLKVKQQAFPLAG--IGNVTLGDAYSQMIGHLAISSQ 392

Query: 417 DSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            +      + V+     +++ +T GV   EE   LI+ ++ Y  + K+I   +++ ++ L
Sbjct: 393 QNSSSLDTANVIRAEAEKNWQSTSGVQRDEEAVSLIEYQKMYQANMKVIAVANQLFESTL 452

Query: 477 EGV 479
             +
Sbjct: 453 AIL 455


>gi|116248739|ref|YP_764580.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253389|emb|CAK11777.1| putative flagellar hook-associated protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 486

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 159/485 (32%), Positives = 255/485 (52%), Gaps = 8/485 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N  Q+I N   QQ + I  NI N  N +YVRR+   T S     VV+     +
Sbjct: 1   MSLTSALNNVQSIFNTTGQQSSVISTNIANVGNSDYVRREASVTTSLSGAQVVSISRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     ++    Q+ L +     + +   + Y  SP+ Y++  + +L+++  + S 
Sbjct: 61  TALLAQYLQTNAKDSAQQTLVTGLESLKSLVGGNDYETSPSTYLTAFQQALQTFGTSPSS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
               ++ +  A+++  + NT++  VQ IRA+AD EI  ++S L   LS+    N+A+K  
Sbjct: 121 TTAAQSAVTAAQDLANSLNTASDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKLA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T++  D    LD+R+ LL++IS I+G+++ VR+NNDM +YTSDGT LFET+PR + F   
Sbjct: 181 TSTGTDTSSALDEREKLLKQISSIVGVTSTVRDNNDMALYTSDGTVLFETIPRTVTFAPT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ QLDE+A+ L+ 
Sbjct: 241 ATYVAGTEGNSIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQAQLDEIAKSLVQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKL------CQGISETICVNPQYRSNPSFLRD 353
            FSE D              +                   IS  + V      + + LRD
Sbjct: 301 IFSETDGSTSAPGLFVWTTASGATGATPAASDDATGIASTISVNLAVVTSEGGDATKLRD 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
            GS+S     N    +G+ D ++   ++  +   F   AG++T+ +L +YA  SIGWLE+
Sbjct: 361 -GSISGITDLNTSGDSGFSDNLDALYEALTEQRSFSSDAGLSTSQSLTDYASASIGWLEQ 419

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   D+M Q
Sbjct: 420 YRSDATSASETTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKILNVIDEMFQ 479

Query: 474 TLLEG 478
           +LL+ 
Sbjct: 480 SLLDI 484


>gi|146278770|ref|YP_001168929.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145557011|gb|ABP71624.1| flagellar hook-associated protein FlgK [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 476

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 94/486 (19%), Positives = 178/486 (36%), Gaps = 18/486 (3%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS-----PENVTVVTQ 55
           MS+    + A +     S+   +   NI NA  + + RR+   +          V VV  
Sbjct: 1   MSITTALSSALSGLTVTSRGVETAANNIANALTEGFARRELEVSARAYGGEGRGVRVVGV 60

Query: 56  RSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYS 115
                           +A G +    +F      +  D     S    I+ L  +L S +
Sbjct: 61  NRIIDMTLVGDRRLADAATGDRNTRSAFYESIAKVVGDTA-EGSLLSRITDLSAALASAA 119

Query: 116 KNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVND 175
                 +  + V+D A+ +V   N ++  V   R  AD  I  ++  L   L  +  +N 
Sbjct: 120 SRPESTVRLQDVLDTAQALVSGLNAASDAVLTARRGADASIADQVDQLNAGLESVRDLNL 179

Query: 176 AIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDI 235
            I     +  D+    D+R  ++  ++ I+ +  I R N  + ++T+ G  L +    +I
Sbjct: 180 RITRLRVTGRDSSALEDERQRVVDSMATIVPLREIERENGQIALFTTGGAALLDGRVAEI 239

Query: 236 NFEKMNS-YTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEM 293
            F       + +S    + +DG  +S       +  G + A   +RD++ P  Q +LD +
Sbjct: 240 GFTPTPGLVSASSSLGSLTMDGRPISVPGDPGLMAGGSLSAAFAVRDTLAPNEQQRLDAL 299

Query: 294 ARVLIGSFSEKDPI-AGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLR 352
           AR LI  F+  D   +     +             + L   IS    V+P+      +LR
Sbjct: 300 ARDLIERFTAADSSLSAGDAGLFTDEGLAFDAANASGLAGRISVNGKVDPERGGALRYLR 359

Query: 353 DGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLE 412
           DG   +     +          ++          +    A I  + +L   A   +  L 
Sbjct: 360 DGLQSAAGSTGDGTLFNAMSAALDR--------RVPCSAADIEGSFSLAGLATEIVSGLS 411

Query: 413 KNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKML 472
            +   +      +    + +        GV+  +EL  L+ +E++Y  + K++   D +L
Sbjct: 412 SSLLSADQEASFASARRDELQVLVL-GDGVDTDKELEQLLLLERAYAANAKVVTACDALL 470

Query: 473 QTLLEG 478
           Q LLE 
Sbjct: 471 QYLLEM 476


>gi|154250318|ref|YP_001411143.1| flagellar hook-associated protein FlgK [Fervidobacterium nodosum
           Rt17-B1]
 gi|154154254|gb|ABS61486.1| flagellar hook-associated protein FlgK [Fervidobacterium nodosum
           Rt17-B1]
          Length = 847

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 56/406 (13%), Positives = 121/406 (29%), Gaps = 27/406 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           SL    N        +      +  NI NA+   + R+                      
Sbjct: 5   SLFGTLNTGLLGVYASKLAMNVVAHNIANANTPGFSRQRPELLTMPPIPITSLTQPAVPL 64

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
                V V   +       D      ++       + S     E + A +       +  
Sbjct: 65  QIGTGVYVRDIKRVRDAFLDIQYRQTNNKYNYWDTITSNLHFVEQLFA-EPSEAGIRYLF 123

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
                 +E    + +     + ++   EE+VQ+       ++++R D D EI      + 
Sbjct: 124 DSFWSGIEEVITDPTNTAAKRGLVSRTEELVQHMQDLYTRLEQLRTDIDNEIAQRTQQIN 183

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
             +  L  +N  ++   + K+  +D LD+RD +L ++S++  I         + +   + 
Sbjct: 184 AMVKRLADINAKVRTAVSLKYTPNDLLDERDRILDELSDLADIYYYEDAAGQITLRLGNQ 243

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             L      D+   +        E           + N   ++  GK+K+L  +RD V+ 
Sbjct: 244 IVLTGQNVVDLRALERPFGKGFKEI---------FAGNSIVSINDGKLKSLFDLRDEVLV 294

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
            + N+LDE A  L   F+       N +            + +      +          
Sbjct: 295 RYMNRLDEFALSLSDEFNLIHQDGFNGDGSVTGLKFFNDIEAERIKDSVLYRLAGAKRVE 354

Query: 345 RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDP 390
               + +       +      K       ++     +   +   +P
Sbjct: 355 NGPINRISGMSDRIEISDITTKPFIEKGAIVFFNGTNKVFSANVNP 400



 Score = 88.9 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 41/92 (44%)

Query: 385 NFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNL 444
           + + +     +   +  EY  + +  L      +  +   + ++   I        GV+L
Sbjct: 748 SALRNKKLLNDGLESFNEYLGSVVAELGVESETAMKIKSNTDLMKKEIDGERERVKGVSL 807

Query: 445 QEELSFLIKVEQSYNISNKLIMFTDKMLQTLL 476
            EE++ +IK +Q++N + +++   D M+  ++
Sbjct: 808 DEEMANMIKYQQAFNAAARVMTAVDDMISRVI 839


>gi|260853472|ref|YP_003227363.1| putative lateral flagellar hook-filament junction protein
           [Escherichia coli O26:H11 str. 11368]
 gi|257752121|dbj|BAI23623.1| predicted lateral flagellar hook-filament junction protein
           [Escherichia coli O26:H11 str. 11368]
 gi|323158097|gb|EFZ44196.1| flagellar hook-associated protein FlgK [Escherichia coli EPECa14]
          Length = 458

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/484 (13%), Positives = 158/484 (32%), Gaps = 39/484 (8%)

Query: 5   AVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI----------SPENVTVVT 54
            + N   +  + A  +     +N  NA    Y R+    +           +   V V +
Sbjct: 2   DMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGASGGSPNSAGNGVQVDS 61

Query: 55  QRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESY 114
            R  +       +   +S  G     Q   +  E + +DD  N+S +        +L   
Sbjct: 62  IRRVSNQYQVNQVWYAASDYGYYSTQQGDLSQLEAVLSDD--NSSLSGGFDNFFAALNEA 119

Query: 115 SKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVN 174
           + +  +  L + VI  A  +    + +   +     +   + +  +S +    S +   N
Sbjct: 120 TTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQAMVSQINTLTSGIASYN 179

Query: 175 DAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRD 234
             I    A+  +A    D RD +++++S ++ +   + +  +  V   +G  L       
Sbjct: 180 QQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNYNVTLKNGQPLVSGQQSS 239

Query: 235 INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMA 294
                  +    ++           +++  +    G + AL   ++ V+    + ++ MA
Sbjct: 240 -----TIALETNADGTSTMSLTFAGTTSTMTTDTGGSLGALFDYQNDVLTPLTDTINSMA 294

Query: 295 RVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDG 354
                + + +     +    PG  +        +               + S+P      
Sbjct: 295 SQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPNITADELAFSSSP------ 348

Query: 355 GSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN 414
                       + +G  D +    +   +      +     +VT+ +   + I  +   
Sbjct: 349 ------------DESGNSDNLQALINISTEPLEIANL----GSVTVGQACSSIISNIGIY 392

Query: 415 RSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQT 474
              +      +  V++      S+  GV++ EE   LI  +Q Y  + K+I    ++  +
Sbjct: 393 SQQNQTEVDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDS 452

Query: 475 LLEG 478
           +LE 
Sbjct: 453 VLEM 456


>gi|307718454|ref|YP_003873986.1| flagellar hook-associated protein [Spirochaeta thermophila DSM
           6192]
 gi|306532179|gb|ADN01713.1| flagellar hook-associated protein [Spirochaeta thermophila DSM
           6192]
          Length = 624

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 61/425 (14%), Positives = 146/425 (34%), Gaps = 29/425 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS--------------- 46
           S        +      +Q  A++  N+ NA  + Y R+                      
Sbjct: 3   STFMSIEIGKRGLLAHTQGLATVGHNMSNASVEGYSRQRVNLEAMDPLYMPGLNREETPG 62

Query: 47  --PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYI 104
              + V++ +       + +  + A ++  G      S+  + E    ++  + S    +
Sbjct: 63  QIGQGVSIQSIERIRDEILEGRIVAQTNVGGYWETRNSYLLMVEKTY-NEPSDVSVRSLL 121

Query: 105 SKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLR 164
               D+ +  S +  E      VI+NA+ +V   +   R +  IR   +++++  +  + 
Sbjct: 122 DAFWDAWQELSIHPDEMAARHAVIENAKALVDGIHERYRALSSIRKMIEEDVQATVKEVN 181

Query: 165 RFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDG 224
            +++ +  +N+ I    A   + +D +D+RD+L++K++++I ++   R+ ++  ++    
Sbjct: 182 DYIARIAHLNEQIVKVKAMGDNPNDLMDRRDLLVEKLAKLINVTVDTRDPDEFTIHVGGR 241

Query: 225 TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVP 284
             +   V      +           N  F   +   S +   +  GK+ ALL++RD  V 
Sbjct: 242 HLVQGKVYHPFALDP-------RPQNEGFSAVLWEGSTEEVRLEGGKLAALLELRDGDVR 294

Query: 285 IFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQY 344
               +LD M   L+   +E    A       G+        + N +              
Sbjct: 295 GEIQKLDTMTVNLVNLVNEVHRNAYGLNGQTGVDFFVEHPAVLNAVGNYDRNGDGEFDST 354

Query: 345 R----SNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
                   + L     V  + +  +        +  +  D+          +G   + + 
Sbjct: 355 YLFRIHGTNPLDPNAQVGIEGVITLSGAEEDVQIAYYPTDTVQDIVNRINTSGAEVSASF 414

Query: 401 LEYAR 405
               R
Sbjct: 415 DRLGR 419



 Score =  113 bits (283), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 100/343 (29%), Gaps = 15/343 (4%)

Query: 142 AREVQKIRADADKEIELEISNLRRFLSELTVVNDA----IKFKTASKHDAHDFLDQRDVL 197
             +V+      D      ++ +         +N         +  +  +A    D+    
Sbjct: 290 DGDVRGEIQKLDTMTVNLVNLVNEVHRNAYGLNGQTGVDFFVEHPAVLNAVGNYDRNGDG 349

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV 257
               + +  I      + +  V      TL      + + +     T T +     I+  
Sbjct: 350 EFDSTYLFRIHGTNPLDPNAQVGIEGVITLSG---AEEDVQIAYYPTDTVQDIVNRINTS 406

Query: 258 VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
               +         +       D   P F  +  E +   +  ++         EN    
Sbjct: 407 GAEVSASFDRLGRLVLKATPSEDVAFPDFVIRHVEDSGQFLSGYAGI-LAGSGPENAYDW 465

Query: 318 FIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNV-KNLAGYPDLIN 376
              DG+  L      G++     +     NP   RD  SV+  F         G      
Sbjct: 466 ETVDGVLTLRGGAEYGVAPFAHPSGWVVLNPEVERDPASVAAGFGQEGRPAPPGDGSAAL 525

Query: 377 HYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESY 436
              +   +         I   +T  +Y   ++  +      +       +++   + +  
Sbjct: 526 AVANLRTEPV------MIGRLMTFDDYFAEAVSEIGLKGQQAQIADETQKLIMKDLKDLR 579

Query: 437 SNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            +  GVN+ EEL+ +IK +  Y  S + I   + ML  L+  +
Sbjct: 580 ESISGVNIDEELAQMIKFQHGYAASARFITTFNSMLDLLINRM 622


>gi|288960285|ref|YP_003450625.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
 gi|288912593|dbj|BAI74081.1| flagellar hook-associated protein 1 [Azospirillum sp. B510]
          Length = 469

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 67/481 (13%), Positives = 155/481 (32%), Gaps = 13/481 (2%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT-ISPENVTVVTQRSEN 59
           MSL A  N A             +  NI  A++ N  R     +  +   V   T R E 
Sbjct: 1   MSLFAALNSATAGLRTVQTSVKLVSDNIAQANDPNRTRHTAQQSVDASGQVISTTYRREV 60

Query: 60  KNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLS 119
                  +   ++  G  ++  ++      +    +       Y +K + ++++ S +  
Sbjct: 61  DTALMGQVMDLTARDGGSQVTSTYMQQLGDLMRTTNGTPLINDYANKFQAAIKTLSTSPE 120

Query: 120 EDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKF 179
           ++     ++  AE   +     +  V+++  +   +I   +  +   L ++  +N+    
Sbjct: 121 DETAQYQLVQTAESFSREIRRVSEGVEQLDRNIKDDIGTSVDKVNDLLKQINQINNDSVS 180

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
                  A+   D+RD L++++S  +GI T+ R +  + ++T  G  L +    ++ ++ 
Sbjct: 181 LQGQGSAANAVADKRDGLVRELSGYMGIRTVERPDGRLAIFTPSGLALVDGQQANLTYD- 239

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
                       I +      ++  + +  GK+ AL+Q+R              +     
Sbjct: 240 ---------GGNINLQVGNQVTSINNHLATGKLGALIQMRKD--GSTTEPPTPASGDPTT 288

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
               K     +             +          +       Q     +          
Sbjct: 289 EIIRKLRSQLDEYAKAFTGPTKPGEPTSFADAYDDASPAAAGEQPNQFFTGNDRFTIAIN 348

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             L +  N      + +           F        + T         G        + 
Sbjct: 349 PKLLDNTNKIKQSAIDDMVTAINAPGRSFSADGLQMKDTTYSAMGSAITGTWMAAAKTAS 408

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
                ++     +SE Y +  GVN+ EE++ L +++ SY  S +++   + M   L   V
Sbjct: 409 TTSESNKASMQLLSERYQSQTGVNIDEEIAQLQQLQTSYQASARVMQVANSMFDALEAVV 468

Query: 480 K 480
           +
Sbjct: 469 R 469


>gi|257457497|ref|ZP_05622665.1| flagellar hook-associated protein FlgK [Treponema vincentii ATCC
           35580]
 gi|257445120|gb|EEV20195.1| flagellar hook-associated protein FlgK [Treponema vincentii ATCC
           35580]
          Length = 625

 Score =  170 bits (431), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 63/353 (17%), Positives = 127/353 (35%), Gaps = 24/353 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT----------------- 43
           MS  A     +       Q   +   NI N+  + Y R+                     
Sbjct: 1   MSTFASIELGKRSLFAHQQSIQTAGHNISNSSTEGYTRQRVQLDSYEPLYRPDLSRAETP 60

Query: 44  TISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
               + V V +       + D+ + A +   G      S+  + E +  ++  + S    
Sbjct: 61  GQIGQGVAVSSITRLRDELLDQRIVAQTDQQGYWETRDSYIYMLEQLY-NEPEDTSVRTR 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           + +  DS +  S           V   A+ +  + +   R +Q IR   + +IE  +  +
Sbjct: 120 LDQFWDSWQELSVYPESTAARSAVATRAKTLTDSVHHQYRGLQGIRDMINGDIEARVKQV 179

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
             F  ++  +N+ I    A   + +D +D+RDVL +K++++I IS    + ++  +  SD
Sbjct: 180 NSFTRQIAALNEEIVKVKAMGDNPNDLMDKRDVLTEKLADLISISVEKVDADESYIIYSD 239

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
           G  L +                +   N  + + V   S   +    G++ AL+++RD  V
Sbjct: 240 GMELVQGR------TFRTFGLKSGTGNEGYANVVWEDSGNLAHFGGGRLAALIELRDGDV 293

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE 336
               N+LD MA   +   ++    A       G+        ++N +      
Sbjct: 294 RDEINKLDTMAMNFVDLVNDIHRNAMGLNGKTGIDFFKEQYFINNTVGNFDRN 346



 Score =  100 bits (247), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/357 (10%), Positives = 94/357 (26%), Gaps = 12/357 (3%)

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDA----IKFK 180
                    +         +V+      D      +  +         +N         +
Sbjct: 273 NLAHFGGGRLAALIELRDGDVRDEINKLDTMAMNFVDLVNDIHRNAMGLNGKTGIDFFKE 332

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
               ++     D+        S I  ++     +    +      TL          +  
Sbjct: 333 QYFINNTVGNFDRNGDGEYDSSYIFRLTGAYSLDPREQIGLEGTLTL---SAGTGTVQVP 389

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGS 300
            + T         I+                +      +D+  P F  +  E +   +  
Sbjct: 390 YASTDMVADLVDRINRSGAEVVAYLDQNNKLVLKGTAAQDTENPDFVIRHVEDSGRFLAG 449

Query: 301 FSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKK 360
           ++     +G                        +S     +     NP  + D  +++  
Sbjct: 450 YAGVLTGSGAENAYDWQQPDAVNVLSQEGAQYAVSPIAHPSGWMEINPVVVSDLQNIAAG 509

Query: 361 FLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHD 420
           +    + +    D       +     I +    +    T  E+   ++  +      S  
Sbjct: 510 YPS-PEGIPYPGDNRAAVAIA----KIRNTPVMVGNTRTFDEFFAEAVTDMGLKGEQSEL 564

Query: 421 LHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
                  +   + +   +  GVN+ EEL+ +IK +  YN + + +   ++ML T++ 
Sbjct: 565 ALNTQTAIGKELRDMRDSISGVNIDEELADIIKFQHGYNATARFVAAVNEMLDTVIN 621


>gi|238916199|ref|YP_002929716.1| flagellar hook-associated protein 1 FlgK [Eubacterium eligens ATCC
           27750]
 gi|238871559|gb|ACR71269.1| flagellar hook-associated protein 1 FlgK [Eubacterium eligens ATCC
           27750]
          Length = 523

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/518 (13%), Positives = 161/518 (31%), Gaps = 43/518 (8%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT------------TISPEN 49
           S       A      A         N+ N + K Y R    T                  
Sbjct: 3   STFFGLTIAYTGLQAAQTSINVTSHNLANINTKGYTRESASTKAADALRTYARYGTLGSG 62

Query: 50  VTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD 109
           V V        + +D+    +++  GQ  +  S+ +  E    ++      +        
Sbjct: 63  VVVDAINQTRDSYYDEKYRNNNTNYGQYNVKNSYMSQIENYL-NEFTLKGYSTEYENFFS 121

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           +L    +  ++      +I+NA+ +   FNT +  ++ ++ DA+ EI+  +  +      
Sbjct: 122 ALNQLDRTPADTSAKNQLINNAKSLTDYFNTLSTNLRNVQVDANNEIKDAVQQINSLAQN 181

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVY---TSDGTT 226
           ++ +N  I    A+  +A+D  DQR+ L+  +S+I+ I+    +  + +     T +G +
Sbjct: 182 ISSLNKQINQIQANYGNANDLKDQRNALIDDLSQIVNITVSESDMGNNLTNLQITINGNS 241

Query: 227 LFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSN---QGSAVPKGKIKALLQIRDSVV 283
           L +                         D    +       S    G++K L+ IRD   
Sbjct: 242 LVDGYNYHTLQTVARENPRNVSDAAGLYDIQWENGQEFYIYSDSLSGELKGLIDIRDGCN 301

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
              +            ++         +E           K +     Q           
Sbjct: 302 GEIEKYASTTDAAGNSTYKTDADGNILTETESQKDKNTQYKGVPYYQSQLNQFIQTFASS 361

Query: 344 Y----------RSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
                        +   +                +     L+++      K  + D  A 
Sbjct: 362 VNEILNKGVTSDGSAQGISLFVMKENSQALTASTVTVNQALLDNADLLATKYNVSDGEAN 421

Query: 394 IN--------------TNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNT 439
           ++                 T   +  + +  +  + S + +       +   I     + 
Sbjct: 422 VDLIVDLINTKDARIYDGGTGSFFLESIVSDMSIDSSKAINFTKNYMNLQTTIQNQRLSV 481

Query: 440 VGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLE 477
           +GV+  EE   L+K +++YN+S+K++   +++   L+ 
Sbjct: 482 MGVDTDEEAMDLVKFQEAYNLSSKMLSVMNELYDRLIN 519


>gi|241113583|ref|YP_002973418.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861791|gb|ACS59457.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 486

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 161/485 (33%), Positives = 255/485 (52%), Gaps = 8/485 (1%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL +  N  Q+I NN  QQ + I  NI N  N +YVRR+   T S     VV+     +
Sbjct: 1   MSLTSALNSVQSIFNNTGQQSSVISTNIANVGNSDYVRREASVTTSLSGAQVVSISRAQE 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
                     ++    Q+ L +     + +   + Y  SP+ Y++  + +L+++  + S 
Sbjct: 61  TALLAQYLQTNAKDSAQQTLVTGLESLKSLVGGNDYETSPSTYLTAFQQALQTFGTSPSS 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
               ++ +  A+++  + NT++  VQ IRA+AD EI  ++S L   LS+    N+A+K  
Sbjct: 121 TTAAQSAVTAAQDLANSLNTASDGVQSIRAEADAEIATQVSTLNTLLSQFEAANNAVKLA 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           TA+  D    LD+R+ LL++IS I+G+++ VR+NNDM +YTSDGT LFET+PR + F   
Sbjct: 181 TATGTDTSSALDEREKLLKQISSIVGVTSTVRDNNDMALYTSDGTVLFETIPRTVTFAPT 240

Query: 241 NSYTVTSESNPIFIDGVVVSSNQGSAVP-KGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +Y   +E N I+IDGV + + +GS     G ++ALLQ+RD + P FQ QLDE+A+ L+ 
Sbjct: 241 ATYVAGTEGNSIYIDGVALDAGEGSTTSASGSLQALLQLRDEIAPTFQAQLDEIAKSLVQ 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKL------CQGISETICVNPQYRSNPSFLRD 353
            FSE D              +                   IS  + V      + + LRD
Sbjct: 301 IFSETDGSTSAPGLFVWTTASGATGATPAASDDTTGIASTISVNLAVVTSEGGDATKLRD 360

Query: 354 GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEK 413
            GS+S     N    +G+ D ++    +  +   F   AG++T+ +L +YA  SIGWLE+
Sbjct: 361 -GSISGITDLNTAGDSGFSDNLDALYQALTEQRSFSSDAGLSTSQSLTDYASASIGWLEQ 419

Query: 414 NRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQ 473
            RSD+      +    +   E+YSN  GVNL EEL+ L+ +EQSY  + K++   D+M Q
Sbjct: 420 YRSDATSASETTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKILNVIDEMFQ 479

Query: 474 TLLEG 478
           +LL+ 
Sbjct: 480 SLLDI 484


>gi|260768775|ref|ZP_05877709.1| flagellar hook-associated protein FlgK [Vibrio furnissii CIP
           102972]
 gi|260616805|gb|EEX41990.1| flagellar hook-associated protein FlgK [Vibrio furnissii CIP
           102972]
 gi|315180478|gb|ADT87392.1| hypothetical flagellar hook-associated protein [Vibrio furnissii
           NCTC 11218]
          Length = 456

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 66/488 (13%), Positives = 158/488 (32%), Gaps = 43/488 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTT----------ISPENV 50
           MS+    N A +             +N  N ++  Y R+    +           +   V
Sbjct: 1   MSMY---NIALSGAMANQVAMNVTAQNTANINSAGYSRKVVDQSAVIYGNAGPNSAGSGV 57

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
           +V + R  +     + L + ++ +       S     E +   +  N S    ++    +
Sbjct: 58  SVTSIRRVSDQAAVERLRSANTELQHHLAFMSGMKNIESVLGMEGLNVSLG--LNDFFAA 115

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           LE  + +    +    V+ NA+ +   FN +  ++      A ++    ++ +   L  +
Sbjct: 116 LEESTLSPESLVYRTQVLANAKSLSARFNGTMNQLSNHLNTAIQQQSTTLTQVNSQLQNV 175

Query: 171 TVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFET 230
             +N+ I+  +A  HD   + D  D  L  +S+ +GI+ +   +  + + T  G  L   
Sbjct: 176 ATLNEQIRLASAKGHDISAYQDALDTELSLVSQSMGINVLYNQDGTVELATQSGQPLVVG 235

Query: 231 VPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQL 290
                     +S    S    +  +G   +         G++ A+  +++        QL
Sbjct: 236 SHVAQLSVDTSSGDKYSTEITVRFNGESFAFKD---PKGGELGAIDTLKNEQYLPIMAQL 292

Query: 291 DEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
           ++MA     + +       +    PG  +                               
Sbjct: 293 NDMAAGFADAVNALLMTGTDLNGNPGQPLFTYDPANPAST-------------------- 332

Query: 351 LRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGW 410
           L      + +  ++     G  D+        N+    +        V + +     +G 
Sbjct: 333 LSVSNITAAELAFSSNGSVGNADIATELAKLANQPIDIN-----GEQVNIYDVYAQMLGT 387

Query: 411 LEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDK 470
           +      +   +  + +       +  +   V+  EE + L+    +Y+ + K+I   ++
Sbjct: 388 VGVVSQKAQGDYKAAMIGLTEAQSARDSISAVSSNEEAANLMMYMNAYSANMKVIATANQ 447

Query: 471 MLQTLLEG 478
           M  T+L  
Sbjct: 448 MFDTVLNS 455


>gi|292492369|ref|YP_003527808.1| flagellar hook-associated protein FlgK [Nitrosococcus halophilus
           Nc4]
 gi|291580964|gb|ADE15421.1| flagellar hook-associated protein FlgK [Nitrosococcus halophilus
           Nc4]
          Length = 647

 Score =  170 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 60/470 (12%), Positives = 149/470 (31%), Gaps = 31/470 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENV 50
           M+     +   +      +  A+   NI N +   + R+ T  + S             V
Sbjct: 1   MATGDPLSIGLSGLLAMQRSLATTSHNIANVNTPGFSRQRTELSASLPESTAKGFIGTGV 60

Query: 51  TVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDS 110
            V T R        + +  ++S   Q        A  + + AD       +  + +  +S
Sbjct: 61  NVATVRRAYDAFLTEQVQGYTSEYAQFETFHDLAAQIDNLFADP--EAGLSSSLQQFFNS 118

Query: 111 LESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSEL 170
           ++  + + S     +T++   E +   F+     ++ +    + ++   +  +    S +
Sbjct: 119 MQEMADDPSALAARQTLLTEGEVLAARFHFLDGRLRDLHDSVNTQLRDTVVEVNTLTSSI 178

Query: 171 TVVNDAI--KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLF 228
             +N  I           A+DFLDQRD L+ ++++ + ++ + ++N  + V   +G  + 
Sbjct: 179 AKLNQRIFESHGQNGSQSANDFLDQRDQLIGELAQKVAVTVLPQDNGMLNVLIGNGQPMV 238

Query: 229 ETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQN 288
                       + Y  +            +  N  + +  G++ ALL  RD  +   +N
Sbjct: 239 VGNHNSKLAILSDPYDSSRLDIGYTTGSDAL--NISNHITGGELGALLSFRDQALEPSRN 296

Query: 289 QLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDL--------DNKLCQGISETICV 340
           QL ++A  +  +F+ +  +  + +   G      I           DN     +  T+  
Sbjct: 297 QLGQLALGITQTFNAQHHLGMDLKGELGRDFFSPIDSSAPVSLPRADNTGDGVVEITVSD 356

Query: 341 NPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTL 400
             +   +   L   G        +   +    +                  +  + +  L
Sbjct: 357 ASKLTDSDYRLERDGVSYTLTRLSDNQVYSLTNFPGGTETVDGLTLDLTAGSMDSGDSYL 416

Query: 401 -------LEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVN 443
                   +     +    +  + +      +         S ++    N
Sbjct: 417 IQPTREAAQNFGVMLTDASRIAAAAPIRTEANLGNKGTGQISAASVTNTN 466



 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 54/377 (14%), Positives = 109/377 (28%), Gaps = 23/377 (6%)

Query: 110 SLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSE 169
           S    +   S + LG+  +   +      +       ++  D    I+            
Sbjct: 285 SFRDQALEPSRNQLGQLALGITQTFNAQHHLGMDLKGELGRDFFSPIDSSAPVSLPRADN 344

Query: 170 LTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFE 229
                  I    ASK    D+  +RD +   ++ +         N      T DG TL  
Sbjct: 345 TGDGVVEITVSDASKLTDSDYRLERDGVSYTLTRLSDNQVYSLTNFPGGTETVDGLTLDL 404

Query: 230 TVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQ 289
           T     + +          +    +                +I A   IR       +  
Sbjct: 405 TAGSMDSGDSYLIQPTREAAQNFGV----------MLTDASRIAAAAPIR------TEAN 448

Query: 290 LDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPS 349
           L       I + S  +           + ++         +  G    +  +P    +  
Sbjct: 449 LGNKGTGQISAASVTNTNGLPLPVNGQITLSYDEATQQFNVNGGPGGLLSYDPATEGDGK 508

Query: 350 FLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGI-------NTNVTLLE 402
                      F  +     G   +I++     + N     +AG+           T  E
Sbjct: 509 EFTFPTLGGITFTISGTPADGDNFVIHNNTGGVSDNRNALAIAGLQTESSLQGETATYQE 568

Query: 403 YARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISN 462
           +    +  +      +      S  + +   E+     GVNL+EE + L++ +Q++  + 
Sbjct: 569 HYSRLVVDVGVRTRQAEVNRDTSGALLDQAVEAREGVSGVNLEEEAANLLRFQQAFQAAA 628

Query: 463 KLIMFTDKMLQTLLEGV 479
           ++I   D M Q+LL  V
Sbjct: 629 RVISVADDMFQSLLGAV 645


>gi|15642858|ref|NP_227899.1| flagellar hook-associated protein 1 [Thermotoga maritima MSB8]
 gi|4980572|gb|AAD35177.1|AE001695_3 flagellar hook-associated protein 1 [Thermotoga maritima MSB8]
          Length = 858

 Score =  170 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 57/446 (12%), Positives = 131/446 (29%), Gaps = 30/446 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           MS+  + N A    +        +  NI NA    Y R+  +                  
Sbjct: 4   MSMFGILNTALTGIHAHKLAMNIVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQPSFP 63

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
                   V T         D      ++       + S     E + A +   +     
Sbjct: 64  LQMGTGARVKTIVRLRDAFLDVQYRQVNNRYNYWDTVLSNLHFIEQLLA-EPGEDGIRSL 122

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           +    ++ +    + S       V+  A+++V         ++++R D D EI   +S +
Sbjct: 123 VDNFWNAFKEVMSDPSSTASKAEVVSRAQQMVSQIKDLYGRLEQLREDIDAEIVQRVSEI 182

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
            + +  L  +N+ I+         +D LD+RD +L ++S +  I+     +  + +   +
Sbjct: 183 NQMIKRLADLNNKIRTSMMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQITLRIGN 242

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
              L  +  R++   +          + +F+    +          GK+KAL+ +RDS +
Sbjct: 243 QIVLNGSTYRELRALER---PYGKGYHELFVGNSQLIL------SDGKLKALIDLRDSSI 293

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQ 343
             +  +LDE    +  S +        S  V          +  +              +
Sbjct: 294 VKYMRKLDEFVLFITDSLNLVHRDGFESNGVTTNLNFFKKIEAFSDDPSIFRIKGNRKLE 353

Query: 344 YRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEY 403
                +               ++      + +    D  + N +         ++     
Sbjct: 354 MGPYHTVTGLHS---ANSQAEIEGRRFNSNDVVLSFDGGSSNVLNISAGTTIGDLVGSWN 410

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVF 429
              +   +  +          S    
Sbjct: 411 LLGTSLKVGTHAGGYRLYLEDSTGSL 436



 Score =  110 bits (273), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 61/436 (13%), Positives = 120/436 (27%), Gaps = 35/436 (8%)

Query: 74  IGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEE 133
           +  +    S      +   D                  ES    LS  +    V    E+
Sbjct: 427 LYLEDSTGSLRNRLFLSLGDSLSQMGFDTETKGYITIKESDLSGLSSGVYNINVEYILED 486

Query: 134 VVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQ 193
             +   T + ++      ++ E       +         +               D    
Sbjct: 487 GTRQTETISVDLSSGVNLSNIEAS-----INSSSHLRAQIYADPSTGENMLVIVPDEQLN 541

Query: 194 RDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIF 253
            D    K+       T                TL         F+    +T+T  S  I 
Sbjct: 542 FDPSAVKVLSDDDFFTESNAFVRNYEVLKYKDTLENIFYGQTGFDPTRPFTITINSTDIE 601

Query: 254 IDGVVVSSNQGSAVPKGKIKALLQ---------IRDSVVPIFQNQLDEM--ARVLIGSFS 302
           ID  V +          K   +L           R S +  F  ++ E+   +    +  
Sbjct: 602 IDPAVDTLETLVEKINEKNTGVLADLTPHHSLVFRASSLYDFDLRMMEIKGPQGFFEAVG 661

Query: 303 EKDPIAGNSENVPGLFIADGIKDLDNKLC---QGISETICVNPQYRSNPSFLRDGGSVSK 359
             DP    +            K  D         +++ +  +      P  + +   VS 
Sbjct: 662 FVDPDGDPTTFDWNTSFTLVSKSDDFTTLSERFKVADILTFDRAPYDEPLNIVNQFEVSS 721

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG----------------INTNVTLLEY 403
               N  NLA          D    +      A                  N   +  E+
Sbjct: 722 SLATNPANLAVDVGYALENSDWNATSIKPSGGANPELLETIQNLYTRKMLSNGKESFYEF 781

Query: 404 ARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNK 463
               +  L      + +L   ++++   I  +     GV+L EE++ +I+ + +++ + K
Sbjct: 782 FGGVVSELGVEAETASNLKNNTEILRQEIDNAREEVKGVSLDEEMANMIEYQHAFSAAAK 841

Query: 464 LIMFTDKMLQTLLEGV 479
           +I   D+M+QT++  V
Sbjct: 842 VITAVDQMIQTVINMV 857


>gi|42527853|ref|NP_972951.1| flagellar hook-associated protein FlgK [Treponema denticola ATCC
           35405]
 gi|41818681|gb|AAS12870.1| flagellar hook-associated protein FlgK [Treponema denticola ATCC
           35405]
          Length = 623

 Score =  170 bits (429), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 63/354 (17%), Positives = 127/354 (35%), Gaps = 26/354 (7%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           M+        +       Q   +   NI N+  K Y R+                     
Sbjct: 1   MATFDAIELGKRSLFAHQQSIQTAGHNISNSSTKGYTRQRVNLEAFEPIYRPDLTRAETP 60

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
               + VT+ +       + D+ +   +  +G      S+ AL E +  ++  + S    
Sbjct: 61  GQIGQGVTIASITRLRDELLDQRIIGATDDLGYWETRNSYIALLEQVH-NEPEDISVRTR 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           + +  ++ +  S     D   + V    E +    +   R +Q IR     +IE  +  +
Sbjct: 120 MDQFWEAWQELSLYPESDAARQVVRTRTETLTDAIHHQFRGLQGIRDMVHGDIEATVKQV 179

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
                 +  +N+ I    A   + +D +D+RD+L +K+S +I IS   R+ ++  V  + 
Sbjct: 180 NDLTGRIAKLNEEIVKVKAMGDNPNDLMDKRDLLTEKLSSLIDISVDKRDEDETYVIHTA 239

Query: 224 G-TTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
           G   +     R  NF+        S  N  + D +   S   +    GK+ AL+++RD+ 
Sbjct: 240 GLEIVQGRTHRTFNFKA-------STENDKYADVIWEDSGNLAHFESGKLAALIELRDTD 292

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE 336
           +     +LD M    +   ++    A +     G+        ++N L      
Sbjct: 293 IRDEIRKLDTMTMNFVDLVNDVHRNAMSPNGKTGIDFFKEQYFINNTLGNFDRN 346



 Score =  104 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/342 (10%), Positives = 87/342 (25%), Gaps = 14/342 (4%)

Query: 142 AREVQKIRADADKEIELEISNLRRFLSELTVVNDA----IKFKTASKHDAHDFLDQRDVL 197
             +++      D      +  +          N         +    ++     D+    
Sbjct: 290 DTDIRDEIRKLDTMTMNFVDLVNDVHRNAMSPNGKTGIDFFKEQYFINNTLGNFDRNGDG 349

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV 257
               S I  I+     +    +      TL       +      S  + S+         
Sbjct: 350 EYDYSYIFRITGTNTLDPREQIGLEGTLTLSSGDG--LVQVPYYSTDMVSDLVERINRSG 407

Query: 258 VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
              +       K  +K +  +           +++  R L G                  
Sbjct: 408 SEVAAYLDQNNKLVLKGMTSLDKENPDFVIRHIEDSGRFLAGYSGVLSQAG----PEGAY 463

Query: 318 FIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
                         Q     I     +      ++             + +A   D    
Sbjct: 464 DWGRANAVDVLAGAQYAVSPIAHPSGWMEINPVIKSDIQNIASGYKGPEGVAYPGDNRAA 523

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
                    I +    +  + T  ++  +++  +      +         +   + +   
Sbjct: 524 ----LAIAAIRNTPVMVGHSATFDDFFADTVTEIGLKGEQAEMTLNTQIAIVKELHDMRD 579

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +  GVN+ EELS +IK +  YN S + +   ++M+ T++  +
Sbjct: 580 SVSGVNIDEELSDIIKFQHGYNASARFVSVINEMIDTVINRM 621


>gi|325474917|gb|EGC78103.1| flagellar hook-associated protein FlgK [Treponema denticola F0402]
          Length = 623

 Score =  170 bits (429), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 65/423 (15%), Positives = 138/423 (32%), Gaps = 28/423 (6%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI--------------- 45
           M+        +       Q   +   NI N+  K Y R+                     
Sbjct: 1   MATFDAIELGKRSLFAHQQSIQTAGHNISNSSTKGYTRQRVNLEAFEPIYRPDLTRAETP 60

Query: 46  --SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHY 103
               + VT+ +       + D+ +   +  +G      S+ AL E +  ++  + S    
Sbjct: 61  GQIGQGVTIASITRLRDELLDQRIIGATDDLGYWETRNSYIALLEQVH-NEPEDISVRTR 119

Query: 104 ISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNL 163
           + +  ++ +  S     D   + V    E +    +   R +Q IR     +IE  +  +
Sbjct: 120 MDQFWEAWQELSLYPESDAARQVVRTRTETLTDAIHHQFRGLQGIRDMVHGDIEATVKQV 179

Query: 164 RRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSD 223
                 +  +N+ I    A   + +D +D+RD+L +K+S +I IS   R+ ++  V  + 
Sbjct: 180 NDLTGRIAKLNEEIVKVKAMGDNPNDLMDKRDLLTEKLSSLIDISVDKRDEDETYVIHTA 239

Query: 224 GTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVV 283
           G  + +                 S  N  + D +   S   +    GK+ AL+++RD  +
Sbjct: 240 GLEIVQGRTH------RTFDFRASTENDKYADVIWEDSGNLAHFESGKLAALIELRDKDI 293

Query: 284 PIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISE----TIC 339
                +LD M    +   ++    A +     G+        ++N L             
Sbjct: 294 RDEIRKLDTMTMNFVDLVNDVHRNAMSPNGKTGIDFFKEQYFINNTLGNFDRNGDGEYDS 353

Query: 340 VNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVT 399
                 +  + L     +  +      +  G   +  +  D  +        +G      
Sbjct: 354 SYIFRITGTNTLDPREQIGLEGTLTFSSGDGIVQVPYYSTDMVSDLVERINRSGSEVAAY 413

Query: 400 LLE 402
           L +
Sbjct: 414 LDQ 416



 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/342 (10%), Positives = 87/342 (25%), Gaps = 14/342 (4%)

Query: 142 AREVQKIRADADKEIELEISNLRRFLSELTVVNDA----IKFKTASKHDAHDFLDQRDVL 197
            ++++      D      +  +          N         +    ++     D+    
Sbjct: 290 DKDIRDEIRKLDTMTMNFVDLVNDVHRNAMSPNGKTGIDFFKEQYFINNTLGNFDRNGDG 349

Query: 198 LQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGV 257
               S I  I+     +    +      T        I      S  + S+         
Sbjct: 350 EYDSSYIFRITGTNTLDPREQIGLEGTLTFSSGDG--IVQVPYYSTDMVSDLVERINRSG 407

Query: 258 VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGL 317
              +       K  +K +  +           +++  R L G                  
Sbjct: 408 SEVAAYLDQNNKLVLKGMTSLDKENPDFVIRHIEDSGRFLAGYSGVLSQAG----PEGAY 463

Query: 318 FIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINH 377
                         Q     I     +      ++             + +A   D    
Sbjct: 464 DWGRANAVDVLAGAQYAVSPIAHPSGWMEINPVIKSDIQNIASGYKGPEGVAYPGDNRAA 523

Query: 378 YCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYS 437
                    I +    +  + T  ++  +++  +      +         +   + +   
Sbjct: 524 ----LAIAAIRNTPVMVGRSATFDDFFADTVTEIGLKGEQAEMTLNTQIAIVKELHDMRD 579

Query: 438 NTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           +  GVN+ EELS +IK +  YN S + +   ++M+ T++  +
Sbjct: 580 SVSGVNIDEELSDIIKFQHGYNASARFVSVINEMIDTVINRM 621


>gi|121997313|ref|YP_001002100.1| flagellar hook-associated protein FlgK [Halorhodospira halophila
           SL1]
 gi|121588718|gb|ABM61298.1| flagellar hook-associated protein FlgK [Halorhodospira halophila
           SL1]
          Length = 685

 Score =  170 bits (429), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 55/406 (13%), Positives = 138/406 (33%), Gaps = 19/406 (4%)

Query: 3   LLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS----------PENVTV 52
           ++ +     +    + +  A+   NI N +   Y R+      S               V
Sbjct: 1   MVDILQTGISGLRASQRGLATTSHNISNVNTDGYSRQRVEQDTSIPHYHSRGAIGTGTQV 60

Query: 53  VTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLE 112
            T +  +++     L  + +   +   L       + + AD   +   +  + +  D++E
Sbjct: 61  QTIQRLSEDHRVDALRNNHAEYERLDRLAEMTGRIDNLVADQ--DAGLSPSLRQFFDAVE 118

Query: 113 SYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTV 172
             + + S  +  + ++   + +   F+T    +  +  D +K +  E   +      +  
Sbjct: 119 EVANDPSNTVSRQQLLTQGQALADRFHTLDNRLLTLEEDVNKRVRAEADKINGLAESIAE 178

Query: 173 VNDAI-KFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETV 231
           +N  I    T  +   +D LDQRD  ++++SE + +    +++  + V   +G  L    
Sbjct: 179 LNGEIRSRWTNPQRPPNDLLDQRDEKIRQLSEHVTVRVTEQDDRSLNVGIGNGQPLVTGD 238

Query: 232 PRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
             +      N++        + +          SAV  G +  LL+ R+ V+   ++++ 
Sbjct: 239 RANTLEVTRNAFDPERP--ELAVRRGDREVQITSAVQGGSLGGLLEFRNGVLDETRDEIG 296

Query: 292 EMARVLIGSFSEKDPIAGNSE-NVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSF 350
            +A  L G+ +E+       +   P           +  +           PQ   +   
Sbjct: 297 RVATSLAGAMNEQHRSGIQFDSGYPEAGDDFFDYAREAGVSAHRGNAGDGQPQVVIDEER 356

Query: 351 LRD---GGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAG 393
           + D       ++     ++ L    + +       + +   D   G
Sbjct: 357 IGDLRRENYQARVVDGQLQVLTEDTNEVRTLGTGEDADIQPDADGG 402



 Score = 86.6 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 49/431 (11%), Positives = 111/431 (25%), Gaps = 8/431 (1%)

Query: 54  TQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLES 113
             R  ++ +         S  G                       S    +++   S   
Sbjct: 258 AVRRGDREVQITSAVQGGSLGGLLEFRNGVLDETRDEIGRVA--TSLAGAMNEQHRS--G 313

Query: 114 YSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVV 173
              +      G    D A E   + +       + +   D+E   ++         +   
Sbjct: 314 IQFDSGYPEAGDDFFDYAREAGVSAHRGNAGDGQPQVVIDEERIGDLRRENYQARVVDGQ 373

Query: 174 NDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPR 233
              +   T          D                 +   + +          L E    
Sbjct: 374 LQVLTEDTNEVRTLGTGEDADIQPDADGGYRFDGLILYPPDPEAGDLQEGDRFLIEPTRN 433

Query: 234 DINFEKM--NSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLD 291
                +   +  T  + + P+          Q     + +I      R   V     +  
Sbjct: 434 AAQGIEGRLSRPTQVAAAAPVVTGEAPREDGQTENTGRARIGPPDVGRADGVMAALEEGG 493

Query: 292 EMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFL 351
            + + +  ++S+                    +D +      +SE +       +     
Sbjct: 494 ALQQGVEMTYSDDGTFNVTIGGDTVGTFEYDPEDPERGQVVNLSEDVEPVSGAAAEALAE 553

Query: 352 RDGGSVSKKFLWNVK--NLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIG 409
            D          +     L G  + +    ++     + +     N N T  E     +G
Sbjct: 554 LDISVRISGVPDDGDRFGLYGNYEGVGDNTNALRMAELMEDTVMDNGNSTFQEAYSAMVG 613

Query: 410 WLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTD 469
            L              + + N   E +    GVNL EE + +++ +Q+Y  + ++I   D
Sbjct: 614 ELGGFSQRVQTNRDAQEALLNQAKEQWEELSGVNLDEEAANMMEYQQAYQAAAQIITSAD 673

Query: 470 KMLQTLLEGVK 480
           ++ Q +L  V+
Sbjct: 674 EVFQEMLNAVR 684


>gi|225569938|ref|ZP_03778963.1| hypothetical protein CLOHYLEM_06033 [Clostridium hylemonae DSM
           15053]
 gi|225161408|gb|EEG74027.1| hypothetical protein CLOHYLEM_06033 [Clostridium hylemonae DSM
           15053]
          Length = 515

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/506 (13%), Positives = 145/506 (28%), Gaps = 31/506 (6%)

Query: 2   SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTI---------------- 45
           S  A F  AQ   +   +      +N+ N +   Y R+                      
Sbjct: 4   STFAGFTMAQQALSANQRAIDVAGQNLSNINTPGYTRQRLDLASISPVGASFSSSVYDNK 63

Query: 46  SPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYIS 105
             + V +           D       + +G              +  D+  + +     +
Sbjct: 64  VGQGVMMKGISQIRDPFLDIQYRNQIAKVGTADAEDQILERLGEIF-DETDSAAVREAFN 122

Query: 106 KLRDSLESYSKNLSEDILGKTVI--DNAEEVVQNFNTSAREVQKIRADADKEIELEI-SN 162
            +   L++ +            +   + E ++   +  A  V  +  +  K++   +  N
Sbjct: 123 NVITQLKNMANPQDGGASSTDALVRSSFEVLINAIHEKANAVDALEEEMIKKMTDSVIPN 182

Query: 163 LRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTS 222
           +   L+E+  +N+ IK      + A +  D+R+ LL  ++  + I    R +        
Sbjct: 183 INTCLNEIKNLNEEIKNSQILGNPALELQDERNKLLDDLATYLPIEVSYRTDTSGGEPID 242

Query: 223 DGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSV 282
                F       +    ++       +      V +          G       I++ V
Sbjct: 243 LLDVTFRDSAGTKHTLISDTKIGEFHFDGTGGIPVSLEVTDALNPGGGASDITDLIQNGV 302

Query: 283 VPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNP 342
           +    + L++                G  +               + L +    +    P
Sbjct: 303 LKGNIDMLNKAEIFDGTDTKGIGYYRGMFDAFVNKLATVMNDLNGDALFEKSDGSGADQP 362

Query: 343 QYRSNPSFLRDGGSVS-----KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINT- 396
              SN        + +               +     +    ++   +     V   +  
Sbjct: 363 FTASNIKVSEGWMNGTVSIKKSDGAVGGTGPSTEYKNVQLMINALISDKQVFTVKRPDGA 422

Query: 397 -----NVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFL 451
                  T+     N        R  S  +      V N IS+S     GVN+ EE+  L
Sbjct: 423 DVTVFTGTIQNCYDNIQNVQAIERKASASILKNHLTVLNQISDSRDAVSGVNMDEEVMDL 482

Query: 452 IKVEQSYNISNKLIMFTDKMLQTLLE 477
           ++  QSYN +++L+   D+ML  L+ 
Sbjct: 483 MRYHQSYNAASRLMTTMDEMLDKLIN 508


>gi|281418803|ref|ZP_06249822.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           JW20]
 gi|281407887|gb|EFB38146.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           JW20]
          Length = 519

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 78/520 (15%), Positives = 182/520 (35%), Gaps = 44/520 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PE 48
           MS    FN A      A +    I  NI N +   Y R+  + + S              
Sbjct: 1   MSSFFGFNVAVKGLFTAQRNMDIINHNINNVNTPGYSRQVAIQSASNPISLLNGTGMLGT 60

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
              V+          D    + + + G+    ++  A  E+   ++  ++     I+   
Sbjct: 61  GSEVLAIERIRDEYLDYKYWSENISYGEWNAKRTLLADMEVTF-NEPSDSGFNAVINSFY 119

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  +K+ S D +   V +      + FN  A   ++++ D + +++  ++ +    +
Sbjct: 120 NSLQELAKDPSSDAIRALVKEQGVTFARYFNNIASHFEELQFDINNQVKTVVTEINSLGT 179

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV--------RNNNDMVVY 220
           ++  +N  I       + A+D  D+R +L+ ++S+++ I              ++  ++ 
Sbjct: 180 QIAQLNKQIYTAELDGNTANDLRDKRTLLIDELSKLVNIDVNEVVVGKLPNGKDDKRMII 239

Query: 221 TSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRD 280
           T  G    +    +    K     +  E +   +  V+       +V  G++K LL +RD
Sbjct: 240 TISGKAFVDNFDVNKLTIKQRENKLNEEEDIPNLYEVLWEDGNSLSVRGGELKGLLDVRD 299

Query: 281 S-----------VVPIFQNQLDEMARVLIGSFSEK---------DPIAGNSENVPGLFIA 320
                        +P +  +L+E  R    +F+E                +    G+   
Sbjct: 300 GNDGENGSPNYKGIPYYIRKLNEFVRTFAIAFNEGIVGNDKVAGHVDGYGTNGNTGIRFF 359

Query: 321 DGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLA-GYPDLINHYC 379
             + + +  +      +                  +VS   L + +N+A           
Sbjct: 360 TILGEENKPISSADFMSAGDIDACYG--KMTAKNFTVSSDILDDPRNIATADTKEQVGNI 417

Query: 380 DSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNT 439
            + N          +       ++ ++ I  L  +   +  L    + +   +     + 
Sbjct: 418 GNINSILAMRNNVHMFKEGAPEDFVKSVITTLAIDSQQTIRLSSIHKNMIEQVENQRMSV 477

Query: 440 VGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
            GV+L EE++ L+K  Q+Y  + ++I    ++   L+  V
Sbjct: 478 SGVSLDEEVANLVKHHQAYAAAAQMINTMAEVYDILINRV 517


>gi|125974728|ref|YP_001038638.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           ATCC 27405]
 gi|256005261|ref|ZP_05430228.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 2360]
 gi|125714953|gb|ABN53445.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           ATCC 27405]
 gi|255990812|gb|EEU00927.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 2360]
 gi|316941862|gb|ADU75896.1| flagellar hook-associated protein FlgK [Clostridium thermocellum
           DSM 1313]
          Length = 519

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 78/520 (15%), Positives = 182/520 (35%), Gaps = 44/520 (8%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------------PE 48
           MS    FN A      A +    I  NI N +   Y R+  + + S              
Sbjct: 1   MSSFFGFNVAVKGLFTAQRNMDIINHNINNVNTPGYSRQVAIQSASNPISLLNGTGMLGT 60

Query: 49  NVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLR 108
              V+          D    + + + G+    ++  A  E+   ++  ++     I+   
Sbjct: 61  GSEVLAIERIRDEYLDYKYWSENISYGEWNAKRTLLADMEVTF-NEPSDSGFNAVINSFY 119

Query: 109 DSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLS 168
           +SL+  +K+ S D +   V +      + FN  A   ++++ D + +++  ++ +    +
Sbjct: 120 NSLQELAKDPSSDAIRALVKEQGVTFARYFNNIASHFEELQFDINNQVKTVVTEINSLGT 179

Query: 169 ELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIV--------RNNNDMVVY 220
           ++  +N  I       + A