RPSBLAST alignment for GI: 254780524 and conserved domain: PRK05683

>gnl|CDD|168176 PRK05683, flgK, flagellar hook-associated protein FlgK; Validated. Length = 676
 Score = 43.2 bits (102), Expect = 2e-04
 Identities = 59/301 (19%), Positives = 127/301 (42%), Gaps = 32/301 (10%)

Query: 16  NASQQ-FASIVRNIENADNKNYVRRDTM-TTISPENVTVV-----TQRSENKNMFDKVLH 68
            ASQ   A    NI N D   Y R+ T+ TT + +          T  ++ + +++  L 
Sbjct: 12  GASQTALAVTGNNIANVDTAGYSRQQTVQTTKASQQSGAGYIGTGTTLADVRRIYNSFLD 71

Query: 69  AH-SSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRD---SLESYSKNLSEDILG 124
               +A        ++  L ++   D   ++S T     L+    +L++ + N ++    
Sbjct: 72  TQLRTATSLNSDASAY--LGQISQLDKLLSDSTTGISPALQRFFTALQTAAANPTDTAAR 129

Query: 125 KTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASK 184
           + ++  A+ + + FN+ + ++ +  ++ + ++      +    + +   N  I   +AS 
Sbjct: 130 QLLLTQAQGLSKRFNSLSSQLNQQNSNINSQLSAMTDQVNNLTTSIASYNKQIAQASASG 189

Query: 185 HDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTL--------FETVPRDIN 236
              +D LD RD  +++++E++G++ + R+ N   VY   G  L           VP    
Sbjct: 190 ATPNDLLDARDEAVRQLNELVGVTVVERDGN-YDVYIGSGQPLVVGNTANTLSVVP---- 244

Query: 237 FEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARV 296
                  +  S  N + ++    + +  S V  G+I  LL+ R  V+    N+L  +A V
Sbjct: 245 -----GPSDPSRYN-VQLNRGSSTQDVTSVVSGGEIGGLLRYRSDVLDPAMNELGRLALV 298

Query: 297 L 297
           +
Sbjct: 299 V 299