HHsearch alignment for GI: 254780525 and conserved domain: COG1558

>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion].
Probab=97.89  E-value=4e-05  Score=50.29  Aligned_cols=48  Identities=27%  Similarity=0.504  Sum_probs=44.1

Q ss_pred             EECCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             523100047789999999999999999999999999999999975129
Q gi|254780525|r  374 FSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR  421 (421)
Q Consensus       374 ~~~~le~SgVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLlnl~R  421 (421)
T Consensus        90 ~~GYV~~PNVn~v~EM~dmisAsRsYeANv~v~~~~K~m~~~tL~i~~  137 (137)
T COG1558          90 AKGYVKMPNVNVVIEMVDMISASRSYEANVEVLNTAKSMMQKTLELGQ  137 (137)
T ss_pred             CCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             367556587658999999999999899999999999999999997519