HHsearch alignment for GI: 254780525 and conserved domain: PRK06665

>PRK06665 flgK flagellar hook-associated protein FlgK; Validated.
Probab=100.00  E-value=0  Score=316.59  Aligned_cols=76  Identities=13%  Similarity=0.216  Sum_probs=66.9

Q ss_pred             CC-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHC-------CCCCCCCCCCEEEEEEEEEECCC
Q ss_conf             94-45889999999999998637887753027786714220024654304-------77776312205885788630341
Q gi|254780525|r    1 MG-ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP-------STSNSYVSGGLEISTKDMISEQG   72 (421)
Q Consensus         1 MS-l~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~-------~~~~~~~G~GV~v~~i~r~~~~~   72 (421)
T Consensus         1 M~s~F~~L~ig~sgL~a~Q~aL~ttg~NIANvnT~GYsRQ~v~~~a~~p~~~~~~~~~~~~G~~G~GV~v~~I~R~~D~f   80 (628)
T PRK06665          1 MDSTFSGIEIGKRSLFAHKQAMQTTGHNISNASKPGYSRQRVTMKTEDPLYAPQLNRANKPGQIGQGVTIQSIERVRDEL   80 (628)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEEEEHHHHH
T ss_conf             98524269999999999999999885766417998805217664123664456545455678767888972798715189


Q ss_pred             CEEE
Q ss_conf             1121
Q gi|254780525|r   73 SLMH   76 (421)
Q Consensus        73 ~~~~   76 (421)
T Consensus        81 l~~q   84 (628)
T PRK06665         81 LDDR   84 (628)
T ss_pred             HHHH
T ss_conf             9999