HHsearch alignment for GI: 254780525 and conserved domain: PRK12620

>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional.
Probab=93.32  E-value=0.25  Score=26.12  Aligned_cols=37  Identities=19%  Similarity=0.129  Sum_probs=32.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4778999999999999999999999999999999997
Q gi|254780525|r  381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI  417 (421)
Q Consensus       381 SgVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLl  417 (421)
T Consensus        93 NtVd~d~Em~~~aeN~l~Y~a~~~~l~~ki~~l~~AI  129 (132)
T PRK12620         93 NTVDPDAERAAYGRAALEYRASLSFLESKVRSMLTAI  129 (132)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8506699999999999999999999999999999986