HHsearch alignment for GI: 254780525 and conserved domain: PRK12621

>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional.
Probab=98.45  E-value=2.2e-07  Score=64.64  Aligned_cols=51  Identities=29%  Similarity=0.365  Sum_probs=43.8

Q ss_pred             CHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCCC
Q ss_conf             4458-89999999999998637887753027786714220024654304777
Q gi|254780525|r    2 GILG-SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS   52 (421)
Q Consensus         2 Sl~~-~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~~   52 (421)
T Consensus         3 ~~f~~~i~ll~~aLd~~~~Rq~via~NIANadTPgYKardv~Fe~~L~~a~~   54 (136)
T PRK12621          3 SLYEPHVNLVGKVMDMQLQRQNVVMSNIANVRTPGYKPRELEFEKQLQSALG   54 (136)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHC
T ss_conf             2478799999999999999999999713205899987441878999999876