HHsearch alignment for GI: 254780525 and conserved domain: PRK12629

>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional.
Probab=98.91  E-value=3e-09  Score=76.58  Aligned_cols=46  Identities=24%  Similarity=0.450  Sum_probs=41.2

Q ss_pred             CCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             3100047789999999999999999999999999999999975129
Q gi|254780525|r  376 GALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR  421 (421)
Q Consensus       376 ~~le~SgVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLlnl~R  421 (421)
T Consensus        90 GyV~~pnVn~~~EMvdm~~AsRsYEANv~~~~~aK~m~~~aL~igr  135 (135)
T PRK12629         90 GYVFSPDVDPVSQMVNMISASRNYQAGVEMLNTAKELALATLTMGR  135 (135)
T ss_pred             CCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             8884689888999999999999999999999999999999998559