HHsearch alignment for GI: 254780525 and conserved domain: PRK12630

>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional.
Probab=99.02  E-value=8.4e-10  Score=80.07  Aligned_cols=47  Identities=30%  Similarity=0.517  Sum_probs=42.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC------CCCCCCEEHHHHH
Q ss_conf             9445889999999999998637887753027786------7142200246543
Q gi|254780525|r    1 MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTV------GYKRTAIAFSSLV   47 (421)
Q Consensus         1 MSl~~~l~~a~SGL~A~q~al~vts~NIANanT~------GYsRq~~~~~~~~   47 (421)
T Consensus         1 M~~~~~~~Ia~sgl~Aqr~Rl~~ia~NiANa~tt~~~~g~pYrrk~~vf~~~~   53 (143)
T PRK12630          1 MKAFDSMRISASGLSAERLRMDTIASNISNASTTRTANGGPYRRKIAVFQENL   53 (143)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             97255786999999999999999998765358889999986644411254766