HHsearch alignment for GI: 254780525 and conserved domain: PRK12632

>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional.
Probab=98.43  E-value=5.6e-07  Score=62.08  Aligned_cols=64  Identities=31%  Similarity=0.353  Sum_probs=53.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCCCCCCCCCCEEEEEEEEE
Q ss_conf             94458899999999999986378877530277867142200246543047777631220588578863
Q gi|254780525|r    1 MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMI   68 (421)
Q Consensus         1 MSl~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~~~~~~G~GV~v~~i~r~   68 (421)
T Consensus         2 ~d~~~~~~Ia~Sgl~Aq~~Rl~~iA~NiANa~t~~y~~k~v~f~~~~~~~----~~~~~v~v~~v~~d   65 (130)
T PRK12632          2 TDFSKSLSVSASGMRAQALRLRHVSENIANADTPGYRRKTVSFQEERDFG----DGVGLVSTGPVRLD   65 (130)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCC----CCCCCEEECCEECC
T ss_conf             03889999999999999999999998743368876433444000124556----78775475350227