HHsearch alignment for GI: 254780525 and conserved domain: PRK12641

>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed.
Probab=99.96  E-value=2.2e-28  Score=198.49  Aligned_cols=112  Identities=22%  Similarity=0.320  Sum_probs=93.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCEEECCCHHH
Q ss_conf             45889999999999998637887753027786714220024654304777763122058857886303411121483022
Q gi|254780525|r    3 ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTD   82 (421)
Q Consensus         3 l~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~~~~~~G~GV~v~~i~r~~~~~~~~~t~~~~d   82 (421)
T Consensus         1 M~r~lY~a~sgm~a~q~~ldvisNNLANvnT~GfK~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~qG~l~~Tg~~lD   77 (252)
T PRK12641          1 MESIIYASMTAANKLLEKQARIANNLANISTPGFKEEFELKILLPNQKNLN---SQEDNFLKEYYNKNPGTLRRTNRNLD   77 (252)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCEEECCCCCEECCCCCEE
T ss_conf             935899999999999998899999998787765506389887644213456---66653243212148746101698102


Q ss_pred             HHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             11036662010179882564201122212367201
Q gi|254780525|r   83 LAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLE  117 (421)
Q Consensus        83 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  117 (421)
T Consensus        78 lAI~G~GfF~v~~~~G~~~YTR~G~F~ld~~G~L~  112 (252)
T PRK12641         78 LIIKKNGWLVIKDDNGQEAYTKNGHFKINSNRKLT  112 (252)
T ss_pred             EEECCCCEEEEECCCCCEEEEECCCEEECCCCCEE
T ss_conf             89858976999779996789972547898999889