HHsearch alignment for GI: 254780525 and conserved domain: PRK12642

>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed.
Probab=99.97  E-value=3.9e-29  Score=203.30  Aligned_cols=236  Identities=22%  Similarity=0.362  Sum_probs=160.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCEEECCCHHH
Q ss_conf             45889999999999998637887753027786714220024654304777763122058857886303411121483022
Q gi|254780525|r    3 ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTD   82 (421)
Q Consensus         3 l~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~~~~~~G~GV~v~~i~r~~~~~~~~~t~~~~d   82 (421)
T Consensus         1 M~~~lY~a~sgm~a~~~~ldviaNNlANvnT~GfK~~~~~F~~~l~~~~~~~-~~-~~~~~~~~~~~~qG~l~~Tg~~lD   78 (241)
T PRK12642          1 MQSGLYVALSSQMALEKRLDTIADNVANANTVGFRAEEVKFDTIVSNKASTD-VS-FASAGKSYISTEAGPLTKTGNPLD   78 (241)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHHCCCCCC-CC-CCCCCCCEECCCCCCEEECCCCCE
T ss_conf             9058999999999999846889888987776533736244688860347787-42-014774122158878466698313


Q ss_pred             HHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             11036662010179882564201122212367201455620111110134555432344544444444455454333211
Q gi|254780525|r   83 LAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTG  162 (421)
Q Consensus        83 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (421)
T Consensus        79 ~AI~G~GFF~V~~~~g~-~yTR~G~F~~~~~G~Lvt~~G~~vL~~~----------------------------------  123 (241)
T PRK12642         79 VAVKGDAWFSFDTPAGQ-VYTRDGRFTMLETGELVSVTGYPVLDAG----------------------------------  123 (241)
T ss_pred             EEECCCCEEEEECCCCC-EEEECCCEEECCCCCEECCCCCEEECCC----------------------------------
T ss_conf             99848836999659985-7886164889899988958998914799----------------------------------


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             23310245544444444445677654322210367540688736778762135555420477630444446566664432
Q gi|254780525|r  163 FISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL  242 (421)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  242 (421)
T Consensus       124 ----------------------------------------g~pI~v~p----~---~~~~~-------------------  137 (241)
T PRK12642        124 ----------------------------------------GAPIQLNP----G---GGPPR-------------------  137 (241)
T ss_pred             ----------------------------------------CCCEEECC----C---CCEEE-------------------
T ss_conf             ----------------------------------------98559789----9---85189-------------------


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             10012202445644577653321246776655433233333100233334323344433234434455477633899841
Q gi|254780525|r  243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD  322 (421)
Q Consensus       243 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  322 (421)
T Consensus       138 --------------------------------------------------------------------I~~dG~i~~---  146 (241)
T PRK12642        138 --------------------------------------------------------------------IGADGAIYQ---  146 (241)
T ss_pred             --------------------------------------------------------------------ECCCCEEEE---
T ss_conf             --------------------------------------------------------------------837961953---


Q ss_pred             CCCCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             43211012220012178678774169526632335870213788876114652310004778999999999999999999
Q gi|254780525|r  323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN  402 (421)
Q Consensus       323 ~~~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~SgVnlDEEm~nLi~~Q~aYqAs  402 (421)
T Consensus       147 --~~~~vg~i~l~~~~~~~~l~~~g~~~~~~~~~~~-~~~----~~~~~~v~qG~LE~SNVd~~~EM~~lI~~qRafe~~  219 (241)
T PRK12642        147 --NGVQVGALGLFEIPADAGLARYGNSGVIPDKPAQ-PVV----DRNSVGVVQGYLEGSNVNAMTEMTRLISVSRAFESV  219 (241)
T ss_pred             --CCEEEEEEEEEECCCCCCCEECCCCCEEECCCCC-CCC----CCCCCCEECCCCHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             --8878888899943795003264787535078887-665----788871775741033062999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999751
Q gi|254780525|r  403 SKVFQTGSDFMDILISL  419 (421)
Q Consensus       403 ArvItt~demldtLlnl  419 (421)
T Consensus       220 ~k~i~~~D~~l~~ai~~  236 (241)
T PRK12642        220 SSLMRDSESSVSEAIKT  236 (241)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999998