HHsearch alignment for GI: 254780525 and conserved domain: PRK12685

>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed.
Probab=94.00  E-value=0.17  Score=27.22  Aligned_cols=37  Identities=11%  Similarity=0.164  Sum_probs=33.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4778999999999999999999999999999999997
Q gi|254780525|r  381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI  417 (421)
Q Consensus       381 SgVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLl  417 (421)
T Consensus        77 N~Vdld~Em~~~aeN~l~Y~a~~~~l~~~~~~lk~AI  113 (116)
T PRK12685         77 NTVELGKEQARYSQNAMDYQTSLTFLNMKISGLKSAI  113 (116)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8537899999999999999999999999999999986