HHsearch alignment for GI: 254780525 and conserved domain: PRK12689

>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed.
Probab=100.00  E-value=2.8e-33  Score=229.69  Aligned_cols=239  Identities=25%  Similarity=0.346  Sum_probs=176.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCCC------CCCCCCCEEEEEEEEEECCCCEEE
Q ss_conf             45889999999999998637887753027786714220024654304777------763122058857886303411121
Q gi|254780525|r    3 ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS------NSYVSGGLEISTKDMISEQGSLMH   76 (421)
Q Consensus         3 l~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~~------~~~~G~GV~v~~i~r~~~~~~~~~   76 (421)
T Consensus         1 M~~~lYta~Sgm~a~q~~ldviaNNlANvnT~GfK~~~~~F~~~l~~~~~~~~~~~~~~~~~~v~~~~~~~d~~qG~l~~   80 (253)
T PRK12689          1 MQNALLVGLSRQMALERQLDVVANNVANVNTNGFKADRSLFQEYLMPGAHEDNFVGPDRRVSYVQDRGTYLDFSQGPLEQ   80 (253)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECEEEEECCCCCEEE
T ss_conf             90289999999999997127887889867765437361127998621256667667776314688420475527878132


Q ss_pred             CCCHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             48302211036662010179882564201122212367201455620111110134555432344544444444455454
Q gi|254780525|r   77 TASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSA  156 (421)
Q Consensus        77 t~~~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (421)
T Consensus        81 Tg~~lDlAI~G~GfF~V~~~~g~-~yTR~G~F~~d~~G~Lvt~~G~~Vl~~~-----gp---------------------  133 (253)
T PRK12689         81 TKNPLDVAIDGDAFLAVQTPQGE-RYTRDGALEINAQGQLVTSSGYPVLGTG-----GP---------------------  133 (253)
T ss_pred             CCCCCEEEECCCCEEEEECCCCC-CEEECCCEEECCCCCEEECCCCEEECCC-----CC---------------------
T ss_conf             59830399879817999727875-0675461679899868908998816799-----97---------------------


Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCCCCCC
Q ss_conf             33321123310245544444444445677654322210367540688736778762135555420477630444446566
Q gi|254780525|r  157 MPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP  236 (421)
Q Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  236 (421)
T Consensus       134 -------i~~--~------------p~-~--------~------------------------------------------  141 (253)
T PRK12689        134 -------IVF--Q------------PT-D--------T------------------------------------------  141 (253)
T ss_pred             -------EEE--C------------CC-C--------C------------------------------------------
T ss_conf             -------260--8------------98-8--------6------------------------------------------


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             66443210012202445644577653321246776655433233333100233334323344433234434455477633
Q gi|254780525|r  237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY  316 (421)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (421)
T Consensus       142 -----------------------------------------------------------------------~i~I~~dG~  150 (253)
T PRK12689        142 -----------------------------------------------------------------------DINISPDGT  150 (253)
T ss_pred             -----------------------------------------------------------------------CEEECCCCC
T ss_conf             -----------------------------------------------------------------------337768970


Q ss_pred             EEEEECCC-CCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECCCCCHHHHHHHHHHH
Q ss_conf             89984143-21101222001217867877416952663233587021378887611465231000477899999999999
Q gi|254780525|r  317 VDIIYDDG-TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA  395 (421)
Q Consensus       317 ~~~~~~~~-~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~SgVnlDEEm~nLi~~  395 (421)
T Consensus       151 i~~~~~~~~~~~~~g~l~l~~~~~~~~L~~~G~~l~~~~~~~~~~-------~~~~~v~qG~LE~SNVd~~~EM~~mI~~  223 (253)
T PRK12689        151 VSVLEGTATTDSIRGKLRLVTFANPQQLTKEGANLYAAGAPARAP-------DTKARVEQGYIEKSNVNAVLEMTRMMEV  223 (253)
T ss_pred             EEECCCCCCCCCEEEEEEEEECCCHHHHEECCCCEEECCCCCCCC-------CCCCEEECCCEECCCCCHHHHHHHHHHH
T ss_conf             897048876631345789982388677001589558578887788-------8886160273220236499999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999975
Q gi|254780525|r  396 QRNYAVNSKVFQTGSDFMDILIS  418 (421)
Q Consensus       396 Q~aYqAsArvItt~demldtLln  418 (421)
T Consensus       224 qRafe~n~k~i~~~Dem~~~ai~  246 (253)
T PRK12689        224 TRTYTQVSSMLQQQSDLRKTAIE  246 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999