HHsearch alignment for GI: 254780525 and conserved domain: PRK12694

>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed.
Probab=100.00  E-value=1.8e-37  Score=256.44  Aligned_cols=245  Identities=31%  Similarity=0.490  Sum_probs=197.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCC--------------CCCCCCCCEEEEEEEEE
Q ss_conf             4588999999999999863788775302778671422002465430477--------------77631220588578863
Q gi|254780525|r    3 ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST--------------SNSYVSGGLEISTKDMI   68 (421)
Q Consensus         3 l~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~--------------~~~~~G~GV~v~~i~r~   68 (421)
T Consensus         1 M~~~lY~a~sgm~a~~~~ldviaNNlANvnT~GfK~~~~~F~~~~~~~~~~~~~~~~~~~~~~~~~~~g~g~~~~~~~~~   80 (260)
T PRK12694          1 MNRSLWIAKTGLNAQQAQMDVISNNLANVSTNGFKRSRAVFEDLLYQTIRQPGAQSTQQTELPSGLQLGTGVRQVATERL   80 (260)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEECCCEEEEEEEEE
T ss_conf             92589999999999998488998889877776556472309999887631567665655557765200342166678875


Q ss_pred             ECCCCEEECCCHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             03411121483022110366620101798825642011222123672014556201111101345554323445444444
Q gi|254780525|r   69 SEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERIN  148 (421)
Q Consensus        69 ~~~~~~~~t~~~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  148 (421)
T Consensus        81 ~~qG~l~~Tg~~lDlAI~G~GfF~V~~~~G~~~yTR~G~F~~d~~G~Lvt~~G~~vl~----------------------  138 (260)
T PRK12694         81 FTQGNLQQTGNSKDVAINGQGFFQVLMPDGTTAYTRDGSFQTNAQGQLVTSSGYPLQP----------------------  138 (260)
T ss_pred             CCCCCCEECCCCCEEEECCCCEEEEECCCCCEEEEECCCEEECCCCCEECCCCCEEEC----------------------
T ss_conf             1678713169831289858957888558995748876646899999888289988740----------------------


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECC
Q ss_conf             44455454333211233102455444444444456776543222103675406887367787621355554204776304
Q gi|254780525|r  149 VKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD  228 (421)
Q Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  228 (421)
T Consensus       139 --------------~i--~ip-------------~~~-------------------------------------------  146 (260)
T PRK12694        139 --------------AI--TIP-------------QNA-------------------------------------------  146 (260)
T ss_pred             --------------CC--CCC-------------CCC-------------------------------------------
T ss_conf             --------------55--348-------------886-------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44446566664432100122024456445776533212467766554332333331002333343233444332344344
Q gi|254780525|r  229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKD  308 (421)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (421)
T Consensus       147 ------------------------------------------------------------------------------~~  148 (260)
T PRK12694        147 ------------------------------------------------------------------------------TS  148 (260)
T ss_pred             ------------------------------------------------------------------------------CE
T ss_conf             ------------------------------------------------------------------------------05


Q ss_pred             CCCCCCCEEEEEECC-CCCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECCCCCHHH
Q ss_conf             554776338998414-3211012220012178678774169526632335870213788876114652310004778999
Q gi|254780525|r  309 FSVSKDGYVDIIYDD-GTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS  387 (421)
Q Consensus       309 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~SgVnlDE  387 (421)
T Consensus       149 i~i~~dG~i~~~~~g~~~~~~vg~l~l~~f~n~~~L~~~G~~l~~~~~~~g~~~~~~p~~~~~~~v~qG~LE~SNVd~~~  228 (260)
T PRK12694        149 LTIGKDGTVSVTQPGSSNAVQIGQLQLATFINPAGLQAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVEASNVNVVE  228 (260)
T ss_pred             EEECCCCEEEEECCCCCCCEEEEEEEEEEECCCHHHHHCCCCCEECCCCCCCCCCCCCCCCCCEEEECCCEECCCCCHHH
T ss_conf             78757860888517986531446899985037166420589731203677887546678787316844867521463999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999751
Q gi|254780525|r  388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISL  419 (421)
Q Consensus       388 Em~nLi~~Q~aYqAsArvItt~demldtLlnl  419 (421)
T Consensus       229 Emv~mI~~qRaye~~~k~i~t~De~l~~~~ql  260 (260)
T PRK12694        229 ELVNMIQTQRAYEINSKAVTTSDQMLQRLTQM  260 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999988999999999998668