HHsearch alignment for GI: 254780525 and conserved domain: PRK12782

>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed.
Probab=98.89  E-value=3.1e-09  Score=76.44  Aligned_cols=46  Identities=28%  Similarity=0.513  Sum_probs=42.2

Q ss_pred             CCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             3100047789999999999999999999999999999999975129
Q gi|254780525|r  376 GALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR  421 (421)
Q Consensus       376 ~~le~SgVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLlnl~R  421 (421)
T Consensus        92 GyV~~pnVn~~~EMvdm~~AsRsYeANv~v~~tak~m~~~tL~i~r  137 (138)
T PRK12782         92 GYVKLPNVNMLIEMADMREANRSYEANLQVIKQARAMVSMTIDLLR  137 (138)
T ss_pred             CCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             8854689888999999999999999999999999999999999850