HHsearch alignment for GI: 254780525 and conserved domain: PRK12818

>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed.
Probab=100.00  E-value=4.3e-32  Score=222.14  Aligned_cols=239  Identities=29%  Similarity=0.485  Sum_probs=173.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHH---HHHCC-----------CCCCCCCCCEEEEEEEEE
Q ss_conf             4588999999999999863788775302778671422002465---43047-----------777631220588578863
Q gi|254780525|r    3 ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSS---LVFPS-----------TSNSYVSGGLEISTKDMI   68 (421)
Q Consensus         3 l~~~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~---~~~~~-----------~~~~~~G~GV~v~~i~r~   68 (421)
T Consensus         1 M~~~ly~a~sgm~a~~~~ldviaNNlAN~nT~GfK~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~   80 (255)
T PRK12818          1 MIRGLYTAVSGMITLEAKQDVITNNLANVNTVGYKSDNLAFKSFEDVLIENYDKKVGNKNIKNIIGGLSMGSKIDEVNTL   80 (255)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEEEEEE
T ss_conf             96689999999999998778998999877756448585006568999864104446786666644541452264356764


Q ss_pred             ECCCCEEECCCHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             03411121483022110366620101798825642011222123672014556201111101345554323445444444
Q gi|254780525|r   69 SEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERIN  148 (421)
Q Consensus        69 ~~~~~~~~t~~~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  148 (421)
T Consensus        81 ~~qG~l~~Tg~~lDlAI~G~GfF~V~-~~g~~~yTR~G~f~vd~~G~Lvt~~G~~vLg~~~~------------------  141 (255)
T PRK12818         81 FTQGIIKSTDKPTDFAIQGRGFFTVE-RNGRNYYTRDGHFHVDTQGYLVNDSGYYVMGINNA------------------  141 (255)
T ss_pred             CCCCCEEECCCCCEEEECCCCEEEEE-CCCCEEEEECCCEEECCCCCEECCCCCEEECCCCC------------------
T ss_conf             27878454598104998698589995-59965899756577989976892899892078888------------------


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECC
Q ss_conf             44455454333211233102455444444444456776543222103675406887367787621355554204776304
Q gi|254780525|r  149 VKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD  228 (421)
Q Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  228 (421)
T Consensus       142 -----------------------------------------------------~~~~~pi~~------------------  150 (255)
T PRK12818        142 -----------------------------------------------------TGAREPIYV------------------  150 (255)
T ss_pred             -----------------------------------------------------CCCCCCEEC------------------
T ss_conf             -----------------------------------------------------777566514------------------


Q ss_pred             CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44446566664432100122024456445776533212467766554332333331002333343233444332344344
Q gi|254780525|r  229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKD  308 (421)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (421)
T Consensus       151 ----------------------------------------------------------------------------~~~~  154 (255)
T PRK12818        151 ----------------------------------------------------------------------------GNKK  154 (255)
T ss_pred             ----------------------------------------------------------------------------CCCC
T ss_conf             ----------------------------------------------------------------------------8980


Q ss_pred             CCCCCCCEEEEEECCCCCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECCCCCHHHH
Q ss_conf             55477633899841432110122200121786787741695266323358702137888761146523100047789999
Q gi|254780525|r  309 FSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASE  388 (421)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~SgVnlDEE  388 (421)
T Consensus       155 i~i~~dG~i~~~-----~~~~~~l~~~~~~~~~~L~~~G~~lf~~~---------~~~~~~~~~v~qG~LE~SNVn~~~E  220 (255)
T PRK12818        155 FSTDASGNISLD-----GVPSYKFQVADFNDYNSLKKIGDNLYSGN---------NPINNNGAIVRQNSLEKSNVNVTNE  220 (255)
T ss_pred             EEECCCCEEEEC-----CCCCEEEEEEECCCHHHCEECCCCCCCCC---------CCCCCCCCEEEECCEECCCCCHHHH
T ss_conf             898898259855-----75412689981488043637688751379---------8775777338726410012689999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCC
Q ss_conf             999999999999999999999999999975-129
Q gi|254780525|r  389 LTELIEAQRNYAVNSKVFQTGSDFMDILIS-LKR  421 (421)
Q Consensus       389 m~nLi~~Q~aYqAsArvItt~demldtLln-l~R  421 (421)
T Consensus       221 M~~mI~~qRafe~~~k~i~t~De~~~~a~n~lg~  254 (255)
T PRK12818        221 MVNMMTTMRSFETNQKIVQSIDETLGKAVNEVGS  254 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9999999999999999999999999999997436