HHsearch alignment for GI: 254780525 and conserved domain: TIGR03506

>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins. This model encompasses three closely related flagellar proteins usually denoted FlgE, FlgF and FlgG. The names have often been mis-assigned, however. Three equivalog HMMs, TIGR02489, TIGR02490 and TIGR00488, respectively, separate the individual forms into three genome-context consistent groups. The major differences between these genes are architectural, with variable central sections between relatively conserved N- and C-terminal domains. More distantly related are two other flagellar apparatus familis, FlgC (TIGR01395) which consists of little else but the N-and C-terminal domains and FlgK (TIGR02492) with a substantial but different central domain.
Probab=100.00  E-value=7.3e-33  Score=227.07  Aligned_cols=229  Identities=35%  Similarity=0.566  Sum_probs=198.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCC-CCCCCCCCEEEEEEEEEECCCCEEECCCHHHHH
Q ss_conf             8999999999999863788775302778671422002465430477-776312205885788630341112148302211
Q gi|254780525|r    6 SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGGLEISTKDMISEQGSLMHTASNTDLA   84 (421)
Q Consensus         6 ~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~-~~~~~G~GV~v~~i~r~~~~~~~~~t~~~~d~a   84 (421)
T Consensus         2 sly~a~sgm~a~~~~l~visnNlAN~nT~GfK~~~~~F~~~~~~~~~~~~~~~~gv~~~~~~~~~~qG~l~~Tg~~lDlA   81 (231)
T TIGR03506         2 ALYTALSGLNAQSKALDVIANNIANANTTGFKASRAEFSDLLAQSGSGSGQVGGGVRAAAVGTDFSQGSLQTTGNPLDLA   81 (231)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCCEEECCCCCEEE
T ss_conf             48999999999998678888888877764435472417887523478877555457841568763888825668832189


Q ss_pred             HCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             03666201017988256420112221236720145562011111013455543234454444444445545433321123
Q gi|254780525|r   85 IQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFI  164 (421)
Q Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (421)
T Consensus        82 I~G~GfF~V~~~~G~~~yTR~G~F~~d~~G~Lv~~~G~~vlg~~g~~---------------------------------  128 (231)
T TIGR03506        82 INGDGFFAVQTPDGSEAYTRAGSFQLDANGYLVTADGYPLLGWGGGP---------------------------------  128 (231)
T ss_pred             ECCCEEEEEECCCCCEEEEECCCEEECCCCCEECCCCCEEECCCCCC---------------------------------
T ss_conf             86963899988999784876453789899988878998807778887---------------------------------


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             31024554444444444567765432221036754068873677876213555542047763044444656666443210
Q gi|254780525|r  165 SNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT  244 (421)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  244 (421)
                                                                                                      
T Consensus       129 --------------------------------------------------------------------------------  128 (231)
T TIGR03506       129 --------------------------------------------------------------------------------  128 (231)
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             01220244564457765332124677665543323333310023333432334443323443445547763389984143
Q gi|254780525|r  245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG  324 (421)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  324 (421)
T Consensus       129 -------------------------------------------------------~~~~~~~~~~~i~~dG~i~~~~~~~  153 (231)
T TIGR03506       129 -------------------------------------------------------ITIPPDAAGVEIGEDGTVSATYSNG  153 (231)
T ss_pred             -------------------------------------------------------CCCCCCCCEEEECCCCEEEEECCCC
T ss_conf             -------------------------------------------------------6457777416987895399850799


Q ss_pred             CCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             211012220012178678774169526632335870213788876114652310004778999999999999999999
Q gi|254780525|r  325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN  402 (421)
Q Consensus       325 ~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~SgVnlDEEm~nLi~~Q~aYqAs  402 (421)
T Consensus       154 ~~~~v~~i~l~~~~~~~~L~~~g~~~~~~~~~~g~~~~~~~~~~~~~~v~qG~LE~SNVd~~~em~~mi~~qR~fe~N  231 (231)
T TIGR03506       154 QTQEVGQLALVNFPNPNGLQKEGGNLFRATDGSGAPLVGAPGTGGLGSLVQGALEGSNVDAVAEMVDMISAQRAYEAN  231 (231)
T ss_pred             CCEEEEEEEEEECCCHHHCEECCCCEEEECCCCCCCCCCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             715878999995068688158589679844777775235678888236970732620265999999999997756089