HHsearch alignment of GI: 254780525 and MMDB domain: 3a69_A_48-116_315-358

>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}
Probab=97.49  E-value=3.7e-05  Score=50.09  Aligned_cols=77  Identities=21%  Similarity=0.283  Sum_probs=69.2

Q ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             22058857886303411121483022110366620101798825642011222123672014556201111101345
Q gi|254780525|r   57 SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNAS  133 (421)
Q Consensus        57 G~GV~v~~i~r~~~~~~~~~t~~~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  133 (421)
                      |.||++..+.+.+.|+.++.|++.+|+|+.++++|......+...+++...|..+.++.|.+..+...+....-...
T Consensus         1 G~Gv~~~~~~~~~~qG~l~~T~~~lDlAI~G~GfF~V~~~~G~~~yTR~G~F~ld~~G~Lvt~~G~~vlal~~f~n~   77 (113)
T 3a69_A            1 GLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTVLANFANN   77 (113)
T ss_dssp             -----------------------CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEECEEECSCG
T ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             67647767999604554576264556662278603675157860001345422047887123567400234566786