Query         gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 421
No_of_seqs    133 out of 3438
Neff          10.3
Searched_HMMs 33803
Date          Wed Jun  1 18:32:24 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780525.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3a69_A Flagellar HOOK protein  97.5 3.7E-05 1.1E-09   50.1   1.7   77   57-133     1-77  (113)
  2 >2d4y_A HAP1, flagellar HOOK-a  96.5  0.0005 1.5E-08   42.9   0.0   19  376-394   358-376 (376)
  3 >3a69_A Flagellar HOOK protein  94.9   0.013 3.8E-07   33.9   2.0   46  330-375    67-112 (113)
  4 >1wlg_A Flagellar HOOK protein  94.2   0.023 6.8E-07   32.3   2.0   39  330-368    44-82  (83)
  5 >1wlg_A Flagellar HOOK protein  93.1    0.45 1.3E-05   24.0  10.8  145  153-305    11-156 (157)
  6 >3a69_A Flagellar HOOK protein  88.7     1.2 3.6E-05   21.3  10.6  130  154-291    11-141 (153)
  7 >1wlg_A Flagellar HOOK protein  87.2    0.29 8.5E-06   25.3   1.7   49   80-128     1-49  (83)
  8 >1ucu_A Phase 1 flagellin; fla  66.8     6.2 0.00018   16.8   5.3   40  382-421    41-80  (80)
  9 >1ory_B Flagellin; flagellar c  43.2     9.9 0.00029   15.5   1.2   40  382-421    16-55  (55)
 10 >1wlg_A Flagellar HOOK protein  41.7     7.1 0.00021   16.4   0.3   18  369-386    41-58  (59)
 11 >1lln_A Antiviral protein 3; r  23.7      32 0.00095   12.2   1.5   20   19-38     13-32  (57)
 12 >1nei_A Hypothetical protein Y  21.7      35   0.001   12.0   1.3   16  406-421    32-47  (60)

No 1  
>>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} (A:48-116,A:315-358)
Probab=97.49  E-value=3.7e-05  Score=50.09  Aligned_cols=77  Identities=21%  Similarity=0.283  Sum_probs=69.2

Q ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             22058857886303411121483022110366620101798825642011222123672014556201111101345
Q gi|254780525|r   57 SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNAS  133 (421)
Q Consensus        57 G~GV~v~~i~r~~~~~~~~~t~~~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  133 (421)
                      |.||++..+.+.+.|+.++.|++.+|+|+.++++|......+...+++...|..+.++.|.+..+...+....-...
T Consensus         1 G~Gv~~~~~~~~~~qG~l~~T~~~lDlAI~G~GfF~V~~~~G~~~yTR~G~F~ld~~G~Lvt~~G~~vlal~~f~n~   77 (113)
T 3a69_A            1 GLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTVLANFANN   77 (113)
T ss_dssp             -----------------------CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEECEEECSCG
T ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             67647767999604554576264556662278603675157860001345422047887123567400234566786


No 2  
>>2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} (A:1-268,A:356-463)
Probab=96.49  E-value=0.0005  Score=42.88  Aligned_cols=19  Identities=16%  Similarity=0.232  Sum_probs=15.7

Q ss_pred             CCEECCCCCHHHHHHHHHH
Q ss_conf             3100047789999999999
Q gi|254780525|r  376 GALETANVDIASELTELIE  394 (421)
Q Consensus       376 ~~le~SgVnlDEEm~nLi~  394 (421)
                      ...+.|||||||||+||||
T Consensus       358 ~r~svSGVnlDEE~anlik  376 (376)
T 2d4y_A          358 QQQSVSGVNLDEEYGNLQR  376 (376)
T ss_dssp             HHHC---------------
T ss_pred             HHHHHHCCCHHHHHHHHCC
T ss_conf             9984206179999998549


No 3  
>>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} (A:48-116,A:315-358)
Probab=94.92  E-value=0.013  Score=33.91  Aligned_cols=46  Identities=20%  Similarity=0.312  Sum_probs=41.9

Q ss_pred             CCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEE
Q ss_conf             2220012178678774169526632335870213788876114652
Q gi|254780525|r  330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFS  375 (421)
Q Consensus       330 ~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~  375 (421)
                      ....+.+|.|+.+|.+.|++.|.++..||++.++.++.+.+++|..
T Consensus        67 ~vlal~~f~n~~gL~~~g~~~~~~t~~sG~~~~g~~g~~~~G~i~~  112 (113)
T 3a69_A           67 QLTVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTN  112 (113)
T ss_dssp             EEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCCC
T ss_pred             CCCCCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             0023456678677441378447613356773016788787254710


No 4  
>>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} (A:1-46,A:245-281)
Probab=94.21  E-value=0.023  Score=32.27  Aligned_cols=39  Identities=21%  Similarity=0.284  Sum_probs=34.5

Q ss_pred             CCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCC
Q ss_conf             222001217867877416952663233587021378887
Q gi|254780525|r  330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHN  368 (421)
Q Consensus       330 ~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~  368 (421)
                      ....+.+|.||.+|.+.|++.|.++..||.+.++.+++.
T Consensus        44 ~vl~la~F~N~~GL~~~G~n~~~~T~~SG~p~~g~pgtg   82 (83)
T 1wlg_A           44 QLTVLANFANNEGLASQGDNVWAATQASGVALLGTAGSG   82 (83)
T ss_dssp             EEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBT
T ss_pred             EEEEEEECCCHHHHHHCCCCEEECCCCCCCCEECCCCCC
T ss_conf             898999607978813115972776445787443579989


No 5  
>>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} (A:62-218)
Probab=93.11  E-value=0.45  Score=24.03  Aligned_cols=145  Identities=22%  Similarity=0.350  Sum_probs=85.0

Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCC
Q ss_conf             54543332112331024554444444444567765432221036754068873677876213555542047763044444
Q gi|254780525|r  153 ELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN  232 (421)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  232 (421)
                      .......+.......+.....  ..............+.+.....++|.+|..|.+.+++.+...+.|...+........
T Consensus        11 ~~~a~aTt~i~~~~NL~a~~~--~~~~~~~~~~~~~~~~~~ts~tvyDSlG~~h~v~~~f~k~~~n~W~~~~~~~~~~~~   88 (157)
T 1wlg_A           11 LMAAKSTTTASMQINLNSTDP--VPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAA   88 (157)
T ss_dssp             CBCCBCCCEEEEEEEEETTCC--CCSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTC
T ss_pred             CCCCCCCEEEEEECCCCCCCC--CCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCCEEECCCCCCCC
T ss_conf             467765316888414664224--553212233678752202125631137863110033221156433036503566555


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             65666644321001220244564457765332124677665543323333-31002333343233444332344
Q gi|254780525|r  233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS-KTTQLAGGFIPQKSEINGHAPGK  305 (421)
Q Consensus       233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~  305 (421)
                      ....     .....+.|+.. |.+..............+........+.. ..+|+...+........+...|.
T Consensus        89 ~~~~-----~~~gtl~Fd~~-G~l~~~~~~~~~~~~~~g~~~~~i~ld~~~~~TQ~~~~~~~~~~~qdGy~~G~  156 (157)
T 1wlg_A           89 TAPT-----TASTTLKFNEN-GILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGD  156 (157)
T ss_dssp             CCCC-----SCSEEEEECTT-SBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEECCBCCBC
T ss_pred             CCCC-----CCEEEEEECCC-CCCCCCCCEECCCCCCCCCCCCCEEECCHHCCCCCCCCCEEEEECCCCCCCCC
T ss_conf             5764-----42025750567-52134541000235421244320353100001223675202444157743321


No 6  
>>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} (A:133-285)
Probab=88.70  E-value=1.2  Score=21.31  Aligned_cols=130  Identities=22%  Similarity=0.365  Sum_probs=71.6

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCCC
Q ss_conf             45433321123310245544444444445677654322210367540688736778762135555420477630444446
Q gi|254780525|r  154 LSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN  233 (421)
Q Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  233 (421)
                      +.............+......  .............+.+...+.++|.+|..|.+.+++.+...+.|...+.........
T Consensus        11 ~~~~aTt~i~~~~NL~a~~~~--~~~~~~~~~~~~~~~~~ts~tvYDSlG~~h~l~~~f~k~~~n~W~~~~~~~~~~~~~   88 (153)
T 3a69_A           11 MAAKSTTTASMQINLNSTDPV--PSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAAT   88 (153)
T ss_dssp             CCCBCCCEEEEEEEEETTCCC--CSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCC
T ss_pred             CCCCCCCEEEECCCCCCCCCC--CCCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEECCCCEEEEECCCCCCCC
T ss_conf             576654135530223455544--444666667764400034269983789604655577762024321564034554555


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC
Q ss_conf             56666443210012202445644577653321246776655433233333-10023333
Q gi|254780525|r  234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK-TTQLAGGF  291 (421)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  291 (421)
                      .....     ...+.|+.. |.+..............+........+... ..++....
T Consensus        89 ~~~~~-----~~ti~Fd~~-G~l~~~~~~~~~~~~~~ga~~~~i~ldl~~~~tq~~~~~  141 (153)
T 3a69_A           89 APTTA-----STTLKFNEN-GILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGAN  141 (153)
T ss_dssp             CCCSC-----SEEEEECTT-SBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCC
T ss_pred             CCCCC-----CEEEEECCC-CCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC
T ss_conf             55444-----204750455-432455531123455566421013521222211245543


No 7  
>>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} (A:1-46,A:245-281)
Probab=87.17  E-value=0.29  Score=25.28  Aligned_cols=49  Identities=27%  Similarity=0.417  Sum_probs=43.8

Q ss_pred             HHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             0221103666201017988256420112221236720145562011111
Q gi|254780525|r   80 NTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYP  128 (421)
Q Consensus        80 ~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  128 (421)
                      .+|.++.++++|....+.+...+++...|..+.++.|.+..+...+...
T Consensus         1 AlDlAI~G~GfF~V~~~~G~~~yTR~G~F~~d~~G~Lv~~~G~~vl~la   49 (83)
T 1wlg_A            1 GLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTVLA   49 (83)
T ss_dssp             CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEECEE
T ss_pred             CCCEEECCCCEEEEECCCCCEEEECCCCEEECCCCCEECCCCCEEEEEE
T ss_conf             9657875870799876999888844887239899988879999898999


No 8  
>>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} (A:1-40,A:455-494)
Probab=66.84  E-value=6.2  Score=16.78  Aligned_cols=40  Identities=23%  Similarity=0.292  Sum_probs=37.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             7789999999999999999999999999999999975129
Q gi|254780525|r  382 NVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR  421 (421)
Q Consensus       382 gVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLlnl~R  421 (421)
                      -+|+-+||+++.++|==.||..-++.-++.+=+.+|.|-|
T Consensus        41 DaD~A~E~~~~tk~qIL~Qa~~amLaQAN~~pq~vl~LLq   80 (80)
T 1ucu_A           41 DSDYATEVSNMSRAQILQQAGTSVLAQANQVPQNVLSLLR   80 (80)
T ss_dssp             CCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             HCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             1319999999999999999999999997416789998409


No 9  
>>1ory_B Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} (B:)
Probab=43.21  E-value=9.9  Score=15.50  Aligned_cols=40  Identities=25%  Similarity=0.382  Sum_probs=35.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             7789999999999999999999999999999999975129
Q gi|254780525|r  382 NVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR  421 (421)
Q Consensus       382 gVnlDEEm~nLi~~Q~aYqAsArvItt~demldtLlnl~R  421 (421)
                      -+|+-+||+++-++|==.||+.=++.=++++=+.+|.|-|
T Consensus        16 DaD~A~E~~~~tk~qIL~Qa~~amLaQAN~~pq~vL~LLq   55 (55)
T 1ory_B           16 NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR   55 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHCHHHHHHHHCCCCHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHC
T ss_conf             0559999999999999999999999998526789997519


No 10 
>>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} (A:47-61,A:219-244,A:282-299)
Probab=41.68  E-value=7.1  Score=16.41  Aligned_cols=18  Identities=44%  Similarity=0.767  Sum_probs=14.4

Q ss_pred             CCEEEEECCEECCCCCHH
Q ss_conf             611465231000477899
Q gi|254780525|r  369 QHGEIFSGALETANVDIA  386 (421)
Q Consensus       369 ~~~~i~~~~le~SgVnlD  386 (421)
                      .+|++..++||.|+|+|.
T Consensus        41 ifg~lt~gale~snvdls   58 (59)
T 1wlg_A           41 IFGKLTNGALEASNVDLS   58 (59)
T ss_dssp             EBCCCSSCEEEEC-----
T ss_pred             ECEEEEECCEEHHHCCCC
T ss_conf             923485174422332626


No 11 
>>1lln_A Antiviral protein 3; ribosome inactivating protein, polynucleotide:adenosine, hydrolase; HET: MLY; 1.60A {Phytolacca americana} (A:192-248)
Probab=23.73  E-value=32  Score=12.25  Aligned_cols=20  Identities=35%  Similarity=0.325  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCC
Q ss_conf             86378877530277867142
Q gi|254780525|r   19 NRVSAVSDNIANVDTVGYKR   38 (421)
Q Consensus        19 ~al~vts~NIANanT~GYsR   38 (421)
                      +.-+-+|+-||-+||||-|-
T Consensus        13 ~~wd~~s~~iakv~t~g~s~   32 (57)
T 1lln_A           13 KNWDSVSXVIAKVGTSGDST   32 (57)
T ss_dssp             TTHHHHHHHHHHCCCCSSCE
T ss_pred             HCHHHHHHHHHHHHCCCCCE
T ss_conf             36988809999865269970


No 12 
>>1nei_A Hypothetical protein YOAG; alpha/beta protein, homodimer, OCSP, NESG, protein structure initiative, structural genomics, PSI; NMR {Escherichia coli} (A:)
Probab=21.72  E-value=35  Score=12.00  Aligned_cols=16  Identities=13%  Similarity=0.235  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHCC
Q ss_conf             9999999999975129
Q gi|254780525|r  406 FQTGSDFMDILISLKR  421 (421)
Q Consensus       406 Itt~demldtLlnl~R  421 (421)
                      =.++-|+...|+||+|
T Consensus        32 p~vaa~~vKdLvNiVR   47 (60)
T 1nei_A           32 PEVAAEVIKDLVNTVR   47 (60)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             1779999999998872


Done!