BLAST/PSIBLAST alignment of GI: 254780525 and GI: 86360902 at iteration 1
>gi|86360902|ref|YP_472789.1| flagellar hook protein FlgE [Rhizobium etli CFN 42] Length = 430
>gi|86285004|gb|ABC94062.1| flagellar hook protein [Rhizobium etli CFN 42] Length = 430
 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 200/440 (45%), Positives = 268/440 (60%), Gaps = 29/440 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 121 GYTLMGYSYDSGVPAVVVNGFDGLVPVNVAQSGLSAIASTSAYFSGNLNSEATVVTDTTT 180

Query: 181 -PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQ- 227
            P  N     + T K S  AYD+LG++V YD Y+TKTG             WEV+++R  
Sbjct: 181 LPSANTSGVTDDTQKMSLVAYDSLGATVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 228 DQST--NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITIDI 281
           D +T    SFPY+ + ++   +SFD   G L +++   I        +D    + IT+D 
Sbjct: 241 DAATGGTTSFPYSSSAVSVATLSFDA-DGQLTSATDTDI--------VDPVTAKTITMDY 291

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQLA  F    S  +G A       S+  DG V + Y +GT   +Y++ +ATV S D
Sbjct: 292 SDFTQLASDFSATGSA-DGQAASAVSSVSIGTDGVVSVSYANGTTKSLYQIPLATVASPD 350

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
           NL L  GN Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  
Sbjct: 351 NLTLLSGNVYTANGMSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTA 410

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 411 NSKVFQTGSDIMDVLVNLKR 430