BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE
[Candidatus Liberibacter asiaticus str. psy62]
         (421 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040202|gb|ACT56998.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 421

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/421 (100%), Positives = 421/421 (100%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL
Sbjct: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA
Sbjct: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT
Sbjct: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA
Sbjct: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
           PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING
Sbjct: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI
Sbjct: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK
Sbjct: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420

Query: 421 R 421
           R
Sbjct: 421 R 421


>gi|315122284|ref|YP_004062773.1| flagellar hook protein FlgE [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495686|gb|ADR52285.1| flagellar hook protein FlgE [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 422

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 364/422 (86%), Gaps = 1/422 (0%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGILG+MKTAMSGMDAQSNRVSAVSDNIANV+T+GYKRTA++FSSLVFP  +  + SGG+
Sbjct: 1   MGILGTMKTAMSGMDAQSNRVSAVSDNIANVNTIGYKRTAVSFSSLVFPPAAGCHTSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +S KDMIS QGSL+HTASNTDLAIQG+GFF+VK +   + LTR+G+F INNEGFL+N A
Sbjct: 61  AVSEKDMISSQGSLIHTASNTDLAIQGEGFFVVKDKTGTHYLTRSGNFQINNEGFLQNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G VL GYP++NA +PL++NSFQGLE INV++ E  A+PTT G I  NLDK+A ++   KT
Sbjct: 121 GYVLQGYPMRNAFSPLVLNSFQGLETINVRNFEPRAVPTTLGSIPANLDKDAKVVVRSKT 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           PK NG DAEYTHKSSF+AYDTLGS V+YD+YYTK  DKKWEVSIFRQDQS+   FPYNV 
Sbjct: 181 PKSNGGDAEYTHKSSFSAYDTLGSRVIYDLYYTKVEDKKWEVSIFRQDQSSKTIFPYNVT 240

Query: 241 -PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
            PL  ++VSFDPVTG+LA SS K ISF+DNTSGI   I IDISKTTQL GGFIPQ + IN
Sbjct: 241 NPLAVIDVSFDPVTGHLAESSPKEISFDDNTSGISHPIKIDISKTTQLVGGFIPQNAVIN 300

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G APGKP+DFSVSKDG +D+IYDDGTRVP+YRLAIATVPSE++LK+ DGNTYLPTRDSGD
Sbjct: 301 GQAPGKPRDFSVSKDGNIDVIYDDGTRVPVYRLAIATVPSENSLKICDGNTYLPTRDSGD 360

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           ISIG+PG++Q G++ SGALETANVDIA+ELTELIEAQRNYA NSKVFQTGSDFMDILISL
Sbjct: 361 ISIGYPGNDQRGDVLSGALETANVDIANELTELIEAQRNYAANSKVFQTGSDFMDILISL 420

Query: 420 KR 421
           KR
Sbjct: 421 KR 422


>gi|15887919|ref|NP_353600.1| flagellar hook protein FlgE [Agrobacterium tumefaciens str. C58]
 gi|15155515|gb|AAK86385.1| flagellar hook protein [Agrobacterium tumefaciens str. C58]
          Length = 425

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/426 (50%), Positives = 284/426 (66%), Gaps = 6/426 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G+M+T +SGM+AQ+N++  V DNIAN  T GYKR + +FSSLV PS+S SY SGG+
Sbjct: 1   MSIFGTMRTGVSGMNAQANKLGTVGDNIANASTTGYKRASTSFSSLVLPSSSGSYASGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + + +  ISEQG+L +T S+TDLAIQG GFF+V+       LTRAG F  N+EG+LEN A
Sbjct: 61  QSNVRYSISEQGNLSYTTSSTDLAIQGNGFFVVQDGSGTPYLTRAGSFQKNSEGYLENAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GYP  +     +VN F GLE INV +  L+A P+T G    NL+++    T    
Sbjct: 121 GFQLMGYPYGSNPPAAVVNGFTGLEAINVNNFGLTASPSTQGSFPANLNRDDKAATA-PL 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P  N   A + +K+S  A+D+ G+ V+YD YYTKTGD  WEV+++RQDQSTN  FPY   
Sbjct: 180 PSGNSATAAFGNKTSLTAFDSGGAKVLYDFYYTKTGDNTWEVAVYRQDQSTNGGFPYTAT 239

Query: 241 PL-----NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
           P        V++ FDP T  L  +S K+I+ +D  SG+ Q I ID+S+ TQ +  F P  
Sbjct: 240 PAANLVQTKVDLEFDPATNKLTTASPKSITIDDQVSGVPQAINIDLSQMTQFSAKFTPGT 299

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           + +NG+ P + KD  + KDG V  +Y DG R  IY+LA+ATVPS DNL   +GN YLP+ 
Sbjct: 300 AVLNGNGPSQIKDVEIGKDGLVTAVYQDGGRRNIYQLALATVPSVDNLTPQNGNVYLPSN 359

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           DSG ++IGFP     G I  GALE +NVDIASELT++IE+QR Y  NSKVFQTGSD MD+
Sbjct: 360 DSGVVTIGFPQSGSFGYIQKGALEGSNVDIASELTDMIESQRIYTANSKVFQTGSDLMDV 419

Query: 416 LISLKR 421
           LI+LKR
Sbjct: 420 LINLKR 425


>gi|325291962|ref|YP_004277826.1| Flagellar hook protein FlgE [Agrobacterium sp. H13-3]
 gi|325059815|gb|ADY63506.1| Flagellar hook protein FlgE [Agrobacterium sp. H13-3]
          Length = 426

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/426 (49%), Positives = 282/426 (66%), Gaps = 5/426 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G+M+T +SGM+AQ+N++  V DNIAN  T GYKR + +FSSLV PS+S SY SGG+
Sbjct: 1   MSIFGTMRTGVSGMNAQANKLGTVGDNIANASTTGYKRASTSFSSLVLPSSSGSYASGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + + +  ISEQG+L +T S+TDLAIQG GFF+V+       LTRAG F  N EG+LEN A
Sbjct: 61  QSNVRYSISEQGNLSYTTSSTDLAIQGNGFFVVQDGGGTPYLTRAGSFVKNAEGYLENAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GYP    +   +VN F GLE +NV +  L+A P+T G    NL+++   +     
Sbjct: 121 GFQLMGYPYGANAPAAVVNGFTGLEAVNVNNFGLTASPSTQGSFPANLNRDEAAVAAGSR 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P  N   +   +K+S  AYD+ G+ V+YD YYTKTG   WEV+++RQDQSTN  FPY   
Sbjct: 181 PSDNLATSTIGNKTSLTAYDSGGAKVLYDFYYTKTGANTWEVAVYRQDQSTNGGFPYTAT 240

Query: 241 PL-----NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
           P       +V ++FDP T  L  +S K+I+ ND  SG+ Q I+ID+S  +Q +  F P  
Sbjct: 241 PAANLVKESVTLAFDPATNKLTPTSQKSITINDTVSGVPQAISIDLSDMSQFSTKFTPGT 300

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           + +NG+ P + KD  + KDG V  +Y DG R  IY+LA+ATVPS DNL   +GN YLP+ 
Sbjct: 301 AILNGNGPSQIKDVEIGKDGVVTAVYQDGGRRNIYQLAVATVPSVDNLSPQNGNVYLPSN 360

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG ++IGFP     G I  GALE +NVDIASELT++IE+QR Y  NSKVFQTGSD MD+
Sbjct: 361 ESGVVTIGFPQTGSFGYIQKGALEGSNVDIASELTDMIESQRIYTANSKVFQTGSDLMDV 420

Query: 416 LISLKR 421
           LI+LKR
Sbjct: 421 LINLKR 426


>gi|163758031|ref|ZP_02165119.1| flagellar hook protein E [Hoeflea phototrophica DFL-43]
 gi|162284320|gb|EDQ34603.1| flagellar hook protein E [Hoeflea phototrophica DFL-43]
          Length = 419

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 193/422 (45%), Positives = 260/422 (61%), Gaps = 4/422 (0%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T  SGM+AQ+NR+  V+DN+AN +T GYKR +  FSSL+ P ++ SY SG +
Sbjct: 1   MSLYGMMRTGASGMNAQANRLGTVADNMANANTTGYKRASAEFSSLILPGSAGSYNSGAV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+ G+L  T+S TD+A+ G GFFIV   + +  LTRAG F  + EGFL N A
Sbjct: 61  TTDVRYSISQAGALEFTSSKTDMALDGSGFFIVTDDNGLPFLTRAGSFVPDGEGFLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY  ++ +   +VN F GL  +NV    L+A P+TTG+   NLD+ ATI+     
Sbjct: 121 GFRLMGYNYESGTPTPVVNGFDGLVPVNVSAGSLTAAPSTTGYFQANLDEGATIVPAADL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF-RQDQSTNNSFPYNV 239
           P  N   A+YT KSS  A D LG  V+ D YYTKT    WEV+++ R   S   SFPY  
Sbjct: 181 PSTNSATADYTSKSSLIAIDNLGGEVLLDFYYTKTATNTWEVTVYDRAGASAGTSFPYAS 240

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
           APL T  + FDP+ G LA +S   ISF   T      +TID+S  +QL   F    + +N
Sbjct: 241 APLATTTLQFDPLNGQLAGASATDISF---TVPGGAGLTIDLSNMSQLNYAFTVDDANVN 297

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G  P    D  +S+DG +   Y++GT  P+YR+A+A V S D L+   GN Y    DSG 
Sbjct: 298 GSKPSTVTDIEISEDGTIFASYENGTLEPLYRVALADVTSPDKLRPLAGNVYSQGLDSGV 357

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I+ GF G    G++ SGALE++NVDIA ELT++I AQR+Y  NSKVFQTGSD M++L++L
Sbjct: 358 ITTGFAGSGSFGKVVSGALESSNVDIAEELTDMIAAQRSYTANSKVFQTGSDLMEVLVNL 417

Query: 420 KR 421
           KR
Sbjct: 418 KR 419


>gi|116250500|ref|YP_766338.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255148|emb|CAK06222.1| flagellar hook protein (agr_c_1012p) [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 433

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 200/437 (45%), Positives = 269/437 (61%), Gaps = 20/437 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S+TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGADGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT--PD 178
           G  L+GY     S  ++VN F GL  +NV    L+A+ +T+G    NLD  A +++   D
Sbjct: 121 GFQLMGYSYDAGSPAVVVNGFDGLVPVNVNQEGLTAIASTSGVFKGNLDSGANVVSTAAD 180

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-----------DKKWEVSIFRQ 227
           +   ++      T K S  AYD+LG+ V+YD Y+TKT               WEV+IFR 
Sbjct: 181 RPSANSATTTADTKKFSMVAYDSLGNKVMYDFYFTKTSVTTPPPATPATASTWEVAIFRN 240

Query: 228 -DQST--NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT 284
            D +T    SFPY+ A + T  + FD  TG + NS+  A++  D+T+   Q I +D++  
Sbjct: 241 ADAATGGTTSFPYSTAAIGTTTLDFD-ATGKITNSTG-AVTI-DDTARTGQMIDMDLTGF 297

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           TQL   F    +  NG A    KD +V  DG V   Y+DG+  P+YR+ +A V S D L 
Sbjct: 298 TQLGADFAGTGTP-NGQAASPVKDVTVDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLT 356

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
           L  GN Y     SG    GFP  N  G I +GALE +NVD+A ELTE+IE+QR+Y  NSK
Sbjct: 357 LMSGNVYSANGQSGVTVTGFPQTNGLGTIKAGALEGSNVDLAGELTEMIESQRSYTANSK 416

Query: 405 VFQTGSDFMDILISLKR 421
           VFQTGSD MD+L++LKR
Sbjct: 417 VFQTGSDIMDVLVNLKR 433


>gi|260466603|ref|ZP_05812791.1| flagellar basal body FlaE domain protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259029609|gb|EEW30897.1| flagellar basal body FlaE domain protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 418

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 185/422 (43%), Positives = 254/422 (60%), Gaps = 5/422 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S  +DNIAN DT GYKR++  FS+L+ PST  +Y SGG+
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTTADNIANSDTTGYKRSSAEFSTLIMPSTGGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + +  +S+ G L +T S +DLA+ G GFF+V+       LTRAG F  + +G L N A
Sbjct: 61  TTTIRQAVSDPGVLQYTTSVSDLAVSGDGFFVVQDPSGTPYLTRAGAFVPDAQGRLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+ Y   N +    VN F+GLE + +    L+A P+T G  S NL   AT +     
Sbjct: 121 GFQLMAYSYANGTPAATVNGFEGLEPVVIADQGLTATPSTAGSFSGNLPAGATAVATANL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST-NNSFPYNV 239
           P  N   A+YT KSS  AYD LG+  + DVY+T TG   W+V++F Q ++T   SFPY  
Sbjct: 181 PGANAATAQYTSKSSMVAYDNLGNKKLLDVYFTNTGTGTWQVAVFDQSKATAGTSFPYTG 240

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
             L T  ++FD  TG L   +  ++SF   T      + +D+S  TQL  GF    +++N
Sbjct: 241 GALGTANLTFDTTTGKL-TGTPTSVSF---TVPGGASLNLDLSTLTQLGTGFTVSDAQVN 296

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP       +SKDG +   Y DGT  P+Y++ +A V S D LK   GN Y    DSG 
Sbjct: 297 GNAPSAIDKVQISKDGTIYAQYKDGTSKPLYKIPLADVQSPDQLKALPGNVYAQGTDSGA 356

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           + +GF    + G I SGALE +NVDIA ELT++I AQR+Y  NSKVFQTGSD MD+L++L
Sbjct: 357 VRVGFANEGKAGSIISGALENSNVDIAEELTDMIAAQRSYTANSKVFQTGSDLMDVLVNL 416

Query: 420 KR 421
           KR
Sbjct: 417 KR 418


>gi|13472592|ref|NP_104159.1| flagellar hook protein FlgE [Mesorhizobium loti MAFF303099]
 gi|14023338|dbj|BAB49945.1| flagellar hook protein; FlgE [Mesorhizobium loti MAFF303099]
          Length = 418

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 185/422 (43%), Positives = 255/422 (60%), Gaps = 5/422 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S  +DNIAN DT GYKR++  FS+L+ PST  +Y SGG+
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTTADNIANSDTTGYKRSSAEFSTLIMPSTGGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + +  +S+ G L +T S +DLA+ G GFF+V+       LTRAG F  + +G L N A
Sbjct: 61  TTTIRQAVSDPGVLQYTTSVSDLAVSGDGFFVVQDPSGTPFLTRAGAFVPDAQGRLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+ Y   N +    VN F+GL+ + +    L+A P+T G  S NL   AT +     
Sbjct: 121 GFQLMAYSYANGTPAATVNGFEGLQPVVISDQGLTATPSTLGTYSGNLPAGATPVAAANL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST-NNSFPYNV 239
           P  N   A+YT KSS  AYD LG+  + DVY+T TG   W+V++F Q ++T   SFPY  
Sbjct: 181 PGANASTAQYTSKSSMVAYDNLGNKKLLDVYFTNTGTGTWQVAVFDQSKATPGTSFPYTG 240

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
             L T  ++FD  TG L   +  ++SF   T      + +D+SK TQL  GF    +++N
Sbjct: 241 GALGTANLTFDTTTGKL-TGAPTSVSF---TVPGGASLNLDLSKLTQLGTGFTVSDAQVN 296

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP       +SKDG +   Y DG+  P+Y++ +A V S D LK   GN Y    DSG 
Sbjct: 297 GNAPSTIDKVQISKDGTIYAQYKDGSTKPLYKIPLADVQSPDQLKALPGNVYAQGTDSGA 356

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I +GF    + G I SGALE +NVDIA ELT++I AQR+Y  NSKVFQTGSD MD+L++L
Sbjct: 357 IRVGFANEGKAGSIISGALENSNVDIAEELTDMIAAQRSYTANSKVFQTGSDLMDVLVNL 416

Query: 420 KR 421
           KR
Sbjct: 417 KR 418


>gi|110632640|ref|YP_672848.1| flagellar hook protein FlgE [Mesorhizobium sp. BNC1]
 gi|110283624|gb|ABG61683.1| flagellar basal body FlaE [Chelativorans sp. BNC1]
          Length = 422

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 188/425 (44%), Positives = 260/425 (61%), Gaps = 7/425 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G MKT +SGM+AQ+NR+S V+DNIAN  T GYKR    FS+LV P T  SY SGG+
Sbjct: 1   MSLYGMMKTGVSGMNAQANRLSTVADNIANSSTNGYKRATTEFSTLVVPGTQGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + ++ +S QG L +T S TDLA+ G GFFIV+G +    LTRAG F ++ +G L N +
Sbjct: 61  TSTVRNAVSAQGVLQYTTSITDLAVNGSGFFIVQGSNGQPYLTRAGSFVLDGDGRLVNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII---TP 177
           G  L+GY   N +     N + GLE I +K  EL A P+  G  S NL  +A I+     
Sbjct: 121 GYQLMGYSYANGTPSATANGYAGLEPITIKQPELVATPSRNGVFSANLPLDAEIVDTGAG 180

Query: 178 DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF-RQDQSTNNSFP 236
             T   N   +EY+ K+S  AY   G  V+ DVY+TKTGD +WEV++F R D + +  FP
Sbjct: 181 QSTAGDNTSTSEYSVKTSLVAYGNRGEQVLLDVYFTKTGDDEWEVAVFDRADATPDTGFP 240

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
           Y   PL T +++FDP TG L  +S   ++      G D  + +D+S+ +QL  GF    +
Sbjct: 241 YASGPLATDQLTFDPTTGKLTGTSVTGVTI--PVPGGD-DLELDLSQLSQLDSGFQVYDA 297

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
           E++G  P       +S +G V   Y DG+  P+YR+ +A V S D L++  GN +  T  
Sbjct: 298 EVDGTPPTSIDSIEISAEGIVYAQYADGSFKPLYRIPLANVTSPDQLEVLSGNAFAETAA 357

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG + IGF G +  G+I SGALE++NVDIA ELT +IE+QR+Y  NSKVFQTGSD M++L
Sbjct: 358 SGAVRIGFAGSDGLGDIASGALESSNVDIAEELTSMIESQRSYTANSKVFQTGSDLMELL 417

Query: 417 ISLKR 421
           ++LKR
Sbjct: 418 VNLKR 422


>gi|86360902|ref|YP_472789.1| flagellar hook protein FlgE [Rhizobium etli CFN 42]
 gi|86285004|gb|ABC94062.1| flagellar hook protein [Rhizobium etli CFN 42]
          Length = 430

 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 200/440 (45%), Positives = 268/440 (60%), Gaps = 29/440 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 121 GYTLMGYSYDSGVPAVVVNGFDGLVPVNVAQSGLSAIASTSAYFSGNLNSEATVVTDTTT 180

Query: 181 -PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQ- 227
            P  N     + T K S  AYD+LG++V YD Y+TKTG             WEV+++R  
Sbjct: 181 LPSANTSGVTDDTQKMSLVAYDSLGATVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 228 DQST--NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITIDI 281
           D +T    SFPY+ + ++   +SFD   G L +++   I        +D    + IT+D 
Sbjct: 241 DAATGGTTSFPYSSSAVSVATLSFDA-DGQLTSATDTDI--------VDPVTAKTITMDY 291

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQLA  F    S  +G A       S+  DG V + Y +GT   +Y++ +ATV S D
Sbjct: 292 SDFTQLASDFSATGSA-DGQAASAVSSVSIGTDGVVSVSYANGTTKSLYQIPLATVASPD 350

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
           NL L  GN Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  
Sbjct: 351 NLTLLSGNVYTANGMSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTA 410

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 411 NSKVFQTGSDIMDVLVNLKR 430


>gi|241203124|ref|YP_002974220.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857014|gb|ACS54681.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 432

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 202/438 (46%), Positives = 263/438 (60%), Gaps = 23/438 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S+TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGPDGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--ITPD 178
           G +L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I  + P 
Sbjct: 121 GFMLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGIFKGNLDSNAKIAPVAPA 180

Query: 179 KTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-----------TGDKKWEVSIFR 226
             P  N       T K S  AYD LG+ V+YD Y+TK                WEVS+FR
Sbjct: 181 TLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKKTVVTPPPATPATAATWEVSMFR 240

Query: 227 QDQST---NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
              +      SFPY+ A + T  +SFD   G L  ++  A++  D  +G  Q I +D S 
Sbjct: 241 NADAAVGGTTSFPYSTASVGTGTLSFD-ANGKL--TAGGAVNIVDPVTG--QTIAMDFSA 295

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQL   F    +  NG A    KD +V  DG V   Y+DG+  P+YR+ +A V S D L
Sbjct: 296 FTQLGADFSGTGTP-NGQAATPVKDVTVDGDGIVYAKYEDGSTKPLYRIPLANVASPDKL 354

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
            L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  NS
Sbjct: 355 TLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTANS 414

Query: 404 KVFQTGSDFMDILISLKR 421
           KVFQTGSD MD+L++LKR
Sbjct: 415 KVFQTGSDIMDVLVNLKR 432


>gi|209547530|ref|YP_002279448.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209538774|gb|ACI58708.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 430

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 198/440 (45%), Positives = 264/440 (60%), Gaps = 29/440 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S+ DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSDYDLAISGDGFFIVQSADGTPVLTRAGDFSVDSDGNLVNGA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 121 GFTLMGYSYDSGVPAVVVNGFDGLVPVNVSQSGLSAVASTSAYFSGNLNSEATVVTDTTT 180

Query: 181 -PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQD 228
            P  N     + T K S  AYD+LG +V YD Y+TKT              WEV+++R  
Sbjct: 181 LPSANTSAVTDDTQKMSLVAYDSLGGTVQYDYYFTKTSVTTDSAGAVTGSTWEVAVYRNA 240

Query: 229 QST---NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITIDI 281
            +T     SFPY+   ++   +SFD   G L +++   I        +D    Q IT+D 
Sbjct: 241 DATTGGTTSFPYSSDAVSVATLSFDA-DGQLTSAADTDI--------VDPVTAQTITMDY 291

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQLA  F    S  +G A       S+  DG V + Y +G    +Y++ +ATV S D
Sbjct: 292 SDFTQLASDFSATGSA-DGQAASAVSSVSIGTDGVVSVSYANGATKALYQIPLATVASPD 350

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
           NL L  GN Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  
Sbjct: 351 NLTLLSGNVYSANGQSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTA 410

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 411 NSKVFQTGSDIMDVLVNLKR 430


>gi|327193059|gb|EGE59971.1| flagellar hook protein [Rhizobium etli CNPAF512]
          Length = 434

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 200/440 (45%), Positives = 259/440 (58%), Gaps = 25/440 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S VSDNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVSDNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFQKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--ITPD 178
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA +  + P 
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGVFKGNLDSNANVAPVAPA 180

Query: 179 KTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG------------DKKWEVSIF 225
             P  N       T K S  AYD LG+ V+YD Y+TKT                WEV++F
Sbjct: 181 TLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKTAVAAAPPPAPPAAAATWEVAMF 240

Query: 226 RQDQSTNN---SFPYNV-APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
           R   +      SFPY+    + T  ++FD     L   +  AI+  D  +G  Q I +D 
Sbjct: 241 RNANAATGGTTSFPYSAGGAVGTGSITFDRDGKLL---TGGAINITDGVTG--QTIAMDF 295

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQL   F    +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D
Sbjct: 296 SGLTQLGAAFSGTGTP-NGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPD 354

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  
Sbjct: 355 KLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTA 414

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 415 NSKVFQTGSDIMDVLVNLKR 434


>gi|190890382|ref|YP_001976924.1| flagellar hook protein [Rhizobium etli CIAT 652]
 gi|190695661|gb|ACE89746.1| flagellar hook protein [Rhizobium etli CIAT 652]
          Length = 433

 Score =  341 bits (874), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 200/439 (45%), Positives = 260/439 (59%), Gaps = 24/439 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S VSDNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVSDNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI-ITPDK 179
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I + P  
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVSQDGLTAIASTSGVFKGNLDSNAKIPVAPAT 180

Query: 180 TPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTK------------TGDKKWEVSIFR 226
            P  N       T K S  AYD LG+ V+YD Y+TK                 WEV+++R
Sbjct: 181 LPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKQSVAAAPPPAPPATAATWEVAMYR 240

Query: 227 QDQSTNN---SFPYNV-APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS 282
              +      SFPY     + T  ++FD   G +  +S  A++ ND  +G  Q I +D S
Sbjct: 241 NANAATGGTTSFPYTAGGAVGTGSLTFD-ANGKM--TSSGAVTINDGVTG--QSIAMDFS 295

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
             TQL   F    +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D 
Sbjct: 296 GLTQLGADFSGTGTP-NGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDK 354

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  N
Sbjct: 355 LTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTAN 414

Query: 403 SKVFQTGSDFMDILISLKR 421
           SKVFQTGSD MD+L++LKR
Sbjct: 415 SKVFQTGSDIMDVLVNLKR 433


>gi|327192294|gb|EGE59259.1| flagellar hook protein FlgE [Rhizobium etli CNPAF512]
          Length = 483

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 202/436 (46%), Positives = 268/436 (61%), Gaps = 21/436 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 54  MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 113

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  ISEQG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 114 QTSVRQAISEQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNSA 173

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 174 GYTLMGYSYDSGVPAVVVNGFDGLVPVNVAQSGLSAIASTSAYFSGNLNSEATVVTDTTT 233

Query: 181 -PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQ- 227
            P  N     + T K S  AYD+LG++V YD Y+TKTG             WEV+++R  
Sbjct: 234 LPSANTSSVTDDTQKMSLVAYDSLGATVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 293

Query: 228 DQST--NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
           D +T    SFPY+   ++   +SFD   G L +++   I   D T+   Q I++D S  T
Sbjct: 294 DAATRGTTSFPYSSDAVSVSTLSFD-ADGQLTSATDTDIV--DPTTA--QTISMDYSSFT 348

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           QLA  F    S  +G A       S+  DG V + Y +GT   +Y++ +ATV S DNL L
Sbjct: 349 QLASDFSATGSA-DGQAASSVSSVSIDTDGVVSVSYANGTTKALYQIPLATVASPDNLTL 407

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
             GN Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  NSKV
Sbjct: 408 LSGNVYTANGRSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKV 467

Query: 406 FQTGSDFMDILISLKR 421
           FQTGSD MD+L++LKR
Sbjct: 468 FQTGSDIMDVLVNLKR 483


>gi|209547946|ref|YP_002279863.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533702|gb|ACI53637.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 433

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 198/439 (45%), Positives = 259/439 (58%), Gaps = 24/439 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QSSVRQAVSDQGDISYTTSGTDLAISGDGFFIVQGADGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI-ITPDK 179
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I + P  
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVSQDGLTAIASTSGVFKGNLDSNAKIPVAPAT 180

Query: 180 TPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG------------DKKWEVSIFR 226
            P  N G     T K S  AYD LG+ V+YD Y+TK                 WEV++FR
Sbjct: 181 APSANLGTTTTDTKKVSMVAYDRLGNKVMYDFYFTKASVAAAPPPAPPATAATWEVAMFR 240

Query: 227 QDQST---NNSFPYNV-APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS 282
              +      SFPY     +    ++FD   G +  +S  A++  D  +G  Q I +D S
Sbjct: 241 NANAAVGGTTSFPYTAGGAVGNGTLTFDS-NGKM--TSSGAVNITDGVTG--QTIAMDFS 295

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
             TQL   F    +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D 
Sbjct: 296 GLTQLGADFSGTGTP-NGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDK 354

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  N
Sbjct: 355 LTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTAN 414

Query: 403 SKVFQTGSDFMDILISLKR 421
           SKVFQTGSD MD+L++LKR
Sbjct: 415 SKVFQTGSDIMDVLVNLKR 433


>gi|241113584|ref|YP_002973419.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240861792|gb|ACS59458.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 430

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 197/440 (44%), Positives = 265/440 (60%), Gaps = 29/440 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +T GYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTTGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNGA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +++ + S NL+  AT++T   T
Sbjct: 121 GFTLMGYSYDSGVPAVVVNGFDGLVPVNVSQSGLSAVASSSAYFSGNLNSEATVVTDTTT 180

Query: 181 -PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQ- 227
            P  N     + T K S  AYD+LG +V YD Y+TKTG             WEV+++R  
Sbjct: 181 LPSANTASVTDDTQKMSLVAYDSLGGTVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 228 DQSTNN--SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITIDI 281
           D ST +  SFPY+   ++   +SFD   G L +++   I        +D    + IT+D 
Sbjct: 241 DASTGSTTSFPYSSDAVSVATLSFDA-DGQLTSATDTDI--------VDPVTAKTITMDY 291

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQL+  F    S  +G A       S+  DG V + Y +G    +Y++ +ATV S D
Sbjct: 292 SDFTQLSSDFSATGSA-DGQAASAVSSVSIGTDGVVSVSYANGATKALYQIPLATVASPD 350

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
           NL L  GN Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  
Sbjct: 351 NLTLLSGNVYSANGLSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTA 410

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 411 NSKVFQTGSDIMDVLVNLKR 430


>gi|116248740|ref|YP_764581.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115253390|emb|CAK11778.1| putative flagellar hook protein flgE [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 430

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 196/440 (44%), Positives = 265/440 (60%), Gaps = 29/440 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +T GYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTTGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNGA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +++ + S NL+  AT++T   T
Sbjct: 121 GFTLMGYSYDSGVPAVVVNGFDGLVPVNVSQSGLSAIASSSAYFSGNLNSEATVVTNTTT 180

Query: 181 -PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQ- 227
            P  N     + T K S  AYD+LG +V YD Y+TKTG             WEV+++R  
Sbjct: 181 LPSANTASVTDDTQKMSLVAYDSLGGTVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 228 DQSTNN--SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITIDI 281
           D +T +  SFPY+   ++   +SFD   G L +++   I        +D    + +T+D 
Sbjct: 241 DAATGSTTSFPYSSDAVSVATLSFDA-DGQLTSATDTDI--------VDPVTAKTVTMDY 291

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQLA  F    S  +G A       S+  DG V + Y +G    +Y++ +ATV S D
Sbjct: 292 SDFTQLASDFSATGSA-DGQAASAVSSVSIGADGVVSVSYANGATKALYQIPLATVASPD 350

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
           NL L  GN Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  
Sbjct: 351 NLTLLSGNVYSANGLSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTA 410

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 411 NSKVFQTGSDIMDVLVNLKR 430


>gi|319781665|ref|YP_004141141.1| flagellar hook-basal body protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167553|gb|ADV11091.1| flagellar hook-basal body protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 419

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 181/423 (42%), Positives = 252/423 (59%), Gaps = 6/423 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN DT GYKR++  FS+LV PST  +Y SGG+
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANSDTTGYKRSSAEFSTLVMPSTGGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + +  +S+ G L +T S +DLA+ G GFF+V+       LTRAG F  + +G L N A
Sbjct: 61  TTTIRQAVSDPGVLQYTTSVSDLAVSGDGFFVVQDPSGTPYLTRAGAFVPDGQGRLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+ Y  +N      VN F+GL  + +    ++A P+T G  + NL   AT +     
Sbjct: 121 GFQLMAYSYENGVPAATVNGFEGLVPVVISDQGMTATPSTEGSFAGNLPAGATPVATANL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST-NNSFPYNV 239
           P  N   A+YT KSS  AYD LG+  + DVY+T TG   W+V++F Q ++T   SFPY  
Sbjct: 181 PAANAATAQYTSKSSMVAYDNLGNKKLLDVYFTNTGAGTWQVAVFDQSKATAGTSFPYTA 240

Query: 240 AP-LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L +  ++FD  TG L  +    +SF   T      + +D+S  TQL  GF    +++
Sbjct: 241 GGLLGSANLTFDTTTGKLTGTPTN-VSF---TVPNGATLNLDLSALTQLGTGFTVSDAQV 296

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+AP       +SKDG +   Y DG+  P+Y++ +A V S D LK   GN Y    +SG
Sbjct: 297 NGNAPSTIDKVQISKDGTIYAQYKDGSTKPLYKIPLADVQSPDQLKALPGNVYSQGTESG 356

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
            + +GF    + G I SGALE +NVDIA ELT +I AQR+Y  NSKVFQTGSD MD+L++
Sbjct: 357 AVRVGFANEGKLGSIISGALENSNVDIAEELTNMIAAQRSYTANSKVFQTGSDLMDVLVN 416

Query: 419 LKR 421
           LKR
Sbjct: 417 LKR 419


>gi|218674739|ref|ZP_03524408.1| flagellar hook protein FlgE [Rhizobium etli GR56]
          Length = 433

 Score =  332 bits (851), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 197/439 (44%), Positives = 260/439 (59%), Gaps = 24/439 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTSGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGADGTPVLTRAGDFQKDDEGNLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI-ITPDK 179
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I + P  
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGVFKGNLDSNAKIPVAPAT 180

Query: 180 TPKHNGRDAEYTHKS-SFAAYDTLGSSVVYDVYYTK------------TGDKKWEVSIFR 226
            P  N        K  S  AYD LG+ V+YD Y+TK                 WEV++FR
Sbjct: 181 LPSANAATTTTDTKKVSMVAYDRLGNKVMYDFYFTKQSVAAAPPPAPPATAATWEVAMFR 240

Query: 227 QDQST---NNSFPYNV-APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS 282
              +      SFPY+V   + T  ++FD   G +  +S  A++  D  +G  Q I ++ S
Sbjct: 241 NANAAVGGTTSFPYSVGGAVGTGTLTFDS-NGKM--TSSGAVNITDGVTG--QTIAMNFS 295

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
             TQL   F    +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D 
Sbjct: 296 GLTQLGADFSGTGTP-NGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDK 354

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  N
Sbjct: 355 LTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTAN 414

Query: 403 SKVFQTGSDFMDILISLKR 421
           SKVFQTGSD MD+L++LKR
Sbjct: 415 SKVFQTGSDIMDVLVNLKR 433


>gi|86356330|ref|YP_468222.1| flagellar hook protein FlgE [Rhizobium etli CFN 42]
 gi|86280432|gb|ABC89495.1| flagellar hook protein [Rhizobium etli CFN 42]
          Length = 434

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 197/440 (44%), Positives = 258/440 (58%), Gaps = 25/440 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S VSDNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVSDNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFQKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--ITPD 178
           G  L+GY   + +  ++VN F GL  +NV    L+A+ +T+G    NLD  A I  + P 
Sbjct: 121 GFQLMGYSYDSGAPAVVVNGFDGLVPVNVNQEGLTAIASTSGVFKGNLDSGANIAPVAPA 180

Query: 179 KTPKHNGRDAEYTHKS-SFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQ 227
             P  N        K  S  AYD LG+ V+YD Y+TKT              WEV++FR 
Sbjct: 181 TLPSANAATTTADTKKFSMVAYDHLGNKVMYDFYFTKTSVVTPPPATGTASTWEVAVFRN 240

Query: 228 -DQSTNN--SFPYN---VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
            D +T    SFPY     A + +  ++FD     L   +  A+   D  + +   I +D+
Sbjct: 241 ADAATGGTTSFPYTGGAGAVVASGNLTFDRNGKML---TGGALPIADTKNAL--SINMDL 295

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQL   F    +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D
Sbjct: 296 SGFTQLGAAFAGTGTP-NGQAASPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPD 354

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  
Sbjct: 355 KLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTA 414

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 415 NSKVFQTGSDIMDVLVNLKR 434


>gi|222084885|ref|YP_002543414.1| flagellar hook protein [Agrobacterium radiobacter K84]
 gi|221722333|gb|ACM25489.1| flagellar hook protein [Agrobacterium radiobacter K84]
          Length = 425

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 186/430 (43%), Positives = 261/430 (60%), Gaps = 14/430 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR++ VSDNIAN  T GYK+ + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAISGMNAQANRLATVSDNIANSSTTGYKQASTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E + +  IS+QG++  T S+TDLAIQG GFF+V+       LTR+GDF  +  G L N A
Sbjct: 61  ETTVRYAISQQGTVSATTSSTDLAIQGNGFFVVQSAAGQTFLTRSGDFSADASGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + +  ++VN F G+  INV  +  S   TT G ++ NL+ NATI T   T
Sbjct: 121 GFTLMGYSSASGAPSVVVNGFSGMVPINVTPSGTSVAATTVGSMTGNLNSNATIATSSST 180

Query: 181 ---PKHNGRDAEY-THKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ----DQSTN 232
              P  N       T KSS   YD+ G++V +D+YYTKT D  W+V ++ Q       T+
Sbjct: 181 GYLPSENTYPVTTDTSKSSITGYDSQGNAVTFDIYYTKTADNTWDVQVYNQADLVASPTS 240

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG-IDQQITIDISKTTQLAGGF 291
               Y+ A + + E++FD   G L +     +SF   TSG   Q I +D++  TQ+A  F
Sbjct: 241 GGPLYSSAAVGSTEMTFDD-DGALVSGGTFDLSF---TSGSTTQSIAMDMTGFTQVATDF 296

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                +++G AP      +++KDG V  +Y D +   +YR+ +ATV S D+L L  GN Y
Sbjct: 297 -SATGKMDGQAPNPVTSVTIAKDGTVSAVYKDSSTKELYRIPLATVASPDSLTLESGNVY 355

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
               DSG    G+P     G I SGALE +NVD+A+ELT +I AQ++Y  NSKVFQ GSD
Sbjct: 356 SANGDSGVTVTGWPQSGGLGYIQSGALEESNVDLATELTNMITAQKSYTANSKVFQAGSD 415

Query: 412 FMDILISLKR 421
            +D+L++L+R
Sbjct: 416 LLDVLVNLQR 425


>gi|312115280|ref|YP_004012876.1| flagellar hook-basal body protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220409|gb|ADP71777.1| flagellar hook-basal body protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 413

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 177/420 (42%), Positives = 253/420 (60%), Gaps = 10/420 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G + T+ SGM AQS  +S V+DNIANV T GYKR +  FS+LV  S + +Y SGG+
Sbjct: 1   MSLYGLLNTSASGMAAQSTALSTVADNIANVSTTGYKRASTEFSTLVASSGAGNYQSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           ++ T+  I  Q     T+S+TDLA+ G GFFIV G +    LTRAG F    +G LEN A
Sbjct: 61  DVDTRVAIGSQSGTTSTSSSTDLAVDGNGFFIVSGPNGTPALTRAGSFEKQADGTLENAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT-PDK 179
           G  LLGYP+    +    NS+ GLE +N+    + A+P+T G ++ NL   AT +T   K
Sbjct: 121 GYTLLGYPVGTTPS---ANSYAGLEEVNISDLAMKAVPSTEGTVTFNLPLQATAVTDATK 177

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
            P  N  DA YT K+SF AY+  G++V  D YYTKT D  WEVS++ Q  +T   FPY+ 
Sbjct: 178 LPSANAADATYTQKTSFTAYNNAGTAVNLDAYYTKTADNTWEVSVYNQADATAGGFPYSS 237

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
             L T  ++FD  T  L + +  +I   + ++     + +DISK+TQL   +    + +N
Sbjct: 238 GALATETLTFDSTTYALTSPTSLSIPVPNGST-----VVLDISKSTQLDAKYT-FSANVN 291

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A    K   +S DG + ++Y+DG+ V  Y + +A V S DN+ +  GN YLP +DSG 
Sbjct: 292 GNAASAVKSVEISDDGTLSVVYEDGSSVAAYTIPLAMVASPDNMTVISGNAYLPNQDSGS 351

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           + IG  G N  G I S  LE ++VD+A+ELT +I++Q  Y  N+KVFQTGSD + +L++L
Sbjct: 352 VQIGTAGTNGFGTIGSYTLENSDVDLATELTRMIQSQNIYQSNAKVFQTGSDLLKVLVNL 411


>gi|328545491|ref|YP_004305600.1| flagellar basal body FlaE [polymorphum gilvum SL003B-26A1]
 gi|326415232|gb|ADZ72295.1| Flagellar basal body FlaE [Polymorphum gilvum SL003B-26A1]
          Length = 424

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/429 (40%), Positives = 253/429 (58%), Gaps = 13/429 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQS+++  V+DNIAN  T GYKR A  FSS++    + +Y SGG+
Sbjct: 1   MSLYGVMRTGVSGMNAQSSKLGTVADNIANSSTTGYKRAASEFSSMILSQGTGTYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +  T   IS+QG++ +T S  DLAI G GFF+V  R+    LTRAG F ++++G+L N A
Sbjct: 61  KAHTVYAISQQGAISYTTSGLDLAIDGNGFFVVADREGSTALTRAGSFVVDSKGYLVNTA 120

Query: 121 GGVLLGYPLKNAS--APLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
           G  L GYP+ N    AP + N   GLE +NV  ++L A+PT +  +  N+ ++A I+   
Sbjct: 121 GYYLQGYPIGNGGTVAP-VANGLGGLENVNVSQSKLEAVPTDSALLWANVPEDAAIVAAA 179

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK----TGDKKWEVSIFRQDQST-NN 233
             P  N   A Y+ K+S   YD LG++V  D+YY+K      D  WEV+I+  D +    
Sbjct: 180 DLPSANAATATYSAKTSLIVYDNLGNAVTLDIYYSKATETAADSDWEVTIYNADDAAPGG 239

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFI 292
            FPY    L T  ++FD  TG LA +S   I+    N S  D    +D+S  T L   F 
Sbjct: 240 GFPYGAPALATQTITFDRTTGNLAAASPTDITVAVPNGSTFD----LDMSGMTYLNADFT 295

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
             + + NG+AP   +    + DG +  +Y +G R  +YR+ +A VPS D L    GN Y 
Sbjct: 296 ITEVDANGNAPSAVESVEFADDGTLFAVYANGDRRALYRIPLADVPSPDKLTPLSGNIYT 355

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            + +SG++ +GFPG    G +  GALE++NVD+ASELT +IE+QR Y  NSKVF+ GSD 
Sbjct: 356 VSNNSGEVRVGFPGEGGLGSLTVGALESSNVDLASELTSMIESQRGYTANSKVFKAGSDL 415

Query: 413 MDILISLKR 421
           ++ L++L R
Sbjct: 416 LEELVNLVR 424


>gi|254503336|ref|ZP_05115487.1| Flagellar basal body protein FlaE [Labrenzia alexandrii DFL-11]
 gi|222439407|gb|EEE46086.1| Flagellar basal body protein FlaE [Labrenzia alexandrii DFL-11]
          Length = 421

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 180/426 (42%), Positives = 247/426 (57%), Gaps = 16/426 (3%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKD 66
           M+T +SGM+AQS+++ AV+DNIAN  T GYKR    F+S V      SY SGG++  TK 
Sbjct: 1   MRTGVSGMNAQSSKLGAVADNIANSSTTGYKRAETEFASQVLAQGGGSYNSGGVQAHTKY 60

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVK---GRDNVNCLTRAGDFHINNEGFLENVAGGV 123
            IS+QGS+  T S  DLA+ G GFFIV    G      LTRAG F  + +G+L N AG  
Sbjct: 61  AISDQGSMSFTTSKLDLAVDGNGFFIVSDSTGAGASQALTRAGSFVPDGQGYLVNTAGMY 120

Query: 124 LLGYPLKNASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
           L GYP+ N +AP +V N   GLE +N+   +L A PT+T  +  N+D+++ I+     P 
Sbjct: 121 LQGYPITNGNAPSVVANGLGGLEPVNITQNQLEATPTSTATLHANVDEDSAIVAAANLPS 180

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----WEVSIFR---QDQSTNNSF 235
            N   AEY+HK+S   YD LG+ V  DVYYTKT D      WEV+++    +D +T   F
Sbjct: 181 ANAATAEYSHKTSMVVYDNLGNEVTLDVYYTKTTDTPPTTDWEVTVYNAADRDPATG-GF 239

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
           PY  A + T  + FD  TG        A++  + T        ID+  +T    GF    
Sbjct: 240 PYGAANIGTSTIQFDTTTG----QRTGAVTAVNITVPNGGTYDIDLENSTYTDAGFTVTN 295

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
            + +G+AP   +     +DG +  IY +G R PIY++ +A VPS D L    GN Y P+ 
Sbjct: 296 VDADGNAPSSVEKVEFGEDGTLYSIYTNGDRRPIYKIPLADVPSPDKLDPVSGNIYRPSI 355

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           DSGD+ +GFPG    GE+  GALE +NVD+A+ELT +IE+QR Y  NS+VF+ GSD M  
Sbjct: 356 DSGDVRVGFPGDGGLGELAVGALEGSNVDLANELTSMIESQRTYTANSQVFKAGSDLMQE 415

Query: 416 LISLKR 421
           L++L R
Sbjct: 416 LVNLVR 421


>gi|118589967|ref|ZP_01547371.1| flagellar basal body FlaE [Stappia aggregata IAM 12614]
 gi|118437464|gb|EAV44101.1| flagellar basal body FlaE [Stappia aggregata IAM 12614]
          Length = 424

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 173/427 (40%), Positives = 247/427 (57%), Gaps = 9/427 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G M++ +SGM+AQS+++  V++NI N  T GYKR    FSSLV    + S+ SGG+
Sbjct: 1   MGLFGVMRSGVSGMNAQSSKLGTVAENIMNSSTTGYKRAKSEFSSLVVSQGAGSFNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E  T+  I+++G+L  T S  DLAI G GFF+V      + LTRAG F  + +G+L N A
Sbjct: 61  EAHTQYEITKKGNLSFTTSKLDLAIDGNGFFVVGNEAGESFLTRAGHFVPDGDGYLLNTA 120

Query: 121 GGVLLGYPLKNASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L GYP+   +AP  V N   GLERIN+   +L A PT+  F+  N+ ++A I+    
Sbjct: 121 GYYLQGYPITGNTAPTTVANGLGGLERINITQNQLEATPTSEAFLRVNVSEDAAIVPAAD 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK---TG-DKKWEVSIFR-QDQSTNNS 234
            P  N   A Y+HK+S   YD LG+ V  DVYY+K   TG D  WEV+I+   D +    
Sbjct: 181 LPSANAATASYSHKTSMIVYDNLGNEVKLDVYYSKVTETGTDSDWEVTIYNAADAAPGGG 240

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
           FPY    LNT  ++FD  TG L  +S  +I+      G      +D+ ++T L   F   
Sbjct: 241 FPYTAPALNTQTLTFDVTTGNLTGASATSINIAVPNGGT---FDLDLDQSTYLNADFTVT 297

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
             + +G+AP   K+   + DG +  +Y +G R  IY++ +A VPS D L    GN Y  +
Sbjct: 298 NVDADGNAPSAVKNVEFADDGTLFAVYANGDRRAIYKIPLANVPSPDRLSNRSGNVYSTS 357

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            DSGD+ +GF G    G I  G LE +NVD+ +ELT +IE+QR Y  NS+VF+ GSD ++
Sbjct: 358 FDSGDVRVGFAGEGGMGAIKVGGLEDSNVDLGNELTSMIESQRTYTANSQVFKAGSDLLE 417

Query: 415 ILISLKR 421
            L++L R
Sbjct: 418 QLVNLVR 424


>gi|222147589|ref|YP_002548546.1| flagellar hook protein FlgE [Agrobacterium vitis S4]
 gi|221734577|gb|ACM35540.1| flagellar hook protein [Agrobacterium vitis S4]
          Length = 418

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 176/423 (41%), Positives = 262/423 (61%), Gaps = 7/423 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-SYVSGG 59
           M + GSM TA+SG+ AQ++++S V DN+AN DT GYKR + AFSSLV  S+ + +Y SGG
Sbjct: 1   MSLSGSMNTAVSGLQAQASKLSTVGDNVANSDTTGYKRVSTAFSSLVVGSSGSGTYNSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
           ++ +T + ISE+GS   + S TDLAI+G G+F+V+       LTRAGDF  ++ G++ N 
Sbjct: 61  VQTTTVNSISEEGSYQSSTSETDLAIKGDGYFVVQDEAGSVFLTRAGDFKADDNGYMVNS 120

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           AG  LLGY  +N     ++N F+GLE + ++   +SA  TT   I  NL  +  I++ D 
Sbjct: 121 AGYTLLGYSYENGEPASVINGFEGLEPVKIQDNSISANATTNALIEGNLKSSEPIVSGD- 179

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS-FPYN 238
            P  N   A ++ KSS  AYD+LG++  YD+YYTKT D +W+  IFR  ++T+ + FPY 
Sbjct: 180 LPDSNSASATWSFKSSMVAYDSLGNANQYDIYYTKTADNEWQADIFRTSEATDETNFPYT 239

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L +  ++FD   G +  SS    +F D+T+   Q I +D+S  TQL       + ++
Sbjct: 240 NGVLGSTTLTFDS-DGTV--SSGGTFTFTDSTTSAPQTIEVDMSTMTQLNSAN-SSEGDV 295

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+        +V+  G +   Y DG+   +Y++A+ATV S DN+K  +G  Y  T D+G
Sbjct: 296 DGNGASAASSVTVNSSGNIVATYQDGSTANLYKVALATVASPDNMKSVNGTAYQVTADAG 355

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
            + +GF      G I S  LET+NVD+A+ELT +I++QR+Y+ NSKVFQT +D +D LIS
Sbjct: 356 TVVVGFANTGSFGSINSKTLETSNVDLATELTNMIQSQRSYSANSKVFQTAADMLDTLIS 415

Query: 419 LKR 421
           LKR
Sbjct: 416 LKR 418


>gi|222147375|ref|YP_002548332.1| flagellar hook protein FlgE [Agrobacterium vitis S4]
 gi|221734365|gb|ACM35328.1| flagellar hook protein [Agrobacterium vitis S4]
          Length = 411

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 254/425 (59%), Gaps = 18/425 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M +  +M +++SG+ AQSN+++++ DNI+N  T GYK T  AFSSLV         +GG 
Sbjct: 1   MSLASAMNSSVSGLTAQSNKLTSIGDNISNTSTTGYKGTETAFSSLV---------NGGT 51

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             +T   +S+ G L  T+S TDLAI G G+F+V+  +    LTR GDF I+ +G+L N +
Sbjct: 52  TSTTTQTVSQSGDLESTSSETDLAIDGDGYFVVQDDEGDVFLTRQGDFEIDEDGYLVNSS 111

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLGY   N     ++N F GLE + +  +E++A  TTTG +S NL+ +  +++ D T
Sbjct: 112 GYTLLGYSYDNGEPASVINGFDGLEPVKIDTSEVTASATTTGEVSGNLESDEEVVSGD-T 170

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN----SFP 236
           P  N  DA +T KSS   YD  G+S  YD+Y+TKT D +WEVSI+R D++ ++    SFP
Sbjct: 171 PSSNSADATFTAKSSIVTYDEQGASTQYDIYFTKTDDDEWEVSIYRNDEANDDDDGTSFP 230

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
           Y+   L +  ++FD   G L + S   +SF D+ +G+   I +D S  TQ A      + 
Sbjct: 231 YDNGELGSTTLTFDSA-GELEDGSTSTLSFTDSETGL--TIDLDFSDITQTATS-TSIEG 286

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG A     D+++  DG +  +  DGT    Y++A+ATV S DNL+   G  Y    D
Sbjct: 287 SANGSAASSSSDYTIGSDGVISTVSSDGTTTDTYKIALATVASPDNLEEVGGTAYKVDAD 346

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG + +GF G    G I S  LE++NVD+ASEL+++I AQR Y+ NSKVFQT +D +D +
Sbjct: 347 SGTVVVGFAGTGSFGTIESSTLESSNVDLASELSDMIAAQRAYSANSKVFQTAADMLDTV 406

Query: 417 ISLKR 421
           I++ R
Sbjct: 407 INMVR 411


>gi|153011508|ref|YP_001372722.1| flagellar hook protein FlgE [Ochrobactrum anthropi ATCC 49188]
 gi|151563396|gb|ABS16893.1| flagellar basal body FlaE domain protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 426

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 171/421 (40%), Positives = 242/421 (57%), Gaps = 24/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+SAV+DNIAN  TVGYKR    FSSLV PST   Y SG +
Sbjct: 30  MSLYGMMRTGVSGMNAQANRLSAVADNIANASTVGYKRAETQFSSLVLPSTGGQYNSGSV 89

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G D    LTRAG F  +  G L N A
Sbjct: 90  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGADGSTFLTRAGSFVPDKNGNLVNSA 149

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG    + +  L   +  GL  INV  A L    +T+G  + NL         D+ 
Sbjct: 150 GYYLLGAGPNDPAGAL---TMAGLNIINVNSAALPPEASTSGNFTVNLPST------DQI 200

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P       E+ HK+S  +Y+  G  +  DVY+TKTG  +W V++           P    
Sbjct: 201 PAA----GEFNHKTSLISYNDKGEKITLDVYFTKTGADEWSVTVKNAADDAVVGGP---- 252

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
                 ++FDP TG + ++   A+          Q + +++  +TQ AG +   +++ING
Sbjct: 253 ----TTLTFDPTTGDMTSAGGVAVDLGPYGG---QNLNLNLGASTQRAGDYTISQAQING 305

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V+ DG V  IY++GT+  + R+ +A V S D + +  GN +LP+ DSGD+
Sbjct: 306 QAPSAVKGVDVANDGSVVAIYENGTQKVLARIPLANVASPDRMTVVSGNVFLPSADSGDV 365

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G++ SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 366 RLGFPQSDGMGKVMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 425

Query: 421 R 421
           R
Sbjct: 426 R 426


>gi|182680457|ref|YP_001834603.1| flagellar hook protein FlgE [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636340|gb|ACB97114.1| flagellar basal body FlaE domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 415

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 173/422 (40%), Positives = 242/422 (57%), Gaps = 8/422 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M +  ++  ++SGM AQSN++SAVSDNIAN +T GYK+    F +LV      SY +GG+
Sbjct: 1   MSLYSALTASVSGMAAQSNKLSAVSDNIANSNTTGYKQADTEFETLVNGLNKTSYDAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + + +  IS QG L  T+S TDL IQG GFF+V        LTRAG F  N +G L N A
Sbjct: 61  KTTIRYNISSQGQLTSTSSATDLGIQGNGFFVVTDDSGTKYLTRAGSFTKNADGTLSNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY L + SA    +   GLE +++  A L A P+T+G ++ NL  N   IT    
Sbjct: 121 GYKLMGYNLTSGSAS-SADGLGGLEVVDLTSAGLQAAPSTSGTLAVNLPSNGNAITT-AL 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS-FPYNV 239
           P  N   + Y  K+S   YD LG++V  D+Y+ KTG   WE+SI+    +     FPY  
Sbjct: 179 PSANSATSTYNSKTSLVTYDNLGNAVTLDMYFAKTGTNSWEMSIYNAADAAAGGGFPYAT 238

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
           + L+T  ++F P  G L   +  + +  +      Q  T+D+S+TTQLA GF       N
Sbjct: 239 SALSTQTLTFSPSDGSLTTPTSASFTIPNG-----QAFTLDLSQTTQLAAGFSVSAQNAN 293

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP   K  S+  DG +  +Y +GT V  Y++ +ATV S DNL +  GN Y    DSG 
Sbjct: 294 GNAPSGLKSISIGTDGVLSKVYQNGTTVAAYKIPLATVASVDNLMVGTGNVYEANGDSGS 353

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I IG  G N  G I S  LE++NVD+A++LT++I AQR Y  NSKVF+TGS  +  L++L
Sbjct: 354 IIIGDAGTNGLGSIQSSQLESSNVDLAAQLTDMIVAQRGYEANSKVFETGSTLLTELVNL 413

Query: 420 KR 421
            +
Sbjct: 414 VK 415


>gi|256059804|ref|ZP_05449999.1| flagellar hook protein FlgE [Brucella neotomae 5K33]
 gi|261323784|ref|ZP_05962981.1| flagellar hook protein flgE [Brucella neotomae 5K33]
 gi|261299764|gb|EEY03261.1| flagellar hook protein flgE [Brucella neotomae 5K33]
          Length = 396

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 175/421 (41%), Positives = 244/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  LIV    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLIV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|306845419|ref|ZP_07477993.1| flagellar hook protein FlgE [Brucella sp. BO1]
 gi|306274162|gb|EFM55978.1| flagellar hook protein FlgE [Brucella sp. BO1]
          Length = 396

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 176/422 (41%), Positives = 245/422 (58%), Gaps = 27/422 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTG-FISNNLDKNATIITPDK 179
           G  LLG     A+  L V    GL  +NV  A L A  +T G FI N       + + D+
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGNFIVN-------LPSTDQ 170

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
            P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+               
Sbjct: 171 APAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADG--------- 217

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
           A + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ IN
Sbjct: 218 AEIGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVIN 274

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD
Sbjct: 275 GQAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNVFLPSAESGD 334

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           + +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++L
Sbjct: 335 VRLGFPRGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNL 394

Query: 420 KR 421
           KR
Sbjct: 395 KR 396


>gi|227820875|ref|YP_002824845.1| flagellar hook protein FlgE [Sinorhizobium fredii NGR234]
 gi|227339874|gb|ACP24092.1| putative flagellar hook protein FlgE [Sinorhizobium fredii NGR234]
          Length = 404

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 243/428 (56%), Gaps = 31/428 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQ+NR+S V++NIAN  T GYKR +  FSS++ PS++ SY SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQANRLSTVAENIANSSTTGYKRASTEFSSMILPSSNGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E S +  IS+QGS  +T S +DLAI G GFFIV+G +    LTRAG F  ++ G L N A
Sbjct: 61  ETSVRYSISDQGSTTYTTSASDLAIDGDGFFIVQGANGQEYLTRAGAFVQDDSGNLVNAA 120

Query: 121 GGVLLGYPLKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P ++VN F GL  +N+    L+A  +T G +  NL   A       
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTEVNLASDGLTAAGSTAGAMGANLPSGA------- 173

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
               NG        +S   YDT G++ + D  YTK  D +WE+ I  +  +T+       
Sbjct: 174 ---ANGD----VSTTSLVVYDTQGNTRILDFNYTKVADNQWELDIVDRTSATS------- 219

Query: 240 APLNTVEVSFDPVTGYLANS------SHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
             L T  + FD   G L  S          IS    T      ITID ++TTQL   F P
Sbjct: 220 --LGTATLDFD-ADGVLTTSPATLTLDGTLISPITGTGAELNNITIDFTETTQLGTSFTP 276

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
               I+G+AP K   + +  DG V I Y +G   P YR+A+A+V S D L    GN Y  
Sbjct: 277 DGGSIDGNAPSKVSGYQIDTDGVVYIKYANGELEPRYRIALASVQSPDKLVPESGNVYSQ 336

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
             DSG I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +
Sbjct: 337 GVDSGVIVTGFAGSGSFGEILSGALESSNVDIADELTSMIESQRNYTANSKVFQTGSELL 396

Query: 414 DILISLKR 421
           ++L++LKR
Sbjct: 397 EVLVNLKR 404


>gi|254720773|ref|ZP_05182584.1| flagellar hook protein FlgE [Brucella sp. 83/13]
 gi|265985831|ref|ZP_06098566.1| flagellar hook protein flgE [Brucella sp. 83/13]
 gi|306840136|ref|ZP_07472921.1| flagellar hook protein FlgE [Brucella sp. NF 2653]
 gi|264664423|gb|EEZ34684.1| flagellar hook protein flgE [Brucella sp. 83/13]
 gi|306404781|gb|EFM61075.1| flagellar hook protein FlgE [Brucella sp. NF 2653]
          Length = 396

 Score =  298 bits (764), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 244/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+               A
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADG---------A 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNVFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ +D+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELIDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|254699262|ref|ZP_05161090.1| flagellar hook protein FlgE [Brucella suis bv. 5 str. 513]
 gi|254706497|ref|ZP_05168325.1| flagellar hook protein FlgE [Brucella pinnipedialis M163/99/10]
 gi|254711218|ref|ZP_05173029.1| flagellar hook protein FlgE [Brucella pinnipedialis B2/94]
 gi|254711818|ref|ZP_05173629.1| flagellar hook protein FlgE [Brucella ceti M644/93/1]
 gi|254714887|ref|ZP_05176698.1| flagellar hook protein FlgE [Brucella ceti M13/05/1]
 gi|256015898|ref|YP_003105907.1| flagellar hook protein [Brucella microti CCM 4915]
 gi|256030153|ref|ZP_05443767.1| flagellar hook protein FlgE [Brucella pinnipedialis M292/94/1]
 gi|256158332|ref|ZP_05456236.1| flagellar hook protein FlgE [Brucella ceti M490/95/1]
 gi|256252734|ref|ZP_05458270.1| flagellar hook protein FlgE [Brucella ceti B1/94]
 gi|260166795|ref|ZP_05753606.1| flagellar hook protein FlgE [Brucella sp. F5/99]
 gi|261216577|ref|ZP_05930858.1| flagellar hook protein flgE [Brucella ceti M13/05/1]
 gi|261219813|ref|ZP_05934094.1| flagellar hook protein flgE [Brucella ceti B1/94]
 gi|261313950|ref|ZP_05953147.1| flagellar hook protein flgE [Brucella pinnipedialis M163/99/10]
 gi|261318810|ref|ZP_05958007.1| flagellar hook protein flgE [Brucella pinnipedialis B2/94]
 gi|261319447|ref|ZP_05958644.1| flagellar hook protein flgE [Brucella ceti M644/93/1]
 gi|261749702|ref|ZP_05993411.1| flagellar hook protein flgE [Brucella suis bv. 5 str. 513]
 gi|261756173|ref|ZP_05999882.1| trypsin inhibitor Kunitz [Brucella sp. F5/99]
 gi|265987183|ref|ZP_06099740.1| flagellar hook protein flgE [Brucella pinnipedialis M292/94/1]
 gi|265996846|ref|ZP_06109403.1| flagellar hook protein flgE [Brucella ceti M490/95/1]
 gi|255998558|gb|ACU50245.1| flagellar hook protein [Brucella microti CCM 4915]
 gi|260918397|gb|EEX85050.1| flagellar hook protein flgE [Brucella ceti B1/94]
 gi|260921666|gb|EEX88234.1| flagellar hook protein flgE [Brucella ceti M13/05/1]
 gi|261292137|gb|EEX95633.1| flagellar hook protein flgE [Brucella ceti M644/93/1]
 gi|261298033|gb|EEY01530.1| flagellar hook protein flgE [Brucella pinnipedialis B2/94]
 gi|261302976|gb|EEY06473.1| flagellar hook protein flgE [Brucella pinnipedialis M163/99/10]
 gi|261736157|gb|EEY24153.1| trypsin inhibitor Kunitz [Brucella sp. F5/99]
 gi|261739455|gb|EEY27381.1| flagellar hook protein flgE [Brucella suis bv. 5 str. 513]
 gi|262551143|gb|EEZ07304.1| flagellar hook protein flgE [Brucella ceti M490/95/1]
 gi|264659380|gb|EEZ29641.1| flagellar hook protein flgE [Brucella pinnipedialis M292/94/1]
          Length = 396

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 243/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|300024588|ref|YP_003757199.1| flagellar hook-basal body protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526409|gb|ADJ24878.1| flagellar hook-basal body protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 417

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/423 (39%), Positives = 239/423 (56%), Gaps = 8/423 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G M T++SGM  QS+R+  V+DNIANV+T GYK  +  F++LV      SYV G +
Sbjct: 1   MGLYGLMTTSISGMAVQSDRMGTVADNIANVNTTGYKEASAEFATLVAEGHVASYVPGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  ++ QG L +T S TDLA+ G GFF+V+       LTRAG F I+  G L N A
Sbjct: 61  STIARRAVTHQGDLSYTNSPTDLAVSGNGFFMVQSPSGTPYLTRAGSF-ISTNGELVNAA 119

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLGY L N  +  ++NS  GL  +   +  L A P+T+G    NL  +A + T    
Sbjct: 120 GFTLLGYDLLNGGSSSVINSAAGLVPVGTANLGLKATPSTSGNFQVNLPSDAAVST--SL 177

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF-RQDQSTNNSFPYNV 239
           P  N   A++  K+S   YD LG  V  D+Y  KTG  +WEVS++     S    FPY  
Sbjct: 178 PSANAAGADFAGKTSIITYDNLGHKVTLDIYSAKTGPNQWEVSVYDNAGASAGGGFPYAA 237

Query: 240 -APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
            + L T  ++F   TG L + S   +S N         +  ++  TTQLAG +IP  +  
Sbjct: 238 GSQLTTQALTFSGTTGKLTSPSPATLSVNVPNG---ATLNFNMGNTTQLAGAYIPVDASA 294

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+ P       +S  G V  +Y DG+RV  +++ +A V S DNL    GN +   ++SG
Sbjct: 295 NGNGPSAVDRLEISAQGIVTAVYADGSRVDAFKIPLANVASPDNLTAISGNVFATNKESG 354

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           D+ +G       G+I SGALE ++VD+ASELT ++EAQR+Y  NSKVFQTG++ +D+L++
Sbjct: 355 DLQLGTANSGSLGKIVSGALEKSSVDLASELTTMVEAQRSYTANSKVFQTGTELLDVLVN 414

Query: 419 LKR 421
           L R
Sbjct: 415 LVR 417


>gi|294852968|ref|ZP_06793640.1| flagellar hook protein FlgE [Brucella sp. NVSL 07-0026]
 gi|294818623|gb|EFG35623.1| flagellar hook protein FlgE [Brucella sp. NVSL 07-0026]
          Length = 396

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 172/421 (40%), Positives = 241/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL      A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLDAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQT S+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTDSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|225628428|ref|ZP_03786462.1| flagellar hook protein FlgE [Brucella ceti str. Cudo]
 gi|225616274|gb|EEH13322.1| flagellar hook protein FlgE [Brucella ceti str. Cudo]
          Length = 456

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 243/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 61  MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 120

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 121 LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 180

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 181 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 231

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 232 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 279

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 280 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 335

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 336 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 395

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 396 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 455

Query: 421 R 421
           R
Sbjct: 456 R 456


>gi|23500854|ref|NP_700294.1| flagellar hook protein FlgE [Brucella suis 1330]
 gi|38257619|sp|Q8FUS9|FLGE_BRUSU RecName: Full=Flagellar hook protein FlgE
 gi|23464518|gb|AAN34299.1| flagellar hook protein FlgE [Brucella suis 1330]
          Length = 396

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 243/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S + + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|304392493|ref|ZP_07374433.1| flagellar hook protein FlgE [Ahrensia sp. R2A130]
 gi|303295123|gb|EFL89483.1| flagellar hook protein FlgE [Ahrensia sp. R2A130]
          Length = 423

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 169/427 (39%), Positives = 245/427 (57%), Gaps = 10/427 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN----SYV 56
           M + G M+T++SGM AQSNR+S V+DN+ANVDT GYK+ +  F+ LV P  S+    S  
Sbjct: 1   MSLYGMMRTSVSGMQAQSNRLSTVADNVANVDTTGYKKYSTEFAQLVRPGASSGVDSSLG 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
           SGG+    +  IS+QG++ +T S+TD+AI G GFF+V+     N LTRAG F  +  GFL
Sbjct: 61  SGGVLTDARQHISQQGNVSYTQSSTDIAINGNGFFVVEDSGGSNSLTRAGSFVADASGFL 120

Query: 117 ENVAGGVLLGYPLKN-ASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
            N  G  L G    +  + P  + S   LE ++V    L+A+PT  G    NL  N+  +
Sbjct: 121 VNAGGQRLKGVAADDQGNFPASIGSISALEPVSVDKQALAAVPTQNGRFVPNLPANSVAV 180

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF-RQDQSTNNS 234
           T D TP  N   + + HK+S  AYD LG + V D+Y T TG   WE++ F     S    
Sbjct: 181 TGD-TPVDNSAASTFAHKTSLTAYDNLGDAKVIDIYSTPTGPLTWEMTAFDASTASPTGG 239

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
           FPY  A L T  ++FDP  G LA  S   ++F   T    + + + ++ TTQLA  +   
Sbjct: 240 FPYASAALGTSTLTFDPANGQLAAGSPDTLTF---TVPNGRPVDLALAGTTQLAADYSIV 296

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
            ++++G  P   +   V  +G +   Y DG+   +YR+ +A V S D +    G  +L  
Sbjct: 297 TADLDGAPPASMEGIVVDGEGVLSARYSDGSLRDLYRIPLAAVVSPDRMDSDTGTVFLAN 356

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SGDI + F G   +G + SGALE +NV++A ELT++I AQR Y  NSKVFQTG+D MD
Sbjct: 357 TESGDIRVDFAGTGSNGVLISGALEQSNVELADELTDMIRAQRGYTANSKVFQTGADLMD 416

Query: 415 ILISLKR 421
           ++++L+R
Sbjct: 417 VIVNLRR 423


>gi|2832235|gb|AAC01569.1| flagellar hook [Brucella abortus]
          Length = 396

 Score =  295 bits (756), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 245/421 (58%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+  +D +          
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSV--KDAADG-------V 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|62317957|ref|YP_223810.1| flagellar hook protein FlgE [Brucella abortus bv. 1 str. 9-941]
 gi|83269934|ref|YP_419225.1| flagellar hook protein FlgE [Brucella melitensis biovar Abortus
           2308]
 gi|189023208|ref|YP_001932949.1| flagellar hook protein FlgE [Brucella abortus S19]
 gi|225686885|ref|YP_002734857.1| flagellar hook protein FlgE [Brucella melitensis ATCC 23457]
 gi|254691611|ref|ZP_05154865.1| flagellar hook protein FlgE [Brucella abortus bv. 6 str. 870]
 gi|254731634|ref|ZP_05190212.1| flagellar hook protein FlgE [Brucella abortus bv. 4 str. 292]
 gi|256112177|ref|ZP_05453098.1| flagellar hook protein FlgE [Brucella melitensis bv. 3 str. Ether]
 gi|256256798|ref|ZP_05462334.1| flagellar hook protein FlgE [Brucella abortus bv. 9 str. C68]
 gi|256261978|ref|ZP_05464510.1| trypsin inhibitor Kunitz [Brucella melitensis bv. 2 str. 63/9]
 gi|260544142|ref|ZP_05819963.1| trypsin inhibitor Kunitz [Brucella abortus NCTC 8038]
 gi|260757242|ref|ZP_05869590.1| flagellar hook protein flgE [Brucella abortus bv. 6 str. 870]
 gi|260759393|ref|ZP_05871741.1| flagellar hook protein flgE [Brucella abortus bv. 4 str. 292]
 gi|260883046|ref|ZP_05894660.1| flagellar hook protein flgE [Brucella abortus bv. 9 str. C68]
 gi|265993603|ref|ZP_06106160.1| flagellar hook protein flgE [Brucella melitensis bv. 3 str. Ether]
 gi|297250151|ref|ZP_06933852.1| flagellar hook protein flgE [Brucella abortus bv. 5 str. B3196]
 gi|68845076|sp|O52070|FLGE_BRUAB RecName: Full=Flagellar hook protein flgE
 gi|12330680|gb|AAG52877.1| FlgE [Brucella abortus]
 gi|62198150|gb|AAX76449.1| FlgE, flagellar hook protein [Brucella abortus bv. 1 str. 9-941]
 gi|82940208|emb|CAJ13264.1| Flagellar basal body rod protein:Trypsin inhibitor Kunitz [Brucella
           melitensis biovar Abortus 2308]
 gi|189021782|gb|ACD74503.1| Trypsin inhibitor Kunitz [Brucella abortus S19]
 gi|225642990|gb|ACO02903.1| flagellar basal body FlaE domain protein [Brucella melitensis ATCC
           23457]
 gi|260097413|gb|EEW81287.1| trypsin inhibitor Kunitz [Brucella abortus NCTC 8038]
 gi|260669711|gb|EEX56651.1| flagellar hook protein flgE [Brucella abortus bv. 4 str. 292]
 gi|260677350|gb|EEX64171.1| flagellar hook protein flgE [Brucella abortus bv. 6 str. 870]
 gi|260872574|gb|EEX79643.1| flagellar hook protein flgE [Brucella abortus bv. 9 str. C68]
 gi|262764473|gb|EEZ10505.1| flagellar hook protein flgE [Brucella melitensis bv. 3 str. Ether]
 gi|263091462|gb|EEZ15998.1| trypsin inhibitor Kunitz [Brucella melitensis bv. 2 str. 63/9]
 gi|297174020|gb|EFH33384.1| flagellar hook protein flgE [Brucella abortus bv. 5 str. B3196]
 gi|326411303|gb|ADZ68367.1| flagellar hook protein FlgE [Brucella melitensis M28]
 gi|326554592|gb|ADZ89231.1| flagellar hook protein FlgE [Brucella melitensis M5-90]
          Length = 396

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 242/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|17988503|ref|NP_541136.1| flagellar hook protein FlgE [Brucella melitensis bv. 1 str. 16M]
 gi|256042866|ref|ZP_05445812.1| flagellar hook protein FlgE [Brucella melitensis bv. 1 str. Rev.1]
 gi|260564103|ref|ZP_05834588.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. 16M]
 gi|265989301|ref|ZP_06101858.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. Rev.1]
 gi|38257707|sp|Q8YDL6|FLGE_BRUME RecName: Full=Flagellar hook protein flgE
 gi|17984295|gb|AAL53400.1| flagellar hook protein flge [Brucella melitensis bv. 1 str. 16M]
 gi|260151746|gb|EEW86839.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. 16M]
 gi|262999970|gb|EEZ12660.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. Rev.1]
          Length = 396

 Score =  295 bits (756), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 242/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNIVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|161621182|ref|YP_001595068.1| flagellar hook protein FlgE [Brucella canis ATCC 23365]
 gi|254702383|ref|ZP_05164211.1| flagellar hook protein FlgE [Brucella suis bv. 3 str. 686]
 gi|260568714|ref|ZP_05839183.1| flagellar hook protein FlgE [Brucella suis bv. 4 str. 40]
 gi|261752946|ref|ZP_05996655.1| flagellar hook protein FlgE [Brucella suis bv. 3 str. 686]
 gi|161337993|gb|ABX64297.1| flagellar basal body FlaE domain protein [Brucella canis ATCC
           23365]
 gi|260155379|gb|EEW90460.1| flagellar hook protein FlgE [Brucella suis bv. 4 str. 40]
 gi|261742699|gb|EEY30625.1| flagellar hook protein FlgE [Brucella suis bv. 3 str. 686]
          Length = 396

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 242/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
                  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVHYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S + + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|254695093|ref|ZP_05156921.1| flagellar hook protein FlgE [Brucella abortus bv. 3 str. Tulya]
 gi|261215444|ref|ZP_05929725.1| flagellar hook protein flgE [Brucella abortus bv. 3 str. Tulya]
 gi|260917051|gb|EEX83912.1| flagellar hook protein flgE [Brucella abortus bv. 3 str. Tulya]
          Length = 396

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 172/421 (40%), Positives = 242/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L+++K
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNMK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|218681813|ref|ZP_03529560.1| flagellar hook protein FlgE [Rhizobium etli CIAT 894]
          Length = 400

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 177/405 (43%), Positives = 230/405 (56%), Gaps = 24/405 (5%)

Query: 36  YKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG 95
           YK  + +FSSLV PS+  +Y SGG++ S +  +S+QG + +T S TDLAI G GFFIV+G
Sbjct: 1   YKAVSTSFSSLVLPSSGGNYNSGGVQTSVRQAVSDQGDISYTTSATDLAISGDGFFIVQG 60

Query: 96  RDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS 155
            D    LTRAGDF  ++EG L N AG  L+GY     S  ++VN F GL  INV    L+
Sbjct: 61  PDGTPVLTRAGDFQKDDEGNLVNAAGFGLMGYSYDAGSPAVVVNGFDGLVPINVNQEGLT 120

Query: 156 AMPTTTGFISNNLDKNATI--ITPDKTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYY 212
           A+ +T+G    NLD  A I  + P   P  N       T K S  AYDTLG+ V+YD Y+
Sbjct: 121 AIASTSGVFKGNLDSGANIAPVAPATLPSANLATTTTDTKKFSMVAYDTLGNKVMYDFYF 180

Query: 213 TKTG------------DKKWEVSIFRQDQSTNN---SFPYNVA-PLNTVEVSFDPVTGYL 256
           TKT             +  W+V+IFR   +      SFPY+    + T  + FD   G +
Sbjct: 181 TKTSVAATPPPAPPAVNSSWQVAIFRNANAATGGTTSFPYSAGGAVGTTTLDFD-ANGKI 239

Query: 257 ANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
            NS+   ++  D  +G  Q I +D+S  TQL   F    +  NG A    KD ++  DG 
Sbjct: 240 TNSTGT-VNIADTVTG--QTIKMDLSGFTQLGAAFAGTGTP-NGQAASPVKDVTIDGDGI 295

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           V   Y+DGT  P+YR+ +A V S D L L  GN Y     SG    GFP  N  G I SG
Sbjct: 296 VYAKYEDGTNKPLYRIPLANVASPDKLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSG 355

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ALE +NVD+A ELTE+IEAQR+Y  NSKVFQTGSD MD+L++LKR
Sbjct: 356 ALEGSNVDLAGELTEMIEAQRSYTANSKVFQTGSDIMDVLVNLKR 400


>gi|237817502|ref|ZP_04596493.1| flagellar hook protein FlgE [Brucella abortus str. 2308 A]
 gi|237787337|gb|EEP61554.1| flagellar hook protein FlgE [Brucella abortus str. 2308 A]
          Length = 456

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 242/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 61  MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 120

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 121 LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 180

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 181 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 231

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 232 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 279

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 280 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 335

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 336 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 395

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 396 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 455

Query: 421 R 421
           R
Sbjct: 456 R 456


>gi|115523193|ref|YP_780104.1| flagellar hook protein FlgE [Rhodopseudomonas palustris BisA53]
 gi|115517140|gb|ABJ05124.1| flagellar basal body FlaE domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 411

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 180/424 (42%), Positives = 244/424 (57%), Gaps = 16/424 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T  SGM+AQSN++S V+DNIANV+T GYKR +  FSSL+  S S SY SG +
Sbjct: 1   MSLYGVMRTGGSGMNAQSNKLSTVADNIANVNTTGYKRASTEFSSLILKSGSGSYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E   +  IS+ G+  +T S TDLAIQG GFF V        LTRAG F  + EG L N  
Sbjct: 61  ETQVRYAISDPGTTQYTTSATDLAIQGNGFFAVADARGTPFLTRAGSFVPDGEGNLVNAG 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLGY LKN    ++ N   GLE++N+    L   P+T G  S NLD NA I      
Sbjct: 121 GYYLLGYNLKNGPPNVVANGLTGLEKVNIGQTALEGNPSTKGTASANLDSNAAITA---- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
               G  A YT K+S   YD +G+ V  D+Y  KT    W + ++    ST   FPY+  
Sbjct: 177 ----GPPA-YTSKTSLVTYDNIGNKVTLDIYAYKTAANTWNMEVYDNATSTAGGFPYSSP 231

Query: 241 PLNTVEVSFDPVT---GYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
            L T   +FD      G L  +S  +++    T       T+D+S  TQ+A  F   K+ 
Sbjct: 232 ALATDTFTFDVSATGKGRLDAASPTSLAL---TIPGGSAFTLDLSTMTQVAAEF-QFKAT 287

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
           ++G++P   +   V  DG +  IY+DGTR+  YR+ +ATVPS D L    GN Y    DS
Sbjct: 288 VDGNSPSAIEKVEVDGDGTMYAIYNDGTRLATYRIPLATVPSPDKLVPEVGNVYSVGIDS 347

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G++ + F G++  G + + ALE +NVD+ASELT +IE+QR Y  NSKVFQTG+D +D+L+
Sbjct: 348 GNVQVDFAGNSGLGTVKAKALEQSNVDLASELTAMIESQRGYTANSKVFQTGADLLDVLV 407

Query: 418 SLKR 421
           +LKR
Sbjct: 408 NLKR 411


>gi|254698190|ref|ZP_05160018.1| flagellar hook protein FlgE [Brucella abortus bv. 2 str. 86/8/59]
 gi|260762637|ref|ZP_05874969.1| flagellar hook protein flgE [Brucella abortus bv. 2 str. 86/8/59]
 gi|260673058|gb|EEX59879.1| flagellar hook protein flgE [Brucella abortus bv. 2 str. 86/8/59]
          Length = 396

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 172/421 (40%), Positives = 241/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDL I G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLTIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|15964432|ref|NP_384785.1| flagellar hook protein FlgE [Sinorhizobium meliloti 1021]
 gi|307311574|ref|ZP_07591215.1| fagellar hook-basal body protein [Sinorhizobium meliloti BL225C]
 gi|20141447|sp|Q9X5Y0|FLGE_RHIME RecName: Full=Flagellar hook protein flgE
 gi|15073609|emb|CAC45251.1| Flagellar hook protein [Sinorhizobium meliloti 1021]
 gi|306899591|gb|EFN30220.1| fagellar hook-basal body protein [Sinorhizobium meliloti BL225C]
          Length = 406

 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 176/425 (41%), Positives = 246/425 (57%), Gaps = 23/425 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + SY SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +   +  IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N +
Sbjct: 61  QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAS 120

Query: 121 GGVLLGYPLKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P ++VN F GL R+N+    L A  +T G +  NL        P  
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASDGLIAAGSTKGSMGANL--------PSG 172

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF---P 236
            P  +         +S   YD+ G++ + D  Y KTG   W + I   D+++ ++    P
Sbjct: 173 APVGD------VSTTSLVVYDSQGNTRILDFNYEKTGANAWTLEIV--DRASGDALTVPP 224

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
             +A     E++  P T  +AN +   I     T  +   ITID SKTTQL   F     
Sbjct: 225 VTLAFNAAGELTTSPAT-VVANGAL--IVPPPATGAVVGSITIDFSKTTQLGYAFNADGG 281

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
            I+G+AP K   + +  DG V + Y++G   P YR+A+A V S D L+   GN Y    D
Sbjct: 282 SIDGNAPSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLRPESGNVYSQGVD 341

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L
Sbjct: 342 SGVIITGFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVL 401

Query: 417 ISLKR 421
           ++LKR
Sbjct: 402 VNLKR 406


>gi|163845457|ref|YP_001623112.1| flagellar hook protein FlgE [Brucella suis ATCC 23445]
 gi|163676180|gb|ABY40290.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 396

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 171/421 (40%), Positives = 241/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN   VGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASMVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI   G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDDNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 172 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 220 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S + + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|150395503|ref|YP_001325970.1| flagellar hook protein FlgE [Sinorhizobium medicae WSM419]
 gi|150027018|gb|ABR59135.1| flagellar basal body FlaE domain protein [Sinorhizobium medicae
           WSM419]
          Length = 402

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 174/425 (40%), Positives = 242/425 (56%), Gaps = 27/425 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + +Y SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +   +  IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N A
Sbjct: 61  QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P ++VN F GL R+N+    L A  +TTG +  NL   A +     
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASKGLIAAGSTTGSMGANLPSGAAVGDIST 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T              S   YD+ G++ + D  Y KT    W V +  +  ST        
Sbjct: 181 T--------------SLVVYDSQGNTRILDFNYEKTAANAWSVEVVDRTSST-------- 218

Query: 240 APLNTVEVSFDP---VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
             L T  ++F+    +T   A  +  A++    T      +TID++KTTQL   F     
Sbjct: 219 -VLGTQTLNFNADGSLTATPATLTTSAMASLPGTGANLSALTIDLTKTTQLGYAFNADGG 277

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
            I+G+AP K   + +  DG V + Y++G   P YR+A+A V S D LK   GN Y    D
Sbjct: 278 SIDGNAPSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLKPESGNVYSQGVD 337

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L
Sbjct: 338 SGVIITGFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVL 397

Query: 417 ISLKR 421
           ++LKR
Sbjct: 398 VNLKR 402


>gi|307318929|ref|ZP_07598360.1| fagellar hook-basal body protein [Sinorhizobium meliloti AK83]
 gi|306895343|gb|EFN26098.1| fagellar hook-basal body protein [Sinorhizobium meliloti AK83]
          Length = 402

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 174/425 (40%), Positives = 242/425 (56%), Gaps = 27/425 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + SY SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +   +  IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N A
Sbjct: 61  QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P ++VN F GL R+N+    L A  +T G +  NL   A +     
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASDGLIATGSTKGSMGANLPSGAAVGDVST 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T              S   YD+ G++ + D  Y KTG   W V +  +  ST        
Sbjct: 181 T--------------SLVVYDSQGNTRILDFNYEKTGANAWSVEVVDRTSST-------- 218

Query: 240 APLNTVEVSFDP---VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
             L T  ++F+    +T   A  +  A++    T      +TID++KTTQL   F     
Sbjct: 219 -VLGTQTLNFNADGSLTATPATLTTSAMTALPGTGANLSALTIDLTKTTQLGYAFNADGG 277

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
            I+G+AP K   + +  DG V + Y++G   P YR+A+A V S D L+   GN Y    D
Sbjct: 278 NIDGNAPSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLRPESGNVYSQGVD 337

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L
Sbjct: 338 SGVIITGFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVL 397

Query: 417 ISLKR 421
           ++LKR
Sbjct: 398 VNLKR 402


>gi|90422624|ref|YP_530994.1| flagellar hook protein FlgE [Rhodopseudomonas palustris BisB18]
 gi|90104638|gb|ABD86675.1| flagellar basal body FlaE [Rhodopseudomonas palustris BisB18]
          Length = 411

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 177/424 (41%), Positives = 240/424 (56%), Gaps = 16/424 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T  SGM AQSN++SAV+DNIANV+T GYKR +  FSSL+  S S SY SG +
Sbjct: 1   MSLYGVMRTGGSGMTAQSNKLSAVADNIANVNTTGYKRASTEFSSLILKSGSGSYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E   +  IS+ G+L +T S TDLAIQG GFF V        LTRAG F  + +G L N A
Sbjct: 61  ETQVRYAISDPGTLQYTTSATDLAIQGNGFFAVSNAGGTPFLTRAGSFVPDGQGNLYNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY LKN    ++ N   GLE +N+    L   P+T         K A     +  
Sbjct: 121 GYYLMGYNLKNGPPNVVANGLTGLEVVNIGQTALEGNPST---------KAAATANLNAN 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    YT K+S   YD +G+ V  D+Y  KT    W + ++    ST   FPY  A
Sbjct: 172 AGITAGAPNYTSKTSLVTYDNIGNKVTLDIYAYKTAANAWTMEVYDSADSTGGGFPYTGA 231

Query: 241 PLNTVEVSFDPVT---GYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
           PL T   SFD      G LA  S  ++S    T       T+D+S  TQ+A  F   K+ 
Sbjct: 232 PLATGNFSFDVSATGKGRLAGGSPTSLSL---TIPNGSPFTLDLSSMTQVAADF-QFKAT 287

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
           ++G++P       V+ DG +  IY+DGTR+  Y++ +ATVPS DNL    GN Y    +S
Sbjct: 288 VDGNSPSSIDKVEVATDGTMYAIYNDGTRIATYKIPLATVPSPDNLVPEVGNVYSIGINS 347

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G++ + F GH+  G + + ALE +NVD+A+ELT +IE+QR Y  NSKVFQTG+D +D+L+
Sbjct: 348 GNVQVDFAGHSGLGIVKAEALEASNVDLANELTAMIESQRGYTANSKVFQTGADLLDVLV 407

Query: 418 SLKR 421
           +LKR
Sbjct: 408 NLKR 411


>gi|306841276|ref|ZP_07473987.1| flagellar hook protein FlgE [Brucella sp. BO2]
 gi|306288678|gb|EFM60009.1| flagellar hook protein FlgE [Brucella sp. BO2]
          Length = 383

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 167/408 (40%), Positives = 234/408 (57%), Gaps = 25/408 (6%)

Query: 14  MDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGS 73
           M+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +    +  IS+QG 
Sbjct: 1   MNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSVLTDVRYGISDQGG 60

Query: 74  LMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNAS 133
           +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N AG  LLG     A+
Sbjct: 61  IRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSAGYYLLGAGADEAA 120

Query: 134 APLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHK 193
             L V    GL  +NV  A L A  +T G  + NL       + D+ P   G    Y HK
Sbjct: 121 GGLTV---AGLNVVNVNAAALPAEGSTAGNFTVNLP------STDQAPAAGG----YNHK 167

Query: 194 SSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVT 253
           +S  +Y+  G  +  DVY+TKTG  +W VS+                 + T  ++FDP T
Sbjct: 168 TSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE---------IGTTVLNFDPTT 218

Query: 254 GYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSK 313
           G + +  + A++         Q + +++  +TQ AG +   ++ ING AP   K   V  
Sbjct: 219 GDIVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAAINGQAPSSIKGVDVGN 275

Query: 314 DGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEI 373
           DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+ +GFP  +  G+I
Sbjct: 276 DGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNVFLPSAESGDVRLGFPQGDGMGKI 335

Query: 374 FSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LKR
Sbjct: 336 MSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLKR 383


>gi|4928060|gb|AAD33398.1|AF129422_1 flagellar hook protein FlgE [Sinorhizobium meliloti]
          Length = 396

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 172/419 (41%), Positives = 238/419 (56%), Gaps = 27/419 (6%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKD 66
           M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + SY SGG++   + 
Sbjct: 1   MRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGVQTEVRY 60

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLG 126
            IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N +G  L+G
Sbjct: 61  SISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNASGFTLMG 120

Query: 127 YPLKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           Y  +    P ++VN F GL R+N+    L A  +T G +  NL   A +     T     
Sbjct: 121 YEYEAGVDPTVVVNGFDGLTRVNLASDGLIATGSTKGSMGANLPSGAAVGDVSTT----- 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
                    S   YD+ G++ + D  Y KTG   W V +  +  ST          L T 
Sbjct: 176 ---------SLVVYDSQGNTRILDFNYEKTGANAWSVEVVDRTSST---------VLGTQ 217

Query: 246 EVSFDP---VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
            ++F+    +T   A  +  A++    T      +TID++KTTQL   F      I+G+A
Sbjct: 218 TLNFNADGSLTATPATLTTSAMTALPGTGANLSALTIDLTKTTQLGYAFNADGGNIDGNA 277

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
           P K   + +  DG V + Y++G   P YR+A+A V S D LK   GN Y    DSG I  
Sbjct: 278 PSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLKPESGNVYSQGVDSGVIIT 337

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L++LKR
Sbjct: 338 GFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVLVNLKR 396


>gi|323137001|ref|ZP_08072081.1| fagellar hook-basal body protein [Methylocystis sp. ATCC 49242]
 gi|322397762|gb|EFY00284.1| fagellar hook-basal body protein [Methylocystis sp. ATCC 49242]
          Length = 417

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 157/419 (37%), Positives = 238/419 (56%), Gaps = 8/419 (1%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS 63
            G   T++ GM AQS+ ++ +S+NIAN  TVGYKR    F +++     ++   GG+   
Sbjct: 5   FGLFNTSIMGMSAQSDALANISENIANSGTVGYKRATTHFLTVLSGFQGSNQFGGGVSTR 64

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
           ++  I+ QG+LMHT S+TD+AI+G GFF+V        LTRAG F  ++ G L N AG  
Sbjct: 65  SRYDITGQGALMHTGSSTDMAIRGNGFFVVSDGAGGTFLTRAGSFVPDSSGRLVNAAGYY 124

Query: 124 LLGYPLKNASAPLI--VNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
           L+G+P   A AP     N+   +  + +++  L A PTT+G +S NL  +AT++     P
Sbjct: 125 LMGFPAGPA-APTTSATNALSSMSIVQIRNDRLYANPTTSGVLSANLPVSATVVPAANLP 183

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
             N   A+++ K+S   YD LG  VV DVYY KT D  WE++++    +T+  FPY   P
Sbjct: 184 STNTAGAQFSAKTSLTVYDNLGKPVVLDVYYAKTADNTWEMTMYDASGATSGGFPYASGP 243

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           + T  ++F+P  G +A+      + N    G    +T+D+S TTQL   F+   + +NG+
Sbjct: 244 IATQTLTFNPANGSIASGG----TLNFTVPG-GASVTLDMSNTTQLGAPFVVNNATVNGN 298

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G  +   +S DG +    D+G  VP Y + IA V +   L  + GN Y  T  SG IS
Sbjct: 299 AAGAIRQVQISSDGTLSYQLDNGQMVPAYLIGIANVAAPTELASYTGNVYTATGASGPIS 358

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G+I S  LE +NVD+A+EL+ +I AQR+Y  N++ FQ  S+ + +L +LK
Sbjct: 359 VGAPGKGGFGDIASATLEASNVDLATELSTMIIAQRSYTANTQSFQVASEILQVLNNLK 417


>gi|148558720|ref|YP_001258004.1| flagellar hook protein FlgE [Brucella ovis ATCC 25840]
 gi|148370005|gb|ABQ62877.1| flagellar hook protein FlgE [Brucella ovis ATCC 25840]
          Length = 377

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 168/421 (39%), Positives = 233/421 (55%), Gaps = 44/421 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
                               TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  L-------------------TDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 101

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL       + D+ 
Sbjct: 102 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLP------STDQA 152

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P   G    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+                
Sbjct: 153 PAAGG----YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKNAADGVE-------- 200

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++         Q + +++  +TQ AG +   ++ ING
Sbjct: 201 -IGTTVLNFDPTTGDLVSGGNVAVNLGAYGG---QTLNLNLGGSTQRAGDYTISQAVING 256

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 257 QAPSSIKGMDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 316

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 317 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 376

Query: 421 R 421
           R
Sbjct: 377 R 377


>gi|218663526|ref|ZP_03519456.1| flagellar hook protein FlgE [Rhizobium etli IE4771]
          Length = 384

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 230/394 (58%), Gaps = 29/394 (7%)

Query: 47  VFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAG 106
           + PS+S +Y SGG++ S +  IS+QG + +T S  DLAI G GFFIV+G D    LTRAG
Sbjct: 1   MLPSSSGNYNSGGVQTSVRQAISQQGDISYTTSAYDLAISGDGFFIVEGADGTPVLTRAG 60

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
           DF ++++G L N AG  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S 
Sbjct: 61  DFSVDSDGNLVNSAGYTLMGYSYDSGVPAVVVNGFDGLVPVNVAQSGLSAIASTSAYFSG 120

Query: 167 NLDKNATIITPDKT-PKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTG-------- 216
           NL+  AT++T   T P  N     + T K S  AYD+LG++V YD Y+TKTG        
Sbjct: 121 NLNSEATVVTDTTTLPSANTSAVTDDTQKMSLVAYDSLGATVQYDYYFTKTGVTTDASGA 180

Query: 217 --DKKWEVSIFRQ-DQST--NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS 271
                WEV+++R  D +T    SFPY+ + ++   +SFD   G L +++   I       
Sbjct: 181 VTGSTWEVAVYRNADAATGGTTSFPYSSSAVSVATLSFD-ANGQLTSATDTDI------- 232

Query: 272 GID----QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
            +D    + IT+D S  TQLA  F    S  +G A       S+  DG V + Y +GT  
Sbjct: 233 -VDPVTAKTITMDYSDFTQLASDFSATGSA-DGQAASSVSSVSIDTDGVVSVSYANGTTK 290

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
            +Y++ +A V S DNL L  GN Y     SG    GFP  N  G I SGALE++NVD+A 
Sbjct: 291 ALYQIPLANVASPDNLTLLSGNVYTANGQSGVTVTGFPQTNGLGSIQSGALESSNVDLAG 350

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ELTE+IEAQR+Y  NSKVFQTGSD MD+L++LKR
Sbjct: 351 ELTEMIEAQRSYTANSKVFQTGSDIMDVLVNLKR 384


>gi|170744543|ref|YP_001773198.1| flagellar hook protein FlgE [Methylobacterium sp. 4-46]
 gi|168198817|gb|ACA20764.1| protein of unknown function DUF1078 domain protein
           [Methylobacterium sp. 4-46]
          Length = 407

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 162/427 (37%), Positives = 244/427 (57%), Gaps = 26/427 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-YVSGG 59
           M +LG+++T MSGM+AQSNR+S V++N+ N  T GYKR +  FSSL+  S++   Y SG 
Sbjct: 1   MSLLGALRTGMSGMNAQSNRISTVAENVQNAGTTGYKRVSTEFSSLLLSSSATGDYNSGS 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E   +  +S++G+ + T+S +DLAI G GFF+VK     + LTRAG+F  +   G  +N
Sbjct: 61  VETVQRRAVSDEGARVSTSSKSDLAIAGNGFFVVKDASGASYLTRAGNFVPDGSTGTFKN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
            AG  L+GY LKN  A   +NS  G+  +N+    + A  +T G ++ NLD  A  +T  
Sbjct: 121 AAGFTLMGYSLKNGQASPTLNSLDGMVPVNISALGMKASASTKGALTGNLDSTAAAVTSG 180

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P      + Y+ K+S   YD LG +V  D+Y TKTGD  W  S++  D S + SFP  
Sbjct: 181 AVPAG----SNYSKKTSLVTYDNLGKAVTLDIYLTKTGDNAWSASVY--DASNSASFP-- 232

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
            +PL T+ + F  V G + +    +++  +      Q +++D++  TQLA       ++I
Sbjct: 233 ASPLTTIPLGF--VNGKVTSGGTGSVTVPNG-----QPVSLDLTGMTQLA-----SATDI 280

Query: 299 NGHAPGKPKDF----SVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
            G A G           + DG V  +Y+D ++V  +++ IA V S DNLK   GN Y  T
Sbjct: 281 KGSADGSKASAVTGAEFAADGTVYAVYEDNSKVAAFKIPIADVDSPDNLKPRAGNVYETT 340

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SG + +GF      G I SGALE +NVD+++ELT +I +Q  Y  NSKVF T ++ +D
Sbjct: 341 LESGALQVGFANQGGRGGIVSGALEQSNVDVSTELTSMIASQTVYTANSKVFMTSNEMLD 400

Query: 415 ILISLKR 421
            L+ LKR
Sbjct: 401 TLMQLKR 407


>gi|158422271|ref|YP_001523563.1| flagellar hook protein FlgE [Azorhizobium caulinodans ORS 571]
 gi|158329160|dbj|BAF86645.1| flagellar basal body FlaE protein [Azorhizobium caulinodans ORS
           571]
          Length = 430

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 171/436 (39%), Positives = 250/436 (57%), Gaps = 21/436 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+++T++SGM+AQSN++  +SDNIAN +T GYK+    FSSL+  S+++ Y SG +
Sbjct: 1   MSLYGTLRTSVSGMNAQSNKLGTISDNIANSNTTGYKKATTDFSSLIVDSSTSEYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHIN-NEGFLENV 119
                  IS+QG+   + S TD+ + G GFF+V+       LTRAG F ++   G L N 
Sbjct: 61  NTKISYDISKQGTTTSSTSATDMMVNGDGFFVVQDGGGSTYLTRAGSFTVDATTGNLVNT 120

Query: 120 AGGVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
           AG  L+GY + K  +   +VNS  G+  +N+    L+A+PTT+G ++ NL   + +++  
Sbjct: 121 AGYTLMGYDISKGNNVTPVVNSTAGMVPVNIGSIALAAVPTTSGTMTANLQSTSAVVS-G 179

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----------WEVSIFRQD 228
            TP  N   A YT+KSS + YD LG+ VV DVY+TKT              WE++I+ Q 
Sbjct: 180 ATPGGNTAAATYTYKSSVSVYDNLGNQVVLDVYFTKTAAANPAATPPTTGGWEMAIYNQA 239

Query: 229 QSTNNS---FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
            +T      FPY+ + L T  ++FD  TG L   +   +S    T    Q +  DIS  T
Sbjct: 240 DATTGGTTPFPYSSSALATQTLTFDS-TGQLLTPATGKVSL---TVPNGQTMNFDISTMT 295

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           QL+  +   K+  NG       D  V+  G V  +  +G    +YR+ +ATV S DNL  
Sbjct: 296 QLSNDY-SIKAPTNGSPATSASDIKVNSQGIVYAVDGNGNTTNLYRIPVATVKSPDNLTP 354

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
             GN Y  T++SG + IG  G    G I S  LE +NVD+ASELT++I AQR+Y  NSKV
Sbjct: 355 VSGNAYQVTQESGAMQIGLSGSAGVGTIKSNTLENSNVDVASELTDMIVAQRDYTANSKV 414

Query: 406 FQTGSDFMDILISLKR 421
           FQTG+D +D+L++LKR
Sbjct: 415 FQTGTDLLDVLMNLKR 430


>gi|217976240|ref|YP_002360387.1| flagellar hook protein FlgE [Methylocella silvestris BL2]
 gi|217501616|gb|ACK49025.1| flagellar basal body FlaE domain protein [Methylocella silvestris
           BL2]
          Length = 414

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 166/417 (39%), Positives = 237/417 (56%), Gaps = 9/417 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M +  ++  ++SGM AQ+N++S VSDNIAN DT GYK+    F +L+  + ++SY + G+
Sbjct: 1   MSLFSALTASVSGMAAQANKLSTVSDNIANSDTTGYKQAMTEFENLISQAGTSSYNASGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  ISE G+L  T S+TDLAIQG GFF+V   +    LTRAG+F  +  G L N A
Sbjct: 61  ATVVRYNISEHGNLKSTTSSTDLAIQGNGFFLVGDANGSVFLTRAGNFKPDATGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL      +S         GLE +N+    L A+P+TTG ++ NL+ NA I+T    
Sbjct: 121 GFTLL--GYSASSGNSSSAGLSGLEPVNIFGDGLKAVPSTTGKLTANLNSNADIVT-GSL 177

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ-DQSTNNSFPYNV 239
           P  N   + YT K+S   YD LG++V  DVYY+KTG   WE SI+   D +    FPY+ 
Sbjct: 178 PSANVAGSVYTSKTSLVTYDNLGNAVKLDVYYSKTGTNTWEASIYNAADAAPGGGFPYSG 237

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
           A L T  ++F    G L   S  ++S           + ID+S TTQLA  F    +  N
Sbjct: 238 AALATQTLNFSASDGSLTGQSSISLSVPGG-----ANVAIDLSGTTQLASAFEVSAATTN 292

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP   +  S+S DG +  ++ +GT+  I+ + +ATV S DN+    G+ +     SG 
Sbjct: 293 GNAPSAVQSVSISPDGTLSEVFVNGTQKAIFTIPLATVASVDNMTSLAGDVFSDNSLSGP 352

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           I +G PG    G I S  LE++ VD+AS+LT++I AQR+Y  NSKVFQTGS+ +  L
Sbjct: 353 ILVGDPGLGGFGSIQSEKLESSTVDLASQLTDMIVAQRSYESNSKVFQTGSELLSTL 409


>gi|218660672|ref|ZP_03516602.1| flagellar hook protein FlgE [Rhizobium etli IE4771]
          Length = 374

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 214/380 (56%), Gaps = 23/380 (6%)

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLEN 118
           G++ S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N
Sbjct: 1   GVQTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGADGTPVLTRAGDFQKDDEGNLVN 60

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--IT 176
            AG  L+GY   + +  ++VN F GL  +NV    L+A+ +T+G    NLD NA +  + 
Sbjct: 61  AAGFQLMGYSYDSGAPAVVVNGFDGLVPVNVNQDGLTAIASTSGVFKGNLDSNAKVAPVA 120

Query: 177 PDKTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-----------DKKWEVSI 224
           P   P  N       T K S  AYD LG+ V+YD Y+TKT               W+V++
Sbjct: 121 PATLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKTSVVTPPPATPATAATWQVAM 180

Query: 225 FRQDQST---NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
           FR   +      SFPY  A + T  ++FD   G L  ++  A++  D  +G  Q I +D 
Sbjct: 181 FRNADAAVGGTTSFPYTTAAVGTGTLNFD-ANGKL--TTGGAVNIVDPVTG--QTIAMDF 235

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S  TQL   F    +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D
Sbjct: 236 SGFTQLGADFSGTGTP-NGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPD 294

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L L  GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  
Sbjct: 295 KLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTA 354

Query: 402 NSKVFQTGSDFMDILISLKR 421
           NSKVFQTGSD MD+L++LKR
Sbjct: 355 NSKVFQTGSDIMDVLVNLKR 374


>gi|296445196|ref|ZP_06887156.1| fagellar hook-basal body protein [Methylosinus trichosporium OB3b]
 gi|296257370|gb|EFH04437.1| fagellar hook-basal body protein [Methylosinus trichosporium OB3b]
          Length = 413

 Score =  265 bits (678), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 155/414 (37%), Positives = 231/414 (55%), Gaps = 11/414 (2%)

Query: 9   TAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMI 68
           T++ GM AQ++ + AVS NIAN  TVGYK     FS+++    + S  +GG+   T   +
Sbjct: 9   TSVMGMAAQASALGAVSQNIANSGTVGYKDATTQFSTVLSSVQNGSDPAGGVTAQTGVAV 68

Query: 69  SEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYP 128
           + QG+   T+S TDLAIQG GFF+V        LTRAG F  ++EG L N AG  L+GY 
Sbjct: 69  TAQGNTQQTSSTTDLAIQGSGFFVVSDSSGNTLLTRAGSFEPDSEGRLVNKAGYYLMGYS 128

Query: 129 LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDA 188
             +A++P   +   GL+ ++V    L A P+T G ++ NL + A ++     P  N   A
Sbjct: 129 ADDANSP---SDIAGLQTVHVAIGSLIATPSTEGSLTANLQQGADVVDSSALPSTNDASA 185

Query: 189 EYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ--STNNSFPYNVAPLNTVE 246
            YT K+S  AYD  G+SV  DVY++KT D +WE++++   +  S++  FPY+  PL T  
Sbjct: 186 TYTSKTSVTAYDNYGNSVKLDVYFSKTADNEWEMAVYDSSKADSSSGGFPYSEGPLTTQS 245

Query: 247 VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKP 306
           +SFD   G L + S   I   +      Q +T+D+S  TQL   F      ING+A    
Sbjct: 246 LSFDS-NGALTSGSPTTIDVPNG-----QTLTLDLSGMTQLGSSFSVSDPTINGNAAQAV 299

Query: 307 KDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPG 366
              +V  DG ++ +   G  VP Y++ +A V S   L+   GN +     SG   +G PG
Sbjct: 300 ASVNVDSDGTLNYVLTGGQTVPAYKIPLANVSSPSGLQSVSGNAFATNASSGTAYVGLPG 359

Query: 367 HNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
               G+I S +LE++ VD+A++L+ +I AQR+Y  NS+VFQ  S+ M +L +LK
Sbjct: 360 TGSFGDIQSKSLESSTVDLATQLSNMIVAQRSYTANSQVFQVASEVMQVLNNLK 413


>gi|27381969|ref|NP_773498.1| flagellar hook protein FlgE [Bradyrhizobium japonicum USDA 110]
 gi|27355139|dbj|BAC52123.1| flagellar hook protein [Bradyrhizobium japonicum USDA 110]
          Length = 410

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 166/427 (38%), Positives = 230/427 (53%), Gaps = 23/427 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM AQSN++S VSDNIANV+T GYKR +  FSSL+  S S +Y SG +
Sbjct: 1   MSLYGVMRTGVSGMSAQSNKLSTVSDNIANVNTTGYKRASTEFSSLILKSGSGNYDSGAV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFHINNEGFLENV 119
           E + +  IS+ G    T S TDLA+QG GFF+V   +N    LTRAG F  + +G L N 
Sbjct: 61  ETTVRYAISDAGHTQFTTSTTDLAVQGNGFFVVSNANNTQQYLTRAGSFVPDAQGNLVNA 120

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTG-FISNNLDKNATIITPD 178
           AG  LLG P K  +     NS  G++ +N+       +P+T G   + NLD  A +I   
Sbjct: 121 AGYYLLGQPGKVTN--FSQNSLSGMQIVNIAQVSQVPVPSTAGTLTTGNLDPKAAVIAGP 178

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----GDKKWEVSIFRQDQSTNNS 234
             P      A Y+ KSS  AY+ +G +V  DVY + T    G   W++  +  + +T  S
Sbjct: 179 PGP------ASYSSKSSIVAYNNIGQAVTLDVYMSHTATAAGSDTWQIQAY--NSATGTS 230

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
                        +     G LA +S   +SF   T      +T+D+S  TQ    F   
Sbjct: 231 VGAATTFTFDTTATGK---GALAAASPTTLSF---TVPGGAAVTMDLSNMTQTGTDF-SF 283

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
           K+ +NG AP       V   G+V  I  +G ++ +Y + +A VPS DNL    GN Y   
Sbjct: 284 KATVNGSAPAAIDKVDVDDAGHVTAILKNGQQMTLYTIMLADVPSPDNLTPEPGNVYSTN 343

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SG+   G  G    G I SGALE +NVD+A ELT +IEAQR +  NSK FQTG+D +D
Sbjct: 344 MNSGNAQAGNAGTGGLGTIQSGALEDSNVDLADELTGMIEAQRGFTANSKSFQTGADLLD 403

Query: 415 ILISLKR 421
           ++++LKR
Sbjct: 404 VVVNLKR 410


>gi|254559268|ref|YP_003066363.1| flagellar hook protein FlgE [Methylobacterium extorquens DM4]
 gi|254266546|emb|CAX22310.1| flagellar hook protein FlgE [Methylobacterium extorquens DM4]
          Length = 403

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/423 (36%), Positives = 228/423 (53%), Gaps = 22/423 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M ++G ++T +SGM+AQSNR+S V++NI N  T GYKRT+  FSSL+  S    +Y SG 
Sbjct: 1   MSLIGVLRTGVSGMNAQSNRISTVAENIQNASTTGYKRTSAEFSSLLLDSGDVGNYNSGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E + +  +SE G +  T S+ DLAIQG GFF+V        +TRAG+F ++ + G L N
Sbjct: 61  VETTLRRSVSEGGPIASTNSDKDLAIQGNGFFVVSDAAGAPFMTRAGNFVVDGKTGNLVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  L+GY L N +   ++N    L+ +NV      A P+T   +S NL    +  TP 
Sbjct: 121 AGGFTLMGYSLANGTPNPVLNGVADLKPVNVSVMGQEARPSTAATVSGNL----SFETPV 176

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P   G    Y+ K+S   YD +G  V  DV  TKT    W V  F     T +     
Sbjct: 177 YDPTATGAIG-YSKKNSLKVYDNVGRPVTLDVQMTKTAANTWSVEFFDPAAPTTS----- 230

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L T  V+FD   G + N     +   +      ++IT+D+   TQL+G         
Sbjct: 231 ---LGTTNVTFDG-NGKVNNGGSALVDVPNG-----RRITVDLGGLTQLSGDH-NLSGTA 280

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG +P      +  +DG V  +Y DGTR   +++ +A V S DNL    GN +  + +SG
Sbjct: 281 NGSSPTSVSGTAFGEDGTVYAVYTDGTRKAAFKVPLADVASPDNLAPRAGNVFTTSAESG 340

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           DI +GF G    G + +GALE +NVD+++ELT +IE+Q  Y  NSKVF TG++ ++ L++
Sbjct: 341 DIQVGFAGQGGRGILKAGALEQSNVDVSTELTTMIESQTVYTANSKVFMTGNELLETLMN 400

Query: 419 LKR 421
           LKR
Sbjct: 401 LKR 403


>gi|240137257|ref|YP_002961726.1| flagellar hook protein FlgE [Methylobacterium extorquens AM1]
 gi|240007223|gb|ACS38449.1| flagellar hook protein FlgE [Methylobacterium extorquens AM1]
          Length = 403

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/423 (36%), Positives = 227/423 (53%), Gaps = 22/423 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M ++G ++T +SGM+AQSNR+S V++NI N  T GYKRT+  FSSL+  S    +Y SG 
Sbjct: 1   MSLIGVLRTGVSGMNAQSNRISTVAENIQNASTTGYKRTSAEFSSLLLDSGDVGNYNSGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E + +  +SE G +  T S+ DLAIQG GFF+V        +TRAG+F ++ + G L N
Sbjct: 61  VETTLRRSVSEGGPIASTNSDKDLAIQGNGFFVVSDAAGAPFMTRAGNFVVDGKTGNLVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  L+GY L N +   ++N    L+ +NV      A P+T   +S NL    +  TP 
Sbjct: 121 AGGFTLMGYSLANGTPNPVLNGVADLKPVNVSVMGQEARPSTAATVSGNL----SFETPV 176

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P   G    Y+ K+S   YD +G  V  DV  TKT    W V  F     T       
Sbjct: 177 YDPTATGAIG-YSKKNSLKVYDNVGRPVTLDVQMTKTAANTWSVEFFDPAAPTT------ 229

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
             P+ T  V+FD   G +       ++  +  S     IT+D+   TQL+G         
Sbjct: 230 --PVGTTSVTFDG-NGKVNGGGSALVAVPNGRS-----ITVDLGGLTQLSGDH-NLSGTA 280

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG +P      +  +DG V  +Y DGTR   +++ +A V S DNL    GN +  + +SG
Sbjct: 281 NGSSPTSVSGTAFGEDGTVYAVYTDGTRKAAFKVPLADVASPDNLAPRAGNVFTTSAESG 340

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           DI +GF G    G + +GALE +NVD+++ELT +IE+Q  Y  NSKVF TG++ ++ L++
Sbjct: 341 DIQVGFAGQGGRGILKAGALEQSNVDVSTELTTMIESQTVYTANSKVFMTGNELLETLMN 400

Query: 419 LKR 421
           LKR
Sbjct: 401 LKR 403


>gi|188579925|ref|YP_001923370.1| flagellar hook protein FlgE [Methylobacterium populi BJ001]
 gi|179343423|gb|ACB78835.1| flagellar basal body FlaE domain protein [Methylobacterium populi
           BJ001]
          Length = 402

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 152/423 (35%), Positives = 228/423 (53%), Gaps = 23/423 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M ++G ++T +SGM+AQSNR+S V++NI N  T GYKRT+  FSSL+  S    +Y SG 
Sbjct: 1   MSLIGVLRTGVSGMNAQSNRISTVAENIQNASTTGYKRTSAEFSSLLLDSGDVGNYNSGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E + +  +SE G +  T S+ DLAIQG GFF+V        +TRAG+F ++ + G L N
Sbjct: 61  VETTLRRSVSEGGPIASTNSDKDLAIQGNGFFVVSDAAGAPFMTRAGNFVVDGKTGNLVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  L+GY L N +   ++N    L+ +NV      A P+T+  IS NL     +  P 
Sbjct: 121 AGGFTLMGYSLANGTPNPVLNGVADLKPVNVSVMGQEARPSTSATISGNLSFETPVYDPA 180

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
            +         Y+ K+S   YD +G  V  DV  TKT    W V  F    +T       
Sbjct: 181 TS------TIGYSKKNSLKVYDNVGQPVTLDVQMTKTAANTWSVKFFNPADATT------ 228

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
             P+ T  V+FD   G + +     +   +      ++I +D+   TQL+G      +  
Sbjct: 229 --PVGTATVAFDG-NGKVTSGGSTLVQVPNG-----REIKVDLGGLTQLSGDHALSGTA- 279

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G +P      +  +DG V  +Y DGTR   +++ +A V S DNL    GN +  + +SG
Sbjct: 280 DGSSPTSVSGTAFGEDGTVYAVYSDGTRKAAFKVPLADVASPDNLSPRAGNVFTTSAESG 339

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           DI IGF G    G + +GALE +NVD+++ELT +IE+Q  Y  NSKVF TG++ ++ L++
Sbjct: 340 DIQIGFAGAGGRGILKAGALEQSNVDVSTELTTMIESQTVYTANSKVFMTGNELLETLMN 399

Query: 419 LKR 421
           LKR
Sbjct: 400 LKR 402


>gi|163850123|ref|YP_001638166.1| flagellar hook protein FlgE [Methylobacterium extorquens PA1]
 gi|163661728|gb|ABY29095.1| protein of unknown function DUF1078 domain protein
           [Methylobacterium extorquens PA1]
          Length = 403

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 155/423 (36%), Positives = 226/423 (53%), Gaps = 22/423 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M ++G ++T +SGM+AQSNR+S V++NI N  T GYKRT+  FSSL+  S    +Y SG 
Sbjct: 1   MSLIGVLRTGVSGMNAQSNRISTVAENIQNASTTGYKRTSAEFSSLLLDSGDVGNYNSGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E + +  +SE G +  T S+ DLAIQG GFF+V        +TRAG+F ++ + G L N
Sbjct: 61  VETTLRRSVSEGGPIASTNSDKDLAIQGNGFFVVSDAAGAPFMTRAGNFVVDGKTGNLVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  L+GY L N +   ++N    L+ +NV      A P+T   +S NL    +  TP 
Sbjct: 121 AGGFTLMGYSLANGTPNPVLNGVADLKPVNVSVMGQEARPSTAATVSGNL----SFETPV 176

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P   G    Y+ K+S   YD +G  V  DV  TKT    W V  F     T +     
Sbjct: 177 YDPTATGAIG-YSKKNSLKVYDNVGRPVTLDVQMTKTAANTWSVEFFDPAAPTTS----- 230

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L T  V+FD   G +       ++  +  S     I +D+   TQL+G         
Sbjct: 231 ---LGTTNVTFDG-NGKVNGGGSALVNVPNGRS-----IPVDLGGLTQLSGDH-NLSGTA 280

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG +P      +  +DG V  +Y DGTR   +++ +A V S DNL    GN +  + +SG
Sbjct: 281 NGSSPTSVSGTAFGEDGTVYAVYTDGTRKAAFKVPLADVASPDNLAPRAGNVFTTSAESG 340

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           DI +GF G    G + +GALE +NVD+++ELT +IE+Q  Y  NSKVF TG++ ++ L++
Sbjct: 341 DIQVGFAGQGGRGILKAGALEQSNVDVSTELTTMIESQTVYTANSKVFMTGNELLETLMN 400

Query: 419 LKR 421
           LKR
Sbjct: 401 LKR 403


>gi|218528727|ref|YP_002419543.1| flagellar hook protein FlgE [Methylobacterium chloromethanicum CM4]
 gi|218521030|gb|ACK81615.1| flagellar basal body FlaE domain protein [Methylobacterium
           chloromethanicum CM4]
          Length = 403

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 226/423 (53%), Gaps = 22/423 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M ++G ++T +SGM+AQSNR+S V++NI N  T GYKRT+  FSSL+  S    +Y SG 
Sbjct: 1   MSLIGVLRTGVSGMNAQSNRISTVAENIQNASTTGYKRTSAEFSSLLLDSGDVGNYNSGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E + +  +SE G +  T S+ DLAIQG GFF+V        +TRAG+F ++ + G L N
Sbjct: 61  VETTLRRSVSEGGPIASTNSDKDLAIQGNGFFVVSDAAGAPFMTRAGNFVVDGKTGNLVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  L+GY L N +   ++N    L+ +NV      A P+T   +S NL    +  TP 
Sbjct: 121 AGGFTLMGYSLANGTPNPVLNGVADLKPVNVSVMGQEARPSTAATVSGNL----SFETPV 176

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P   G    Y+ K+S   YD +G  V  DV  TKT    W V        + +     
Sbjct: 177 YDPTATGAIG-YSKKNSLKVYDNVGRPVTLDVQMTKTAANTWSVEFLDPAPPSTS----- 230

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L T  V+FD   G +  S+   +   +  S     I +D+   TQL+G         
Sbjct: 231 ---LGTTSVTFDG-NGKITGSASTLVKVPNGGS-----IPVDLRGLTQLSGNH-NLSGTA 280

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G +P      +  +DG V  +Y DGTR   +++ +A V S DNL    GN +  + +SG
Sbjct: 281 DGSSPTSVSGTAFGEDGTVYAVYTDGTRKAAFKVPLADVASPDNLAPRAGNVFTTSAESG 340

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           DI IGF G    G + +GALE +NVD+++ELT +IE+Q  Y  NSKVF TG++ ++ L++
Sbjct: 341 DIQIGFAGQGGRGILKAGALEQSNVDVSTELTTMIESQTVYTANSKVFMTGNELLETLMN 400

Query: 419 LKR 421
           LKR
Sbjct: 401 LKR 403


>gi|170748125|ref|YP_001754385.1| flagellar hook protein FlgE [Methylobacterium radiotolerans JCM
           2831]
 gi|170654647|gb|ACB23702.1| flagellar basal body FlaE domain protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 407

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 156/428 (36%), Positives = 229/428 (53%), Gaps = 28/428 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G +   +SGM+AQSNR+  V+DNI N +T GYKR +  FSSL+   +  SY +G +
Sbjct: 1   MGLYGVLHAGVSGMNAQSNRLGTVADNIQNQNTTGYKRASTEFSSLLIDPSPGSYDAGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLENV 119
           +   +  ISE+G+   T S TDL I+G GFF+VK     + LTRAG+F ++ + G L N 
Sbjct: 61  DTVVRHRISEEGTGTATNSPTDLTIKGNGFFVVKDGSGRSYLTRAGNFVVDGQTGDLVNA 120

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           AG  L GY L N    + +NSF G+  +NV    +   P+T G +  NL  +  I T   
Sbjct: 121 AGMRLQGYSLANGEPSVSLNSFDGMMNVNVAKLAMKTSPSTAGTLEGNLFSDTPIAT--- 177

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
                     Y+ KSS   YD LG     D+Y+ KT +  W+V+ +  D S   ++P   
Sbjct: 178 ------NPPGYSLKSSITTYDNLGHPFKADLYFAKTANNTWQVTAY--DASLPGNYPG-- 227

Query: 240 APL-NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
            PL     ++F+   G +A +     +  +      Q  T+D+S  +Q+A   + Q S+I
Sbjct: 228 TPLGGPTTLTFNAF-GQIAGAPKLNFTVPNG-----QPFTLDLSPLSQVAD--VAQVSDI 279

Query: 299 -----NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                NG+A    +   +  DG V  IY DG+R   +R+ +A+V S DNL    GN +  
Sbjct: 280 KARSVNGNAASAVEGADIDTDGTVYAIYRDGSRRAAFRIPVASVGSPDNLTPRAGNVFDV 339

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
             +SG   IGF      G I S  LE + VD+ +EL  +IEAQ  Y  NSKVFQTGS+ +
Sbjct: 340 NPESGPAQIGFANVGGRGHIQSKMLENSTVDLGNELATMIEAQTTYGANSKVFQTGSEML 399

Query: 414 DILISLKR 421
           ++L++LKR
Sbjct: 400 ELLVNLKR 407


>gi|114707045|ref|ZP_01439944.1| flagellar hook protein E [Fulvimarina pelagi HTCC2506]
 gi|114537595|gb|EAU40720.1| flagellar hook protein E [Fulvimarina pelagi HTCC2506]
          Length = 390

 Score =  219 bits (557), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 159/434 (36%), Positives = 225/434 (51%), Gaps = 57/434 (13%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-SYVSGG 59
           M I G  +T++SGM+AQSN++SAVSDNIAN  T GYKR  + FSSLV  S    +Y SG 
Sbjct: 1   MSINGVFRTSVSGMNAQSNKLSAVSDNIANSATTGYKRADVEFSSLVINSGGRGNYTSGS 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF-----HINNEG 114
           +   T+  IS QG +  T+S TDLAI G GFF+V+ ++     TRAG F         E 
Sbjct: 61  VLSQTRYDISTQGLVTTTSSKTDLAISGDGFFVVEDQNGQPFFTRAGSFVQRTEPDTGET 120

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSA-MPTTTGFISNNLDKNAT 173
           FL N AG     Y L   + P           + V   E+ A   TTT  +S  L  N T
Sbjct: 121 FLVNAAG-----YKLTGQNGP-----------VQVPVGEIVAPQATTTSELSMQLPLNGT 164

Query: 174 IITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN 233
                            TH  SF A+++ G +V   +  T+TG  +W+++          
Sbjct: 165 ----------------GTHTGSFTAFNSRGEAVNVSMTATRTGADQWDLTF--------- 199

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLAN------SSHKAISFNDNTSGIDQQITIDISKTTQL 287
             P   AP+ TV V+FD  TG L N       + + +   +   G    + +++ + T  
Sbjct: 200 DAPSASAPV-TVSVTFDAATG-LPNPPITTAGNLQIVPPANGGGGAPSTVALNLGQLTSY 257

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F  Q +E NG+      DF++S DG V  I   G ++ + R+ +A   S D L +  
Sbjct: 258 DAAFTFQ-AEANGNPATGFSDFTISDDGRVFGILTTGRQIELDRIQLARFQSPDQLDVIS 316

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN + P++ SGD   GF G    G++ SGALE +NVD+ASELT++I  QR+YA NSK FQ
Sbjct: 317 GNVFRPSQLSGDPQFGFSGELGFGDLISGALEESNVDLASELTDMIVTQRSYAANSKTFQ 376

Query: 408 TGSDFMDILISLKR 421
           TGS+ +D+L++LKR
Sbjct: 377 TGSEMLDLLVNLKR 390


>gi|218461961|ref|ZP_03502052.1| flagellar hook protein FlgE [Rhizobium etli Kim 5]
          Length = 316

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 179/310 (57%), Gaps = 24/310 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFQKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--ITPD 178
           G  L+GY   + +  ++VN F GL  +NV    L+A+ +T+G    NLD NA +  + P 
Sbjct: 121 GFQLMGYSYDSGAPAVVVNGFDGLVPVNVNQEGLTAIASTSGVFKGNLDSNAKVAPVAPA 180

Query: 179 KTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-----------KKWEVSIFR 226
             P  N       T K S  AYD LG+ V+YD Y+TKT               WEVSI+R
Sbjct: 181 TLPSANLATTTADTKKFSMVAYDRLGNKVMYDFYFTKTAVVTPPPAPPGVASTWEVSIYR 240

Query: 227 QDQST---NNSFPYN--VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
              +      SFPY+  V  +    ++FD   G +   S  AI   D  +G+   I +D+
Sbjct: 241 NADAAVGGTTSFPYSTAVGDVGNGSLTFD-ANGKMI--SFGAIPITDPVTGL--TINMDL 295

Query: 282 SKTTQLAGGF 291
           S  TQL   F
Sbjct: 296 SGFTQLGADF 305


>gi|90418365|ref|ZP_01226277.1| putative flagellar hook protein FlgE [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338037|gb|EAS51688.1| putative flagellar hook protein FlgE [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 388

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 150/430 (34%), Positives = 216/430 (50%), Gaps = 51/430 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G  +T++SGM+AQ+NR+S VS+NIAN  T GYKR +  F+SLV       Y  G +
Sbjct: 1   MSINGVFRTSVSGMNAQANRLSTVSENIANSSTNGYKRNSTEFASLVLAQGGGEYNPGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEG------ 114
           +   +  IS+QGS+  T+S +DLAIQG GFF+V+        TRAG F    E       
Sbjct: 61  KTQVRQSISQQGSIAATSSGSDLAIQGDGFFVVQDTAGREFYTRAGSFVQRTETIGGKET 120

Query: 115 -FLENVAGGVLLGYPLKN-ASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
            FL N AG  L G P+   A+AP+                    +P          D  A
Sbjct: 121 TFLVNTAGYRLTGSPVGGGAAAPI-------------------ELPVGAIVAPKATDAGA 161

Query: 173 -TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
            TI  P+     +      T KSS   YD++G ++   V   KT    W VS       T
Sbjct: 162 FTIQFPESAAVGD------TKKSSMVVYDSIGKAIEVPVDMEKTAANTWTVSY------T 209

Query: 232 NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF 291
           ++  P       T  + FDP TG    +       + N   +D    I+    T+ A  F
Sbjct: 210 DSGGP------QTTTIVFDPNTGRPTAAPANMTYTHVNGDTVD----IEFGSLTEYATDF 259

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
              K   NG+ PG    F+ +++G +  + + G  +P+Y +++A   S D L+   GN Y
Sbjct: 260 -SSKLVTNGNPPGSFTGFAFAENGTLSGVMNTGQLIPLYEMSLARFASPDQLQASAGNVY 318

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG  ++G PG N +G + S  LE +NVD+ASELT +IE+QR+Y+ NSKVFQTG++
Sbjct: 319 SATASSGVAALGGPGTNGYGSLVSSGLEQSNVDLASELTSMIESQRSYSANSKVFQTGAE 378

Query: 412 FMDILISLKR 421
            +D+L++LKR
Sbjct: 379 ILDVLVNLKR 388


>gi|254473478|ref|ZP_05086875.1| flagellar hook protein FlgE [Pseudovibrio sp. JE062]
 gi|211957594|gb|EEA92797.1| flagellar hook protein FlgE [Pseudovibrio sp. JE062]
          Length = 397

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 226/433 (52%), Gaps = 49/433 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G M T++SGM+AQSN++S V+DNI+N +TVGYKR   AFSSLV    ++ + SG +
Sbjct: 1   MGLYGIMNTSVSGMNAQSNKLSTVADNISNANTVGYKRYKTAFSSLVGSGGTSGHESGIV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             +    + +QG+   T+  TDLAI GKGFF V+        TRAGDF ++  G + N  
Sbjct: 61  NTTVVQTVRQQGAFNFTSRGTDLAINGKGFFQVQDSQGSTYYTRAGDFVLDKNGQMVNSG 120

Query: 121 GGVLL---GYPLK-NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           G  LL   G P+  + + P+   S +G   +N+     S+ P  TG              
Sbjct: 121 GYKLLSAGGAPVTVDLNTPVWQASSEGELGVNLA----SSTPVRTG-------------- 162

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG---------DKKWEVSIFRQ 227
               P + G    + +K+S +AYD  G+ V  D+ Y+K G         D  W+V  + Q
Sbjct: 163 ---APSYPGN---FDYKTSVSAYDQNGNVVKIDLVYSKIGQNMTGSTVDDSTWKVQAYNQ 216

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
           D       P  +A    V++ FD   G L   S   ++F   T    + +T+D+SKT   
Sbjct: 217 DTP-----PVELA---NVDLVFDG-DGTLQTGSPDELAF---TVPNGETLTLDLSKTVTA 264

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F   K +++G+ P   K   +  DG V  +Y+      + ++ I    + D L+   
Sbjct: 265 GDKFSVNKVDVDGYGPSTIKTIRIEADGRVFGVYEGSAEKLLDQIQIVNFSNPDGLQAKS 324

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN Y  T  SGD ++GFPG N  G ++SGA+E +NVD+A+ELTE+++AQR Y+ N+KVF 
Sbjct: 325 GNVYAATDASGDPAVGFPGDNGFGSLYSGAVEGSNVDLAAELTEMVQAQRTYSANTKVFN 384

Query: 408 TGSDFMDILISLK 420
             S+ +  L +L+
Sbjct: 385 ASSELLQELNNLR 397


>gi|319403978|emb|CBI77566.1| Flagellar hook protein FlgE [Bartonella rochalimae ATCC BAA-1498]
          Length = 402

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 141/430 (32%), Positives = 209/430 (48%), Gaps = 37/430 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M+T +SGM+AQ  R+S V+DN+AN  T+GYKRT + FS+ V PS   +YVSGG+
Sbjct: 1   MGIYGMMRTGVSGMNAQGTRLSGVADNVANAGTIGYKRTNVQFSNYVTPSGQYAYVSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T  + D  I G GFF V   +    LTRAG F  + +G+L N A
Sbjct: 61  KSHIGHDISIGGPARATGRSGDTMIHGNGFFRVADENGKEFLTRAGSFVRDKDGYLRNTA 120

Query: 121 GGVLL---GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP 177
           G  LL   G  ++    P  +   +   +I+ K                N + +A ++ P
Sbjct: 121 GYYLLNEDGEKIQIKGGPTDLFGPEATTKIDFKV---------------NFNPSAKVVEP 165

Query: 178 DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS-FP 236
                   +   Y+ K S   YD+ G  V  D Y  KT + KW V  +   +   ++ F 
Sbjct: 166 KDGKIDPEKPETYSQKKSMTTYDSQGKKVQVDFYMRKTAENKWVVDAYSDGKKVGSTEFN 225

Query: 237 YN-----VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF 291
           ++     +AP    +++       L +S       N N  G+        S  TQ  G  
Sbjct: 226 FDKEGNLIAPTKEFKLT-------LPDSEGNTFEVNVNFGGVGAD-----SLVTQ-KGNL 272

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
              + E +G   G    F+  K+G ++++Y +     I  + + TV S D+L    G  +
Sbjct: 273 FAFEGEADGMESGAFDGFTFGKNGEIEVMYSNQKTRTIGYIGVTTVASPDSLTFLGGTVF 332

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
                +G   +G PG    G + SG LE +NVD+  ELT++IEAQRNY  NSKVFQTGS+
Sbjct: 333 ETNSQTGPQMMGRPGDGVFGTLSSGYLEDSNVDMGDELTDMIEAQRNYTANSKVFQTGSE 392

Query: 412 FMDILISLKR 421
            MD++++LKR
Sbjct: 393 LMDVIVNLKR 402


>gi|319898656|ref|YP_004158749.1| flagellar hook protein FlgE [Bartonella clarridgeiae 73]
 gi|319402620|emb|CBI76165.1| Flagellar hook protein FlgE [Bartonella clarridgeiae 73]
          Length = 402

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 151/437 (34%), Positives = 215/437 (49%), Gaps = 51/437 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M+T +SGM+AQ  R+S V+DN+AN  TVGYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MGIYGMMRTGVSGMNAQGTRLSGVADNVANAGTVGYKRTNVQFSNYVTPSGQYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T  + D  I G GFF V   +    LTRAG F  + +G+L N A
Sbjct: 61  KSHIGHDISISGPAHATGRSGDAMIHGNGFFRVADENGKEFLTRAGSFTRDKDGYLRNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHA--ELSAMPTTTGF-ISNNLDKNATIITP 177
                GY L N             ERI +K    +L     TT      N + +A ++ P
Sbjct: 121 -----GYYLLNEDG----------ERIQIKGGPTDLFGPEVTTKIDFKANFNPSAKVMEP 165

Query: 178 D------KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ-- 229
           +      K PK       Y  K S   YD+ G  V  D Y  KT + KW V  +   +  
Sbjct: 166 EGGQIDPKDPK------SYNQKKSMTTYDSQGKKVQVDFYMRKTAENKWVVDAYSNGEKV 219

Query: 230 -STNNSFPYN---VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
            ST+ +F      + P    +++       L +S  K    + N  G+        S  T
Sbjct: 220 GSTDFNFDKEGNLIEPTKEFKLT-------LPDSEGKTFEVDVNFGGVGAD-----SLVT 267

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIY-DDGTRVPIYRLAIATVPSEDNLK 344
           Q  G     ++E +G   G    F+  K+G ++++Y +  TR+  Y + I TV S ++L 
Sbjct: 268 Q-KGNLFAFEAEADGMESGAFDGFTFGKNGEIEVMYSNQKTRIVGY-VGITTVASPESLT 325

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
              G+ +     +G   +G PG    G + SG LE +NVD+  ELT++IEAQRNY  NSK
Sbjct: 326 FLGGSVFETNSQTGAQMMGRPGDGVFGTLSSGYLEDSNVDMGDELTDMIEAQRNYTANSK 385

Query: 405 VFQTGSDFMDILISLKR 421
           VFQTGS+ MD++++LKR
Sbjct: 386 VFQTGSELMDVIVNLKR 402


>gi|319406994|emb|CBI80631.1| Flagellar hook protein FlgE [Bartonella sp. 1-1C]
          Length = 402

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 138/430 (32%), Positives = 207/430 (48%), Gaps = 37/430 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M+T +SGM+AQ  R+S V+DN+AN  T+GYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MGIYGMMRTGVSGMNAQGTRLSGVADNVANAGTIGYKRTDVQFSNYVTPSGKYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      +S  G    T  + D  I G GFF V   +    LTRAG F  + +G+L N A
Sbjct: 61  KSHIGHDVSIGGPARATGRSGDTMIHGNGFFRVADENGKEFLTRAGSFIRDKDGYLRNTA 120

Query: 121 GGVLL---GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP 177
           G  LL   G  ++    P  +   +   +I+ K                N + +A ++ P
Sbjct: 121 GYYLLNEDGEKIQIKGGPTDLFGPEATTKIDFKA---------------NFNPSAKVVEP 165

Query: 178 DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS-FP 236
                +      Y+ K S   YD+ G  V  D Y  KT + KW V  +   +   ++ F 
Sbjct: 166 KDGTINPENPETYSQKKSMTTYDSQGKKVQVDFYMRKTDENKWVVDAYSDGKKVGSTEFN 225

Query: 237 YN-----VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF 291
           ++     + P    +++       L +S       N N  G+        S  TQ  G  
Sbjct: 226 FDKEGNLIEPTKEFKLT-------LPDSEGNTFEVNVNFGGVGAD-----SLVTQ-KGNL 272

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
              + E +G   G    F+  K+G ++++Y +     I  + + TV S D+L    G  +
Sbjct: 273 FAFEGEADGMESGAFDGFTFGKNGEIEVMYSNQKTRTIGYIGVTTVASTDSLTFLGGTVF 332

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
                +G   +G PG    G + SG LE +NVD+  ELT++IEAQRNY  NSKVFQTGS+
Sbjct: 333 ETNSQTGPQMMGRPGDGVFGTLSSGYLEDSNVDMGDELTDMIEAQRNYTANSKVFQTGSE 392

Query: 412 FMDILISLKR 421
            MD++++LKR
Sbjct: 393 LMDVIVNLKR 402


>gi|319405421|emb|CBI79040.1| Flagellar hook protein FlgE [Bartonella sp. AR 15-3]
          Length = 402

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 141/431 (32%), Positives = 207/431 (48%), Gaps = 39/431 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G M+T +SGM+AQ  R+S V+DN+ANV TVGYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MSIYGMMRTGVSGMNAQGTRLSGVADNVANVGTVGYKRTNVQFSNYVTPSGQYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T  + D+ I G GFF V   +    LTRAG F  +  G+L N A
Sbjct: 61  KSHIGHDISISGPAHATGRSGDVMIHGSGFFRVADENGKEFLTRAGSFTRDKGGYLRNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHA--ELSAMPTTTGF-ISNNLDKNATIITP 177
                GY L N             ERI +K    +L     TT      N + +A ++  
Sbjct: 121 -----GYYLLNEDG----------ERIQIKGGPTDLFGPEATTKIDFKANFNPSAKVVES 165

Query: 178 DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
           +           Y+ K S   YD+ G  V  D Y  KT + KW V  +            
Sbjct: 166 EDGEIDPDDPKSYSQKKSMTTYDSQGKKVQVDFYMRKTAENKWVVDAYS----------- 214

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK-- 295
           N   + + E +FD     +  +    ++  D+     +   +D++     A   + QK  
Sbjct: 215 NGEKVGSTEFNFDKEGNLIEPTEEFKLTLPDSEG---ETFEVDVNFGGVGADSLVTQKGN 271

Query: 296 -----SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
                +E +G   G    F+  K+G ++++Y +     I  + + TV S ++L    G+ 
Sbjct: 272 LFAFEAEADGMESGAFDGFTFGKNGEIEVMYSNQKTRIIGYVGMTTVASPESLTFLGGSV 331

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           +     +G   +G PG    G + SG LE +NVDI  ELT++IEAQRNY  NSKVFQTGS
Sbjct: 332 FETNSQTGAQMMGRPGDGVFGTLSSGYLEDSNVDIGDELTDMIEAQRNYTANSKVFQTGS 391

Query: 411 DFMDILISLKR 421
           + MD++++LKR
Sbjct: 392 ELMDVIVNLKR 402


>gi|259417834|ref|ZP_05741753.1| flagellar hook protein FlgE [Silicibacter sp. TrichCH4B]
 gi|259346740|gb|EEW58554.1| flagellar hook protein FlgE [Silicibacter sp. TrichCH4B]
          Length = 422

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 135/446 (30%), Positives = 215/446 (48%), Gaps = 49/446 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A S R++A+SDNIAN  T GYKR   +F S+V      SY +GG+
Sbjct: 1   MTISSSLNAGVAGLAANSTRLAAISDNIANASTAGYKRVVTSFESMVISQNGGSYAAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIV-------KGRDNVNCLTRAGDFHINNE 113
            ++   MI E+ SL+ T++ TDLA+ G+GF  V        G D    LT +G F  N+E
Sbjct: 61  SVNNTRMIDERSSLISTSNATDLAVAGRGFLPVASLAEVDSGGDPTMLLTTSGSFRTNDE 120

Query: 114 GFLENVAGGVLLGYPL-KNASAPLIVNSFQG-LERINVKHAELSAMPTTTGFISNNLDKN 171
           G+L   +G VLLG+P   + + P +     G LE +    ++LSA PTT   +  NL   
Sbjct: 121 GYLTTTSGLVLLGWPANADGTIPTVARDTDGPLEPVRFDTSQLSAAPTTAVSLGVNLPAG 180

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG--DKKW--------- 220
           + +      P+ N          +   YD LG     D+ YT TG  D +W         
Sbjct: 181 SAVAGAAGDPEEN----------AIQYYDNLGGQQELDIVYTPTGANDNEWTMTLTDGAT 230

Query: 221 -----EVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ 275
                E ++   D +T       VA   T   ++DP +G +  ++               
Sbjct: 231 GTVVGEYTLTFDDSATGKGTLDTVA--TTTGGAYDPASGTIIVTTDSG------------ 276

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            I I+I   TQL+  F     E +G+         V + G+V  +Y++G+   +Y++ +A
Sbjct: 277 PIEIEIGVMTQLSSAFSAATIEKDGYEAASFAGVEVDEGGFVHALYENGSSRIVYQIPLA 336

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
            +P+ + +K  D  T++P+ DSG   +   G    GE+ S   E +  D+A+ELT +I+ 
Sbjct: 337 DMPNANGMKSLDSQTFMPSPDSGAYYLWDAGAGPTGEVASYRQEESGTDVATELTSMIQT 396

Query: 396 QRNYAVNSKVFQTGSDFMDILISLKR 421
           QR Y+ N+KV QT  + +    ++KR
Sbjct: 397 QRAYSSNAKVIQTVDEMLQETTNIKR 422


>gi|121601827|ref|YP_989383.1| flagellar hook protein FlgE [Bartonella bacilliformis KC583]
 gi|120614004|gb|ABM44605.1| flagellar hook protein FlgE [Bartonella bacilliformis KC583]
          Length = 404

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 149/439 (33%), Positives = 215/439 (48%), Gaps = 53/439 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M T++SGM+AQ  R+S +++N+AN  TVGYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MGIYGMMHTSVSGMNAQGKRLSGIAENVANAGTVGYKRTNVQFSNYVTPSGDYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T    D  I G GFF V+  +    LTRAG F  + +G+L N +
Sbjct: 61  KSHVGHDISIYGPARATGRPGDAMINGNGFFRVEDENGNEFLTRAGSFSRDKDGYLRNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHA--ELSAMPTTTGF-ISNNLDKNAT---- 173
           G  LL     N             +RI ++    +L     TTG     N D +A     
Sbjct: 121 GHYLL-----NDEG----------QRIQIRGGPTDLFGPEVTTGIDFKANFDASAESLGE 165

Query: 174 -IITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
            +I P+  PK       Y  K S   YD+ G  V  D Y  KT D KW V  +  D    
Sbjct: 166 GVIDPED-PK------SYNQKKSVTVYDSQGKKVQVDFYMRKTADNKWTVDAYHGDNK-- 216

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ---QITIDI------SK 283
                    + T + +FD      A      ++  +N  G      Q+ I++      S 
Sbjct: 217 ---------VGTADFNFDKEGNLQAPLPDFTLTLPENDGGDPPGTFQVAINLGGLGEDSL 267

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIY-DDGTRVPIYRLAIATVPSEDN 342
            TQ  G     ++E NG   G    F+  K+G V++ Y +  TRV  Y + +ATV S ++
Sbjct: 268 VTQ-KGNSYAFEAEANGMEVGSFDGFTFGKNGEVEVKYTNQKTRVISY-VGLATVTSPES 325

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L +  G  +     +G   +G PG    G + +G LE +NV+++ ELT++IE+QRNY  N
Sbjct: 326 LTVLSGTVFQTNTRTGAQMVGRPGDGVFGSLTAGYLEDSNVEMSEELTDMIESQRNYTAN 385

Query: 403 SKVFQTGSDFMDILISLKR 421
           SKVFQTGS+ MD++++LKR
Sbjct: 386 SKVFQTGSELMDVIVNLKR 404


>gi|319409169|emb|CBI82813.1| Flagellar hook protein FlgE [Bartonella schoenbuchensis R1]
          Length = 403

 Score =  192 bits (489), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 138/436 (31%), Positives = 213/436 (48%), Gaps = 48/436 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G M+T +SGM+AQ  R+S V++N+ANV+T+GYKRT + FS+ V PS   +YV GG 
Sbjct: 1   MSIYGMMRTGVSGMNAQGTRLSGVAENVANVNTIGYKRTDVQFSNYVIPSGDYAYVPGGA 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
                  IS  G    T    D+ I G GFF V   + +  LTRAG F  + +G++ N+A
Sbjct: 61  RSYVGHDISISGPARATGRMGDVMIDGNGFFRVADENGIEYLTRAGSFSRDKDGYVRNLA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAM-PTTTGFISNNLDKNATIITPDK 179
           G  LL                +  +R+ +K        P  T  I   ++ +A+    D 
Sbjct: 121 GYYLLD---------------EDGQRVQIKGGPTDLFGPEVTTKIDFKVNFDASAEALDV 165

Query: 180 TPKHNGRDAE-YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
               +  D E Y HK S   YD+ G  +  D Y  KT D KW V  +   +         
Sbjct: 166 HGDIDPNDPESYNHKKSVTTYDSQGKKIQVDFYMRKTDDNKWTVDAYVGGEK-------- 217

Query: 239 VAPLNTVEVSF-------DPVTGYLANSSHKAISFNDNTSGIDQQITIDI------SKTT 285
              + T ++ F       DPV  +        +  ND   G   ++ +++      S  T
Sbjct: 218 ---VGTTDLVFDKDGNLKDPVDDFTL-----TLPENDGEDGT-FEVAVNLGGVGKDSLVT 268

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q+ G     + E +G   G    F+  ++G +++ Y +     +  + + TV S ++L +
Sbjct: 269 QV-GNLSAFELEADGMESGAFDGFTFGRNGEIEVRYTNHQMRVVGYVGMTTVTSPESLTV 327

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
             G+ +     +G   +G PG    G +FSG LE +NV+++ ELT++IEAQRNY  NSKV
Sbjct: 328 LSGSVFGTNSRTGGQMMGRPGDGVFGLLFSGYLEDSNVEMSDELTDMIEAQRNYTANSKV 387

Query: 406 FQTGSDFMDILISLKR 421
           FQTGS+ MD++++LKR
Sbjct: 388 FQTGSELMDVIVNLKR 403


>gi|327254554|gb|EGE66170.1| hypothetical protein ECSTEC7V_0308 [Escherichia coli STEC_7v]
          Length = 400

 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 137/415 (33%), Positives = 203/415 (48%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++     + S   G     T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMY----AGSQAMGVSVAGTA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF++         TRAG F  + +G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKDGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  +++   + NLD +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANLDASDDAIDRTTVPFDPT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  +G+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSDFSVTTNAADGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P++D L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNDDGLQAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SGALE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLTSGALESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|99082779|ref|YP_614933.1| hypothetical protein TM1040_2939 [Ruegeria sp. TM1040]
 gi|99039059|gb|ABF65671.1| Flagellar hook protein flgE [Ruegeria sp. TM1040]
          Length = 422

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 131/445 (29%), Positives = 213/445 (47%), Gaps = 47/445 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A S R++A+SDNIAN  T GYKR   +F S+V   +   Y +GG+
Sbjct: 1   MTISSSLNAGVAGLAANSTRLAAISDNIANSSTAGYKRVVTSFESMVISQSGGRYAAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK-------GRDNVNCLTRAGDFHINNE 113
            ++   MI E+ SL+ T++ TDLA+ G+GF  V        G D    LT +G F  N+E
Sbjct: 61  SVNNTRMIDERSSLISTSNATDLAVAGRGFLPVASLAEVKAGEDPNMLLTTSGSFRTNDE 120

Query: 114 GFLENVAGGVLLGYPL-KNASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G+L   +G VLLG+P   + + P +  ++   LE I    A+LSA PTT   +  NL  +
Sbjct: 121 GYLTTSSGLVLLGWPANSDGTLPSVARDTDDPLEPIRFDTAQLSAAPTTAVSLGVNLPAS 180

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG--DKKWEVSI----- 224
           + +       + N          +   +D LG     ++ YT TG  D +W +++     
Sbjct: 181 SAVTGAAGAAEEN----------TIQYFDNLGGQQDLNIVYTPTGAADNEWTMTLTDGVT 230

Query: 225 --------FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ 276
                      D S       +     T   ++DP TG +  ++                
Sbjct: 231 GTVVGDYTLTFDDSVTGKGTLSTV-TTTTGGAYDPATGAIIVTTDSG------------P 277

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           I I+I   TQLA  F     E +G+         V + GYV  +Y++G+   +Y++ +A 
Sbjct: 278 IEIEIGVMTQLASSFSAATIEKDGYEAASFAGVEVDEGGYVHALYENGSSRIVYQIPLAD 337

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
           +P+ + ++  D  T++P+ DSG   +   G    G + S   E +  D+ASELT +I+ Q
Sbjct: 338 MPNANGMRSLDSQTFMPSPDSGAYYLWDAGAGPTGTVASYRQEESGTDVASELTTMIQTQ 397

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           R Y+ N+KV QT  + +    ++KR
Sbjct: 398 RAYSSNAKVIQTVDEMLQETTNIKR 422


>gi|209963559|ref|YP_002296474.1| flagellar hook protein FlgE [Rhodospirillum centenum SW]
 gi|209957025|gb|ACI97661.1| flagellar hook protein FlgE [Rhodospirillum centenum SW]
          Length = 434

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 143/450 (31%), Positives = 217/450 (48%), Gaps = 45/450 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M I  +M + +SG+ AQS + +A+SDNI+N  TVGYKR+ + FS+LV  ++S  SY +GG
Sbjct: 1   MSIYSAMYSGVSGLAAQSAKFAAISDNISNSSTVGYKRSGVQFSTLVTSASSPGSYSAGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN-VN------CLTRAGDFHINN 112
           ++      +S  G +  T S TD+AI G+GFF+V  R   VN       LTR+G F ++ 
Sbjct: 61  VQADLHTEVSRGGIVQATNSATDMAISGRGFFVVSNRSAAVNGEAPSYMLTRSGAFRVDE 120

Query: 113 EGFLENVAGGVLLGYPL----KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            G L N AG  L G+ L    K         SF GLE +N+      A  TT    + NL
Sbjct: 121 NGNLHNTAGYFLQGWKLGPDGKVVGGEPSRTSFTGLETVNLSSITGLAKATTQIDFAANL 180

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT-KTGDKKWEVSIFRQ 227
             + T  TP   P            +S   Y  LG +    + +  ++   +W ++I+  
Sbjct: 181 PASQTGKTPPAQP----------FSTSVDYYTPLGGTGRLTLEWAPQSAANEWNLTIYDG 230

Query: 228 DQS---TNNSFPYNVA------PLNTV-EVSFDPVTGYLANSSHKAISFNDNTSGIDQQI 277
             S    N  F  N A       LNT+ EV   P     A +    +  N       Q I
Sbjct: 231 TTSLGTANIVFNGNTATSGPPGSLNTMSEVGASPTLDVDAATGSIKLDVNG------QPI 284

Query: 278 TIDISKTTQLAG------GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
            +++ +  Q  G       ++P K   +G +    +   +  DG +  IY +G R  +Y+
Sbjct: 285 VVNLGRPNQTGGLTQWGDDYVPTKINKDGASYAPLERVEIGDDGVMTAIYKNGLRQAVYQ 344

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +A V + D L+  DGN +  +R+SGD  +   G  + G +   ALE +NVDIA ELT 
Sbjct: 345 IPVADVTNPDGLRRMDGNAFQVSRESGDYYLWDAGSGKAGAVDGAALEASNVDIAEELTS 404

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +IE QR Y+ N+K+ QT  + +D +  L R
Sbjct: 405 IIETQRAYSSNAKIIQTADEMLDEVSRLMR 434


>gi|27378811|ref|NP_770340.1| flagellar hook protein FlgE [Bradyrhizobium japonicum USDA 110]
 gi|27351960|dbj|BAC48965.1| flgE [Bradyrhizobium japonicum USDA 110]
          Length = 421

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 145/445 (32%), Positives = 218/445 (48%), Gaps = 48/445 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGG 59
           M + G++ +A+S + AQS  +S +SDNIAN DT GYK T+  F +LV  S+ + SY SGG
Sbjct: 1   MSLTGALSSAISALSAQSQSLSMISDNIANSDTTGYKTTSAMFDALVTASSNATSYASGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLE 117
           + +S +  I++QG L  T++ TD+AIQG GFF V    +   +  TR G F INN G+LE
Sbjct: 61  VTVSGRANITQQGLLAATSNATDVAIQGSGFFAVSNSTSGGTISYTRNGAFTINNAGYLE 120

Query: 118 NVAGGVLLGYPLKNASAPLIVN-SFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           N  G  L G+   +A   ++ N S   L  IN + A  S   TT   ++ NL  +A   T
Sbjct: 121 N-NGNYLEGWR-TDADGNVVGNESASNLTAINTQVASTSGSATTKTTVAANLPSDA--AT 176

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
            D            T+ SS   YD+LG++    V +TKTG   W  S F    ST+++  
Sbjct: 177 GD------------TYTSSMTVYDSLGAANSMQVTWTKTGTNTWSAS-FANPTSTSDTTT 223

Query: 237 YNVAPLNTVEVSFDP---------------VTGYLANSSHKAISFNDNTSGIDQQITIDI 281
                  T+ ++F+                VTG+   ++  +I+ N  T G    +T   
Sbjct: 224 ATGTASGTIAITFNSDGSLASTSPSPATVVVTGWTDGAADSSITLNLGTVGKTDGLT--- 280

Query: 282 SKTTQLAGGFIPQKSEI-----NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
               Q A G       +     +G + GK    S+ KDG VD  Y +G  + IY++A+AT
Sbjct: 281 ----QYASGETTPSVNVTSIDSDGLSYGKLSSVSIGKDGVVDATYSNGQTIAIYKIAVAT 336

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
               + L       Y  T  SG+ ++   G N  G I+   LE++  D +S+ + +I AQ
Sbjct: 337 FADPNGLSARSDGIYSATVTSGNAALQASGENGAGTIYGSELESSTTDTSSQFSSMISAQ 396

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           + Y+  S+V  T +   D LIS  R
Sbjct: 397 QAYSAASQVISTVNKMYDTLISAMR 421


>gi|323975930|gb|EGB71024.1| fagellar hook-basal body protein [Escherichia coli TW10509]
          Length = 400

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 201/415 (48%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF++         TRAG F  + +G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKDGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDPT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNSANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|170021360|ref|YP_001726314.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli ATCC 8739]
 gi|169756288|gb|ACA78987.1| flagellar basal body FlaE domain protein [Escherichia coli ATCC
           8739]
          Length = 400

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|59889780|emb|CAH19136.1| Lateral flagellar hook protein (FlgE-like) [Escherichia coli]
 gi|284920044|emb|CBG33101.1| lateral flagellar hook protein (FlgE-like) [Escherichia coli 042]
          Length = 400

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQASSSLIFTANFDASDDAIDRTTVPFDPT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T          +  
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG---------VPA 224

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           + ++FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 225 MTLTFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|293408367|ref|ZP_06652206.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291471545|gb|EFF14028.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 400

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++     + S   G     T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMY----AGSQAMGVSVAGTA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDPT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSDFSVTTNSANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLTSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|323191538|gb|EFZ76799.1| flgE [Escherichia coli RN587/1]
          Length = 400

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGDYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSDFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|188494513|ref|ZP_03001783.1| Flagellar basal body protein FlgE [Escherichia coli 53638]
 gi|188489712|gb|EDU64815.1| Flagellar basal body protein FlgE [Escherichia coli 53638]
          Length = 400

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|306813303|ref|ZP_07447496.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli NC101]
 gi|305854066|gb|EFM54505.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli NC101]
          Length = 400

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPNTPQTIEFQTDAAAPID--LTVDYSSCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|218703525|ref|YP_002411044.1| lateral flagellar hook FlgE-like protein [Escherichia coli UMN026]
 gi|293403355|ref|ZP_06647446.1| flgE [Escherichia coli FVEC1412]
 gi|300900359|ref|ZP_07118535.1| flagellar hook protein FlgE [Escherichia coli MS 198-1]
 gi|218430622|emb|CAR11488.1| Lateral flagellar hook protein (FlgE-like) [Escherichia coli
           UMN026]
 gi|291429208|gb|EFF02228.1| flgE [Escherichia coli FVEC1412]
 gi|300356127|gb|EFJ71997.1| flagellar hook protein FlgE [Escherichia coli MS 198-1]
          Length = 400

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDPT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSLTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSDFSVTTNSANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLTSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|300817270|ref|ZP_07097488.1| flagellar hook protein FlgE [Escherichia coli MS 107-1]
 gi|307313519|ref|ZP_07593140.1| fagellar hook-basal body protein [Escherichia coli W]
 gi|300530246|gb|EFK51308.1| flagellar hook protein FlgE [Escherichia coli MS 107-1]
 gi|306906687|gb|EFN37198.1| fagellar hook-basal body protein [Escherichia coli W]
 gi|315059542|gb|ADT73869.1| flagellar hook protein [Escherichia coli W]
 gi|323171064|gb|EFZ56713.1| flgE [Escherichia coli LT-68]
 gi|323379899|gb|ADX52167.1| fagellar hook-basal body protein [Escherichia coli KO11]
          Length = 400

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|170681389|ref|YP_001742373.1| lateral flagellar hook protein LfgE [Escherichia coli SMS-3-5]
 gi|170519107|gb|ACB17285.1| lateral flagellar hook protein LfgE [Escherichia coli SMS-3-5]
          Length = 400

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGSCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|301645413|ref|ZP_07245354.1| flagellar hook protein FlgE [Escherichia coli MS 146-1]
 gi|307136858|ref|ZP_07496214.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli H736]
 gi|331640713|ref|ZP_08341860.1| LfgE [Escherichia coli H736]
 gi|301076297|gb|EFK91103.1| flagellar hook protein FlgE [Escherichia coli MS 146-1]
 gi|315616827|gb|EFU97444.1| flgE [Escherichia coli 3431]
 gi|323181547|gb|EFZ66967.1| flgE [Escherichia coli 1357]
 gi|331040087|gb|EGI12295.1| LfgE [Escherichia coli H736]
          Length = 400

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSDFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|331671804|ref|ZP_08372600.1| LfgE [Escherichia coli TA280]
 gi|331070793|gb|EGI42152.1| LfgE [Escherichia coli TA280]
          Length = 400

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 200/415 (48%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKNGYIVNASGDYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ +A   L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDDA-GTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  +G+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAADGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLTSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|256020228|ref|ZP_05434093.1| flagellar basal body FlaE domain-containing protein [Shigella sp.
           D9]
 gi|332281390|ref|ZP_08393803.1| lateral flagellar hook protein [Shigella sp. D9]
 gi|332103742|gb|EGJ07088.1| lateral flagellar hook protein [Shigella sp. D9]
          Length = 400

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|283784085|ref|YP_003363950.1| lateral flagellar hook protein [Citrobacter rodentium ICC168]
 gi|282947539|emb|CBG87091.1| lateral flagellar hook protein [Citrobacter rodentium ICC168]
          Length = 400

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 198/414 (47%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++     ++S   G     T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTDFSAMY----ADSQAMGVSVAGTA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             I+  GS++ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L 
Sbjct: 58  QSIARGGSMVSTGNALDLAINNGGFFVMCDSAGNITYTRAGSFETDKNGYIVNASGACLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   L+   ++   + A  T+    + N D +   +     P    
Sbjct: 118 GYPV-DGSGTLQTGTVTDLQ---IQTGNIPAQATSNMTFTANFDASDETVDRSTMPFDLS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               YT   +   YD+LG+      Y+TKT D  WEV       S +      V P   V
Sbjct: 174 NSDSYTDSYTTTVYDSLGNEHSVCQYFTKTDDNSWEVQY-----SFDGQMESGVEP---V 225

Query: 246 EVSFDPVTGYLAN-SSHKAISFNDNTSG-IDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
            ++FDP TG L + +S  ++ F    +  ID  +T D S  TQ    F    +  NG+A 
Sbjct: 226 TLTFDPNTGKLTSPTSPVSVEFETGAAAPID--MTFDYSSCTQYGSDFSVTTNSANGYAS 283

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
                  V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG
Sbjct: 284 ATQNGVQVDDDGKVYATYSNGERMLQGQIVLATFPNENGLEAVSGTAWVQTGESGSALIG 343

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
            PG    G + SG LE++NVDI +EL EL+ AQRNY  N+KV  T +   D L 
Sbjct: 344 VPGSGSCGTLSSGMLESSNVDITTELVELMTAQRNYQANTKVISTSTQLDDALF 397


>gi|89068728|ref|ZP_01156114.1| flagellar hook protein FlgE, putative [Oceanicola granulosus
           HTCC2516]
 gi|89045691|gb|EAR51753.1| flagellar hook protein FlgE, putative [Oceanicola granulosus
           HTCC2516]
          Length = 432

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 147/455 (32%), Positives = 223/455 (49%), Gaps = 57/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-SYVSGG 59
           M ILG+MKT +SG+ A +  V+ +S+NIAN +T G++R+   FS +V  +T+N S +SG 
Sbjct: 1   MSILGAMKTGVSGLQANAASVANISENIANANTDGFRRS---FSQMVTTTTTNPSSMSGV 57

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-----LTRAGDFHINNEG 114
           +     DM    GS+  T S TDLA++G GFF+V  R +        LTRAG F  +  G
Sbjct: 58  IARDRIDM-GTPGSMRPTDSATDLALEGGGFFVVSQRPDEPLASNYMLTRAGSFTPDENG 116

Query: 115 FLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
            L+N AG  L G+P      +  +   SF  L  +NV    +   PTTT  +S NL    
Sbjct: 117 NLKNAAGFYLAGFPTDQNGQTGGIDRTSFGDLSTVNVLERSIQGAPTTTIALSGNLPAQE 176

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIFRQDQST 231
           + +     P  +   AEY        ++ LG +   ++ +  + +K +W + I   D   
Sbjct: 177 SGLATPGAPFIS--SAEY--------FNPLGGAERLELRWLPSMNKNEWTLEISGPDP-- 224

Query: 232 NNSFPYNVAPLNTVEVSFD--------PVTGY--LANSSHKAISFNDNTSG----ID--- 274
                 N  P   V  +F+        P+T Y  + N      +FND T      ID   
Sbjct: 225 ------NQPPYGWVTATFEDSGPNAGSPLT-YQGMPNGGGANFAFNDATGQATLTIDNGN 277

Query: 275 --QQITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
             Q IT+D+         TQ AG + P + + +G   G      +  DG V   +D+G R
Sbjct: 278 TPQVITLDLGAPGEFDGMTQFAGDYTPPQIDRDGSEAGNLARVEIENDGTVFGFFDNGQR 337

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
           + ++ L +A V + + L   +GN Y  +R SG +++G  G      I++GALE +NVDIA
Sbjct: 338 MSLFSLPVANVSNPEGLVAGNGNAYKLSRASGAMTLGIAGGGGTASIYAGALEGSNVDIA 397

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            ELT+LI  QR Y+ N+KV  T  + +D    +KR
Sbjct: 398 EELTDLIATQRAYSTNAKVVTTADEMLDETTRIKR 432


>gi|331645418|ref|ZP_08346522.1| LfgE [Escherichia coli M605]
 gi|331045580|gb|EGI17706.1| LfgE [Escherichia coli M605]
          Length = 400

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  +G+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAADGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|288962673|ref|YP_003452967.1| flagellar hook protein [Azospirillum sp. B510]
 gi|288914939|dbj|BAI76423.1| flagellar hook protein [Azospirillum sp. B510]
          Length = 427

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 142/449 (31%), Positives = 218/449 (48%), Gaps = 50/449 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV-FPSTSNSYVSGG 59
           M +  +M++ +SGM AQS+R++A+SDNI+N  TVGYKR  + FS+LV  P    SY + G
Sbjct: 1   MSLYSAMRSGVSGMAAQSSRLAAISDNISNSQTVGYKRATVDFSTLVTAPGDRTSYSASG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN---CLTRAGDFHINNEGFL 116
           ++ +    + + G+L+ T S+TD+AI G GFF+V  R        LTRAG F  ++ GFL
Sbjct: 61  VQSNLHYQMQQDGTLLGTGSSTDMAISGDGFFVVGNRATGTPDYALTRAGSFLPDDGGFL 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNS--FQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
            N AG  L G+ L        VN+  F  L+ INV +       TT   ++ NL   AT 
Sbjct: 121 RNTAGQYLQGWKLDPNGNLGAVNTTRFDDLKTINVGNLAYGGSRTTKMGLTGNLPAQAT- 179

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSS----------VVYDVYYTKTG-DKKWEVS 223
                        A     ++   YD+LG +          V  D   T T  D KWE++
Sbjct: 180 -------------AGTNFTTTTTFYDSLGEAKDIQLNWKMIVPPDSAATPTPIDGKWELT 226

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSF---DPVTGYLANSSHKAIS--------FNDNTSG 272
           +            Y V P     ++F    P  G + + S   +             TS 
Sbjct: 227 VTPPGN-------YTVTPTGPQSITFASVGPNAGMMVDGSGNPLGSLPFTITSQTSTTSP 279

Query: 273 IDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRL 332
                T+++S  TQL G ++PQ +  +G   G+    +V   G +  +YD+G R  +Y++
Sbjct: 280 TPDSFTLNVSDITQLRGDYVPQITA-DGAKAGRVTSVNVDGTGKLWALYDNGARQALYQV 338

Query: 333 AIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTEL 392
            +A V + D L    GNT+   RDSG +++      + G +   ALE +NVDIA+EL  L
Sbjct: 339 PVANVTNPDGLVAQTGNTFTLGRDSGTLTLSAGNSGKAGSVVGSALEQSNVDIATELVSL 398

Query: 393 IEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           IE QR Y+ ++ + +T  + ++    LKR
Sbjct: 399 IETQRAYSSSATLVRTTDEMVEETTRLKR 427


>gi|331666546|ref|ZP_08367420.1| LfgE [Escherichia coli TA271]
 gi|331065770|gb|EGI37654.1| LfgE [Escherichia coli TA271]
          Length = 400

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N + +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFNASDEAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|300936126|ref|ZP_07151065.1| flagellar hook protein FlgE [Escherichia coli MS 21-1]
 gi|300458704|gb|EFK22197.1| flagellar hook protein FlgE [Escherichia coli MS 21-1]
          Length = 400

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 199/415 (47%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++     + S   G     T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMY----AGSQAMGVSMAGTA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N D +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + ID  +T+D S  TQ    F    +  +G+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPID--LTVDYSTCTQYGSEFSVTTNAADGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|260853466|ref|YP_003227357.1| putative lateral flagellar hook protein [Escherichia coli O26:H11
           str. 11368]
 gi|260866413|ref|YP_003232815.1| putative lateral flagellar hook protein [Escherichia coli O111:H-
           str. 11128]
 gi|257752115|dbj|BAI23617.1| predicted lateral flagellar hook protein [Escherichia coli O26:H11
           str. 11368]
 gi|257762769|dbj|BAI34264.1| predicted lateral flagellar hook protein [Escherichia coli O111:H-
           str. 11128]
 gi|323158103|gb|EFZ44202.1| hypothetical protein ECEPECA14_0101 [Escherichia coli EPECa14]
 gi|323178494|gb|EFZ64072.1| hypothetical protein ECOK1180_3007 [Escherichia coli 1180]
          Length = 400

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 133/415 (32%), Positives = 200/415 (48%), Gaps = 22/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G    T 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQAMGVSVAG----TA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GSL+ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKNGYIVNASGAYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + +  L   +   +  I +K   + A  +++   + N + +   I     P    
Sbjct: 118 GYPVDD-TGTLQTGT---VTDIQIKTGNIPAQASSSLTFTANFNASDEAIDRTTVPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS-IFRQDQSTNNSFPYNVAPLNT 244
             + YT   +   YD+LG+      Y+TKT D  WEV   F   Q T         P  T
Sbjct: 174 NSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTG-------VPATT 226

Query: 245 VEVSFDPVTGYLAN-SSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +FDP TG L + ++ + I F  D  + +D  +T+D S  TQ    F    +  NG+A
Sbjct: 227 L--TFDPNTGKLTSPTTPQTIEFQTDAAAPVD--LTVDYSTCTQYGSEFSVTTNAANGYA 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
                   V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   I
Sbjct: 283 SATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLI 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L 
Sbjct: 343 GVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALF 397


>gi|146305250|ref|YP_001185715.1| flagellar basal body FlaE domain-containing protein [Pseudomonas
           mendocina ymp]
 gi|145573451|gb|ABP82983.1| flagellar basal body FlaE domain protein [Pseudomonas mendocina
           ymp]
          Length = 395

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 133/425 (31%), Positives = 206/425 (48%), Gaps = 47/425 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   AM+G+ A + +++ +S NIAN  T G+K +   F S+     ++S   G   ++T 
Sbjct: 2   SFNIAMTGLSAVNEQLNTISHNIANAGTTGFKSSRTEFGSIY----ADSQAMGVEVLATT 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS+ GSL+ T  + DLAI G GFF+ +G +     TRAG F  + + ++ N AG  L 
Sbjct: 58  QSISQGGSLVTTGRSLDLAISGGGFFVTRGSNGDVSYTRAGVFGADKDNYIVNAAGLKLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT--PDKTPKH 183
           GYP+ +A+  L+V +   L+   +++A L A  T +     NLD N ++ T  P      
Sbjct: 118 GYPV-DAAGNLLVGAMGDLQ---LQNANLPARATDSLAFVMNLDSNQSVPTAAPFDPADV 173

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS----------TNN 233
           N  ++ YT K     +D+ G       Y+ KTGD  WE   +    +          TN 
Sbjct: 174 NTYNSTYTTK----VFDSQGKEHTLTQYFVKTGDNAWEAHYYADGAAVGGPQALTFGTNG 229

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID-QQITIDISKTTQLAGGFI 292
           S     AP+  V V F P+                   G+D   I ID S ++Q    F+
Sbjct: 230 SL---TAPVGPVAVGF-PL------------------PGVDPMNIAIDYSNSSQYGSDFV 267

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
              +  +G+A G+    SV KDG V   Y +G R+   ++A+AT  +   LK   G  ++
Sbjct: 268 VTSNRASGYAAGEQTGLSVEKDGMVYANYSNGQRMLQGQVALATFANAGGLKNVSGTAWV 327

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            + +SG   IG PG    GE+ +G+LE +NVD+  +L  L+E QRNY  N+KV  T  + 
Sbjct: 328 ESAESGAALIGVPGVGPFGELVAGSLENSNVDLTQQLVGLMEGQRNYQANTKVLTTNKEL 387

Query: 413 MDILI 417
             +L 
Sbjct: 388 TQVLF 392


>gi|330501137|ref|YP_004378006.1| flagellar basal body FlaE domain-containing protein [Pseudomonas
           mendocina NK-01]
 gi|328915423|gb|AEB56254.1| flagellar basal body FlaE domain-containing protein [Pseudomonas
           mendocina NK-01]
          Length = 395

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 198/415 (47%), Gaps = 27/415 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   AM+G+ A + +++ +S NIAN  T G+K +   F S+     ++S   G   ++T 
Sbjct: 2   SFNIAMTGLSAVNEQLNTISHNIANAGTTGFKSSRTEFGSIY----ADSQAMGVEVLATT 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS+ GSL+ T  + DLAI G GFF+ +G +     TRAG F  + +  + N AG  L 
Sbjct: 58  QSISQGGSLVTTGRSLDLAISGGGFFVTRGGNGDVSYTRAGVFGADKDNNIVNAAGQTLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--ITPDKTPKH 183
           GYP+ +A+  L V +   L+   ++ A L A  T T     NLD N T+    P      
Sbjct: 118 GYPV-DAAGNLQVGAMGDLQ---LQTANLPARATDTLAFVMNLDSNQTVPATAPFDPADV 173

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
           N  ++ YT K     +D+ G       Y+ KTGD  W+V  ++ + +             
Sbjct: 174 NTYNSTYTTK----IFDSQGKEHTLTQYFIKTGDNAWDVRYYQGNTAVGGPQALTFGTNG 229

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGID-QQITIDISKTTQLAGGFIPQKSEINGHA 302
           T+     PV    A              G+D   I ID S ++Q    F+   +  +G+A
Sbjct: 230 TLTAPAGPVNVGFA------------LPGVDPMAIAIDYSNSSQYGSDFVVTTNRASGYA 277

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+    SV KDG V   Y +G R+   ++A+AT  +   LK   G  ++ T DSG   I
Sbjct: 278 AGEQTGLSVEKDGMVYANYSNGQRMLQGQVALATFANAGGLKDVSGTAWVETADSGAALI 337

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + +G+LE +NVD+  +L  L+E QRNY  N+KV  T  +   +L 
Sbjct: 338 GVPGVGPFGALVAGSLENSNVDLTQQLVGLMEGQRNYQANTKVLTTNKELTQVLF 392


>gi|163744346|ref|ZP_02151706.1| flagellar hook protein FlgE [Oceanibulbus indolifex HEL-45]
 gi|161381164|gb|EDQ05573.1| flagellar hook protein FlgE [Oceanibulbus indolifex HEL-45]
          Length = 422

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 136/448 (30%), Positives = 215/448 (47%), Gaps = 53/448 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  +++  +SG+ A S+RV  +S NIAN +TVGY+RT   FS  V  +T ++    G+
Sbjct: 1   MSITSALQIGVSGLQANSSRVQNISSNIANANTVGYRRT---FSEFVTQNTGSTQA--GV 55

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNC---LTRAGDFHINNEGF 115
               +  IS  G+++ T S TDLA+QG GFF+V     D +     LTRAG F  +  G 
Sbjct: 56  LTDVRANISTNGNIVGTNSTTDLAVQGDGFFVVSRNANDPIESNYYLTRAGSFTPDQNGD 115

Query: 116 LENVAGGVLLGYPLKNA--SAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT 173
           L N AG  L G+P   A  +  +   S+  L  +N+   ++   P+++  +S N+    T
Sbjct: 116 LRNSAGYFLSGFPTDAAGNTGSVSSTSYNDLSTVNIASYQVQGTPSSSVGVSGNVPAQET 175

Query: 174 IITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQ----- 227
                  P   G   E T +      + LG S    + +T    D +W VSI  +     
Sbjct: 176 ------GPGTTGTAFESTLR----YVNQLGGSDALTLSWTPGAVDNEWTVSITDEAGTNY 225

Query: 228 --------DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI 279
                   D   +   P +  P     +  DP TG         ++ +    G  Q + I
Sbjct: 226 GDATVNFTDSGADAGSPASYTP---GTLPIDPATG--------VVTLSITNGGTPQALEI 274

Query: 280 DISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLA 333
           D          TQ +G + P     +G   G  +   +S  G +  ++D+G R  ++++ 
Sbjct: 275 DFGAPGTFGGMTQFSGDYTPPAFTDDGTETGSLERAEMSDSGVLFGVFDNGQRRALFQVP 334

Query: 334 IATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELI 393
           +A V + D ++  DGN Y+ TRDSG +S+G P  N  G I S ALE +NVDIA ELT+LI
Sbjct: 335 LANVANPDQMRSVDGNAYVATRDSGAVSLGNPMLNGLGSINSNALEGSNVDIAQELTDLI 394

Query: 394 EAQRNYAVNSKVFQTGSDFMDILISLKR 421
           + QR Y+ ++K+  T  + +   +++KR
Sbjct: 395 QTQRAYSSSAKIITTSDEMLSETLNIKR 422


>gi|254488501|ref|ZP_05101706.1| flagellar hook protein FlgE [Roseobacter sp. GAI101]
 gi|214045370|gb|EEB86008.1| flagellar hook protein FlgE [Roseobacter sp. GAI101]
          Length = 432

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 218/450 (48%), Gaps = 47/450 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A + R+++VSDNIAN  T GYKR    F+SLV    S+SY +GG+
Sbjct: 1   MTISSSLNAGVAGLQANATRLASVSDNIANSSTYGYKRVVTDFNSLVLSEGSSSYTAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
             S++ ++ E G+L+ T ++TDLA++G+GF  V      N         LT  G F ++ 
Sbjct: 61  RASSQRLLGEDGALVSTTNSTDLAVRGRGFLPVTTATEFNANSETPEMMLTTTGSFRLDA 120

Query: 113 EGFLENVAGGVLLGYPLK-NASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           EGFL+  +G +L+G+P   + S P+   ++  GL  +      L+  PTT   +S NL  
Sbjct: 121 EGFLKTESGLLLMGWPANADGSIPIYPRDTDDGLRPVQFAL-NLNGDPTTRVDMSLNLPA 179

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT----KTG-DKKWEVSIF 225
            AT       P+      EY        +D LG+S    + +T     TG   +W V + 
Sbjct: 180 TATAAGGSGEPQI--LSIEY--------FDNLGTSKSISMEFTPNVPATGTTNEWNVKLM 229

Query: 226 RQDQSTNNSFPY------------NVAPLNTVEV-SFDPVTG-YLANSSHKAISFNDNTS 271
              Q       Y             +A + T+   ++DPVTG  + ++    I FN    
Sbjct: 230 DSAQGGLLVGEYTILFDDSRASGGTIASVTTITGNAYDPVTGDLIVDAQSGPIEFNIGAI 289

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           G    +       +QL+  F P     +G   G      V ++GYV+ IYD+G R  IY+
Sbjct: 290 GSSFGL-------SQLSDSFAPIALTKDGSPIGNMAGVEVDENGYVNAIYDNGLRNTIYQ 342

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +  +P+ + +   D  TYLP+  SG   +   G    G+I S + E +  D+A+ELT 
Sbjct: 343 IPLIDMPNPEGMVSLDAQTYLPSTKSGAYFLWDSGEGPTGDIKSYSREESTTDVATELTT 402

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +I  QR Y+ N+KV QT  + +    ++KR
Sbjct: 403 MIRTQRAYSSNAKVIQTVDEMLQETTNIKR 432


>gi|260431756|ref|ZP_05785727.1| flagellar hook protein FlgE [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415584|gb|EEX08843.1| flagellar hook protein FlgE [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 439

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 215/450 (47%), Gaps = 48/450 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++ + A +NR++ +SDNIAN  T GYKR    F S+V      SY +GG+
Sbjct: 9   MTISSSLNAGVAALKANANRLATISDNIANSSTFGYKRVETDFHSMVTAGQGGSYSAGGV 68

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEG 114
             +++ +I ++GSL+ T ++TDLA+QG+G   V+    +        LT  G F  N EG
Sbjct: 69  RTTSQRLIDQRGSLVTTNNSTDLAVQGRGLLPVRPSSQIGTPSNEMLLTTTGSFRTNAEG 128

Query: 115 FLENVAGGVLLGYPL-KNASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
           +L   +G VLLG+P   + S P +  ++   LE + +   +LS  PTT   +  NL   A
Sbjct: 129 YLVTESGLVLLGWPANSDGSIPNVSRDTPAALEPVQLSVNQLSGAPTTEMNLRMNLPATA 188

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT----KTGDK-KWEVSIFRQ 227
           T       P+      EY        +D LG     D+        TG   +W +++  +
Sbjct: 189 TDAGASGDPQP--LSVEY--------FDNLGKPETVDIELVPIVPATGSSNQWTMTL--R 236

Query: 228 DQSTNNSF--PYNV---------APLNTVEV----SFDPVTG-YLANSSHKAISFNDNTS 271
           D ++  +    Y +           L +V      ++DP TG ++ N +   +  N    
Sbjct: 237 DSASGGAVIGEYTLTFTDSRTAGGTLASVTAVSGGAYDPATGSFVVNVAGGPVEVNVGLI 296

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           G       D    TQL+  F P     +G A G      + ++GYV  +YD G    +Y+
Sbjct: 297 G-------DPDGITQLSDTFAPVSITRDGSAVGTMASVEIDENGYVYALYDTGVTRRMYQ 349

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +A VP+ + L   +  TY P+R+SG   +   G    GE+ S A E +  D+A+ELT 
Sbjct: 350 IPLADVPNPNGLTALNSQTYAPSRESGTYFLWNAGEGPTGELISFAREESTTDVATELTS 409

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +I+ QR Y+ ++KV QT  + +    ++KR
Sbjct: 410 MIQTQRAYSSSAKVIQTVDEMLQETTNIKR 439


>gi|295687864|ref|YP_003591557.1| fagellar hook-basal body protein [Caulobacter segnis ATCC 21756]
 gi|295429767|gb|ADG08939.1| fagellar hook-basal body protein [Caulobacter segnis ATCC 21756]
          Length = 425

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 133/441 (30%), Positives = 211/441 (47%), Gaps = 36/441 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M +  ++ TA+SG+ AQS  +SA+S+NIAN  T  YK T + F +LV     +S  +  +
Sbjct: 1   MSLSAALSTAVSGLTAQSRALSAISENIANSSTTAYKTTDVYFQALVSGGKGSSTSTSAV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIV----KGRDNVNCLTRAGDFHINNEGFL 116
              +   +S QG++  T+  T++AIQ  GFF+V     G  + +  TR G F  N +G+L
Sbjct: 61  TAKSSQAMSVQGTVTSTSVATNVAIQDAGFFVVTSDPAGAASEDMYTRNGSFETNADGYL 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNS--FQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
            N  G  L+G+P       L  N+    GL  IN+     +A  TT   +S N+  +A +
Sbjct: 121 INTEGFYLMGWPTDAEGNVLASNTNDLTGLSAINLSSIGGTAKATTEIEMSANVPADAAV 180

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS----IFRQDQS 230
                        A  T  +S    D+LG S      +TKT D  WE++    +   D +
Sbjct: 181 ------------GAALT--TSMQMIDSLGVSHTVGQTWTKTADNTWELTLSDPVLTSDGT 226

Query: 231 TN----NSFPYNV-----APLNTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITID 280
           T     N  PY V       L +V  + D  VTG+ + ++  A+S +    G    +T  
Sbjct: 227 TQSGTINGGPYTVVFNTDGSLGSVTPALDFTVTGFSSGAADSAVSLDIGEVGGTDGVTQY 286

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
            S ++ +  G    ++E +G   G+    S+  DG V   +D+G  + IY++ IAT  + 
Sbjct: 287 ASTSSTI--GLEDVQTEQDGALYGELSGISIDSDGLVTANFDNGISLAIYQIPIATFSNP 344

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
           + L L  G TY     +G + +  PG    G + + ALE +  DIA+E  ++I AQ+ Y+
Sbjct: 345 NGLTLVSGTTYDENSAAGQVHLNLPGEGGAGSLVASALEGSTTDIATEFNKMIIAQQAYS 404

Query: 401 VNSKVFQTGSDFMDILISLKR 421
             S+V  + SD  D LI   R
Sbjct: 405 AASQVVSSASDMFDSLIQAVR 425


>gi|225849153|ref|YP_002729317.1| flagellar hook protein FlgE [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643172|gb|ACN98222.1| flagellar hook protein FlgE [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 409

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 136/431 (31%), Positives = 212/431 (49%), Gaps = 34/431 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS--------NS 54
           +L S  TA+SG++     +  +SDNIANV+T+G+K   + F  LV  S +        N 
Sbjct: 1   MLQSFYTAVSGLNGNQKWIDVISDNIANVNTIGFKSERVTFEDLVAKSLTTFANNTPKNM 60

Query: 55  YVSGG--LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINN 112
            + GG  + ++TKD    QGS  +T +  DLA+ G+GFF+VK        TRAG F ++ 
Sbjct: 61  EIGGGSFIALTTKDF--SQGSFQNTVNPLDLALDGEGFFMVKDNQGTVYYTRAGQFRLDA 118

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS-NNLDKN 171
            G + NV G  L G+ L  A      N    L++IN+ ++ L ++ T    +   NLD  
Sbjct: 119 NGDIVNVDGMKLQGWKLDTAG-----NISAALDKINIPYSILPSITTKINLVEPTNLDSR 173

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
              I+    P +    A + + +S   YD+LG+      Y+ K+    W V+ +  + +T
Sbjct: 174 VNTISGTIDPTN---PATFNYANSMTIYDSLGNPHTLTFYFQKSSPNTWNVAAYVDNNTT 230

Query: 232 NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN-DNTSGIDQQITIDISKTTQLAGG 290
                    P+ +  + FD  TG L + S   +S    N +   Q +T+D+++  Q+A  
Sbjct: 231 --------TPVGSGTLQFDS-TGKLISGSPITLSIPLTNGATTPQTVTVDLTQVKQVASD 281

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           FI   ++ +G A G     SVS+DG V  +Y +G    I RLA+AT   ++ L     N 
Sbjct: 282 FIFYANQ-DGFAKGDLIGVSVSEDGVVRGMYSNGKVELIARLAVATFKDKEMLVRKGNNL 340

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           YLP   S    I  PG     ++ SG LE +NVDI+ E   LI AQR Y  N++V  T  
Sbjct: 341 YLPNTQSF-TPIITPG-GILSKVRSGFLELSNVDISKEFINLITAQRAYQANARVITTDD 398

Query: 411 DFMDILISLKR 421
             +   +++KR
Sbjct: 399 QILQEAMNIKR 409


>gi|237755390|ref|ZP_04584017.1| flagellar basal body and hook protein FlgE [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692431|gb|EEP61412.1| flagellar basal body and hook protein FlgE [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 413

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 140/438 (31%), Positives = 218/438 (49%), Gaps = 44/438 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS--------NS 54
           +L S  TA++G++     ++ +SDNIANV+T+G+K   + F  L+  S +        N+
Sbjct: 1   MLQSFYTAITGLNGNQQWLNVISDNIANVNTIGFKSERVTFEDLIAHSLTTFANNTPKNT 60

Query: 55  YVSGG--LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINN 112
            + GG  + ++TKD    QGS M+T S TDLA+ G+GFF+VK        TRAG F +N 
Sbjct: 61  EIGGGSFIALTTKDF--SQGSFMNTNSPTDLALDGEGFFMVKDNQGTVYYTRAGQFRLNA 118

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS----NNL 168
           +G L NV G  L G+ L +       N    L++INV +A     PT T  IS     NL
Sbjct: 119 DGDLVNVDGMKLQGWTLDDKG-----NIIGALDKINVPYA---INPTITTKISLVEPTNL 170

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----WEVSI 224
           D  + +I+    P  +     + + +S   YD+LG+      Y+ KT +      W+V +
Sbjct: 171 DSRSNVISATFDPTDS---TTFNYVNSMTVYDSLGNPHTLSFYFQKTNESSTGSTWKVYV 227

Query: 225 FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN-DNTSGIDQQITIDISK 283
           +  +  T          + +  ++FD   G L + S   +S    N +   Q IT+D+SK
Sbjct: 228 YMDNDLT--------TQVGSSTLNFD-TNGNLTSGSPFTLSLTLTNGATSPQSITVDVSK 278

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
             Q+A  FI   ++ +G A G     +V++DG +  +Y +G    I RLA+AT   ++ L
Sbjct: 279 IKQVASDFIFYANQ-DGFAKGDLIGVAVAEDGIIKGMYSNGNVKNIARLAVATFKDKEML 337

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                N YLP   +    I  PG     ++ SG LE +NVDI+ E   LI AQR Y  N+
Sbjct: 338 VRKGNNLYLPNTQTF-TPIITPG-GILSKVRSGFLELSNVDISREFINLITAQRAYQANA 395

Query: 404 KVFQTGSDFMDILISLKR 421
           +V  T    +   +++KR
Sbjct: 396 RVITTDDQILQEAMNIKR 413


>gi|254464969|ref|ZP_05078380.1| flagellar hook protein FlgE [Rhodobacterales bacterium Y4I]
 gi|206685877|gb|EDZ46359.1| flagellar hook protein FlgE [Rhodobacterales bacterium Y4I]
          Length = 435

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 133/450 (29%), Positives = 219/450 (48%), Gaps = 44/450 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   +SG+ A ++R++++SDNIAN  T GYKR    F S+V   +  +Y +GG+
Sbjct: 1   MTISSSLNAGVSGLSANASRLASISDNIANSSTRGYKRVQTDFHSMVLSGSGGTYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-------LTRAGDFHINNE 113
             +   +I E+G L+ T + TDLA++G+G   V     V         LT  G F  ++ 
Sbjct: 61  RTTNVRLIDERGPLVSTNNATDLAVRGRGMLPVASITEVEAGGSPSMMLTSTGSFRTDSS 120

Query: 114 GFLENVAGGVLLGYPLK-NASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G+L   +G VL+G+P + + + P +  ++   LE I +    LSA PTT   ++ NL   
Sbjct: 121 GYLSTESGLVLMGWPAQADGTLPDVARDTADALEPIRIDLNRLSAEPTTEISLTANLPAA 180

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT--------KTGDKKWEVS 223
            T       P  +G   E   +     +D +G S    + YT         +G  +W + 
Sbjct: 181 ET------DPGASGDPVEQVVQ----YFDNMGRSEELTITYTPSVATPPATSGTNEWTMQ 230

Query: 224 IFRQDQSTNNS--------FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ 275
           I   D +T  +        F  + A   T++ S   +TG   +++  +++ N   +G   
Sbjct: 231 IV--DSATGATVIGEYTLTFDDSAASAGTLQ-SVATLTGGAYDATAGSVTIN--VAGGPV 285

Query: 276 QITIDI----SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +I I +    +  +QL   F+P  +E +G A G      V+  G V   YD G    IY+
Sbjct: 286 EINIGVIGEQNGMSQLGDEFVPGTTEKDGTAVGSFVSVEVNASGEVIASYDSGDTKVIYK 345

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +A V + + ++  D  TY PT DSG   +   G    GEI   A E + VD+A+ELT+
Sbjct: 346 VPLADVSNINGMQALDSQTYKPTDDSGAFYLWDAGEGPTGEILGYAQEESAVDVATELTD 405

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 406 MIKTQRAYSSNAKVIQTVDEMLQETTNIKR 435


>gi|254511352|ref|ZP_05123419.1| flagellar hook protein FlgE [Rhodobacteraceae bacterium KLH11]
 gi|221535063|gb|EEE38051.1| flagellar hook protein FlgE [Rhodobacteraceae bacterium KLH11]
          Length = 439

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 134/455 (29%), Positives = 214/455 (47%), Gaps = 58/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++ + A +NR++ +SDNIAN  T GYKR    F S+V      SY +GG+
Sbjct: 9   MTISSSLNAGVAALKANANRLATISDNIANSSTFGYKRVETDFHSMVTSGQGGSYSAGGV 68

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC------LTRAGDFHINNEG 114
             +++ +I ++GSL+ T ++TDLA++G+G   V+    +        LT  G F  N EG
Sbjct: 69  RTTSQRLIDQRGSLVTTNNSTDLAVRGRGMLPVRPSSQIAAGSNEMMLTTTGSFRTNEEG 128

Query: 115 FLENVAGGVLLGY-PLKNASAPLI-VNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
           +L   +G VLLG+    + S P +  ++   LE I +   +LS  PTT   +  NL   A
Sbjct: 129 YLVTQSGLVLLGWRAAADGSIPSVPRDTPAALEPIQLSVNQLSGAPTTEMNLRMNLPATA 188

Query: 173 TIITPDKTPKHNGR--DAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIF 225
           T    D     + +    EY        +D LG S   D+    T        +W +++ 
Sbjct: 189 T----DAGAPGDAQPLSVEY--------FDNLGKSESVDIELVPTVPAVGSSNEWTMTL- 235

Query: 226 RQDQSTNNSF--PYNV---------APLNTVEV----SFDPVTGYLANSSHKAISFNDNT 270
            +D ++  +    Y +           L +V      ++DP TG          S   N 
Sbjct: 236 -RDSASGGTVIGEYTLTFTDSRTAGGTLASVTAVTGGAYDPATG----------SMVVNV 284

Query: 271 SGIDQQITI----DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
           +G   +I I    D    TQL+  F P     +G A G      V ++GYV   YD G  
Sbjct: 285 AGGPMEINIGQLGDADGITQLSDTFAPVSITRDGSAVGTMTSVQVDENGYVYAFYDTGVS 344

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             ++++ +A VP+ + L   D  TY P+RDSG   +   G    G++ S A E +  D+A
Sbjct: 345 RRMFQIPLADVPNPNGLTALDSQTYAPSRDSGTFFLWNAGEGPTGDLVSFAREESTTDVA 404

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +ELT +I+ QR Y+ ++KV QT  + +    ++KR
Sbjct: 405 TELTSMIQTQRAYSSSAKVIQTVDEMLQETTNIKR 439


>gi|188997539|ref|YP_001931790.1| protein of unknown function DUF1078 domain protein
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932606|gb|ACD67236.1| protein of unknown function DUF1078 domain protein
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 413

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 137/435 (31%), Positives = 216/435 (49%), Gaps = 38/435 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS--------NS 54
           +L S  TA++G++     ++ +SDNIANV+T+G+K   + F  LV  S +        N+
Sbjct: 1   MLQSFYTAITGLNGNQQWLNVISDNIANVNTIGFKSERVTFEDLVAHSLTTFANNTPKNT 60

Query: 55  YVSGG--LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINN 112
            + GG  + ++TKD    QGS M+T S TDLA+ G+GFF+VK        TRAG F ++ 
Sbjct: 61  EIGGGSFVALTTKDF--SQGSFMNTNSPTDLALDGEGFFMVKDNQGTVYYTRAGQFRLDA 118

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS-NNLDKN 171
            G L NV G  L G+ L N       N    L++INV +A    + T    +   NLD  
Sbjct: 119 NGDLVNVDGMKLQGWTLDNNG-----NIAGALDKINVPYAINPTITTKINLVEPTNLDSR 173

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----WEVSIFRQ 227
           + +I+    P ++     + + +S   YD+LG+      Y+ KT +      W+V  ++ 
Sbjct: 174 SNVISATFDPTNS---TTFNYVNSMTIYDSLGNPHTLSFYFQKTNESSTGSTWKVYAYKD 230

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN-DNTSGIDQQITIDISKTTQ 286
           +  T          + +  ++FD   G L + S   +S    N +   Q I++D+SK  Q
Sbjct: 231 NDLT--------TQVGSSTLNFD-TNGNLTSGSPFTLSLTLSNGATSPQVISVDVSKIKQ 281

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
           +A  FI   ++ +G A G     +V++DG V  +Y +G    I RLA+AT   ++ L   
Sbjct: 282 VASDFIFYANQ-DGFAKGDLLGVAVTEDGIVKGMYSNGNVKNIARLAVATFKDKEMLVRK 340

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N YLP   +    I  PG     ++ SG LE +NVDI+ E   LI AQR Y  N++V 
Sbjct: 341 GNNLYLPNTQTF-TPIITPG-GILSKVRSGFLELSNVDISREFINLITAQRAYQANARVI 398

Query: 407 QTGSDFMDILISLKR 421
            T    +   +++KR
Sbjct: 399 TTDDQILQEAMNIKR 413


>gi|283834455|ref|ZP_06354196.1| flagellar hook protein FlgE [Citrobacter youngae ATCC 29220]
 gi|291070002|gb|EFE08111.1| flagellar hook protein FlgE [Citrobacter youngae ATCC 29220]
          Length = 400

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 186/403 (46%), Gaps = 16/403 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++ +  T    VS      + 
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANSGTVGYKSMTTQFSAM-YAGTQAMGVS---VAGSA 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS  GS++ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L 
Sbjct: 58  QSISTGGSMVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFVTDKNGYIVNASGDYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ + S  L   +   +  I +K   + A  T +   + N D +   I     P    
Sbjct: 118 GYPVDD-SGTLQTGT---VTDIQIKTGNIPAQATDSMTFTANFDASDETIDRTSVPFDAN 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               YT   +   YD+LG+      Y+TKTGD  WEV  +  D    +  P         
Sbjct: 174 NSDTYTDSYTTTVYDSLGNEHSVSQYFTKTGDNTWEVQ-YTFDGEAQSGVP-------AT 225

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            ++FDP TG L + +                +T+D S  TQ    F    +   G+A   
Sbjct: 226 TLTFDPNTGKLTDPTTPQTITFTTDEAAPISMTVDYSDCTQYGSDFSVTTNSATGYASAT 285

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
                V  DG V   Y +G R+   ++ +AT P E+ L+   G  ++ T +SG   IG P
Sbjct: 286 QNGVQVDDDGKVYATYSNGERMLQGQVVLATFPDENGLQAVSGTAWVQTGESGTPLIGTP 345

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           G    G + SG LE++NVDI +EL  L+ AQRNY  N+KV  T
Sbjct: 346 GSGSCGTLSSGMLESSNVDITNELVNLMTAQRNYQANTKVIST 388


>gi|115522802|ref|YP_779713.1| flagellar hook protein FlgE [Rhodopseudomonas palustris BisA53]
 gi|115516749|gb|ABJ04733.1| flagellar basal body FlaE domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 421

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 138/439 (31%), Positives = 218/439 (49%), Gaps = 36/439 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV-FPSTSNSYVSGG 59
           M + G++ +A+S +++QS  ++ +SDNIAN  TVGYK T+  F SLV   S+++SY SGG
Sbjct: 1   MSLTGALSSAISALNSQSQSLAMISDNIANSQTVGYKTTSALFDSLVTSSSSASSYSSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN--VNCLTRAGDFHINNEGFLE 117
           + + +K  IS QG L  T S+TD+ I G GFF V    N      TRAG F I++ G++ 
Sbjct: 61  VTVLSKSNISSQGLLTTTTSSTDIGISGNGFFPVSTALNGGSTLYTRAGSFTIDDSGYMV 120

Query: 118 NVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           N +G  LLG+   +A   ++  +  G L  I+   A  S   TT   ++ NL  +A +  
Sbjct: 121 NASGAYLLGWR-TDADGNVVGGTGSGDLVPIDTNIAATSGSATTETTVALNLPADAAV-- 177

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
                         T  SS   YD+LG++    + + KT D  W  S+     +++++  
Sbjct: 178 ------------NDTFTSSMPLYDSLGTANSMQITWEKTADNTWTASVANPTLTSDSTKT 225

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI-DQQITIDISKTTQLAGGFIPQK 295
              A   T+ ++F+      + SS  A S +  T+G  +  IT+D+     + G  + QK
Sbjct: 226 TGTAS-GTITITFNSDGSLKSTSSPTAFSVSGWTTGAANSTITLDLGTIGGIDG--LTQK 282

Query: 296 S-------------EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           S             E +G A GK    +V  DG V+  Y +GT + +Y++ +AT  + D 
Sbjct: 283 SSGSTTPAIDLTSIESDGSAYGKLSSVAVGDDGKVNATYSNGTTISLYKIPVATFAAPDQ 342

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L++     Y  T DSG   +   G N  G I  G LE +  D  +E + +I AQ+ Y+  
Sbjct: 343 LQVKSNGLYAATADSGTAIVQQSGSNGAGTIQGGKLEASTADTNTEFSNMISAQQAYSAA 402

Query: 403 SKVFQTGSDFMDILISLKR 421
           S+V    ++  D LIS  R
Sbjct: 403 SQVITAVNEMFDTLISAVR 421


>gi|320354325|ref|YP_004195664.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
 gi|320122827|gb|ADW18373.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
          Length = 434

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 136/455 (29%), Positives = 223/455 (49%), Gaps = 55/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL----VFPSTSNSYV 56
           MGI  ++ + +SG++  S  +S + +N+AN +T+G+K +   FS L    VF S   S V
Sbjct: 1   MGIQSALYSGVSGLNTNSQAMSVIGNNLANTNTLGFKGSRSIFSDLLSSNVFGSGGTSQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHINNEGF 115
             G+ +S  D I  QG+   T+S+TD+AI+G GFF++K   N     +RAG F  ++EG+
Sbjct: 61  GRGVGLSIVDSIYSQGTFETTSSDTDVAIEGVGFFVLKEAGNDTAYYSRAGAFRFDDEGY 120

Query: 116 LENVAGGVLLGY---PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
           L N  G  + G    P  N++  L+      ++  NV   E  A PT+    + NLD+N+
Sbjct: 121 LVNPEGFRVQGKLFDPTNNST--LLPMDPTDIQVANVGLIE--ANPTSELTFTTNLDENS 176

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD--KKWEVSIFRQDQS 230
           T+I+   TP     +A Y + +S   +D+LG S +  VY+    D    WE + +  D  
Sbjct: 177 TVIS-SATPIDPNNNATYNYSASSQIFDSLGESHLITVYWRLVNDATNTWEAA-YTID-- 232

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFND-------NTSGIDQQITIDISK 283
                  N A   T    FD  T     + ++A+SF++       N  G+    T  +  
Sbjct: 233 -------NDAATITAITDFDAST-----AGNQAMSFDNIGKAPDTNGDGVPDPFTTTVGP 280

Query: 284 TTQLAGGF-----------------IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
            T   G                   I    + NG+A G+  + S++ +G V   Y +G +
Sbjct: 281 ITWANGAATSTIELSFDCTQYDSDSIVIGQQQNGYAAGELTNVSINSEGVVVASYSNGRQ 340

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
           + I +L +A   +   LKL   N Y+   ++G I +G PG  + G++F+ +LE +NVD+ 
Sbjct: 341 INISQLVLAKFQNPGGLKLAGANRYIAPAEAGTIRVGLPGP-ELGKLFTNSLEQSNVDMG 399

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            E  ++I  QR +  NSK+  T  + +  LI+LKR
Sbjct: 400 QEFVKMITTQRGFQANSKIITTVDEMLSELINLKR 434


>gi|192289142|ref|YP_001989747.1| flagellar hook protein FlgE [Rhodopseudomonas palustris TIE-1]
 gi|192282891|gb|ACE99271.1| flagellar basal body FlaE domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 421

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 142/439 (32%), Positives = 217/439 (49%), Gaps = 36/439 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVS-GG 59
           M + G++ +A+S ++AQS  +S +SDNIAN DT GYK T+  FS LV  S+S +  + GG
Sbjct: 1   MSLTGALSSAISALNAQSQSLSMISDNIANSDTTGYKTTSAMFSQLVTASSSATSYASGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN--VNCLTRAGDFHINNEGFLE 117
           + ++ +  IS+QG L  T++ TD+AIQG GFF+V  + +      TR G F I+N G+L 
Sbjct: 61  VTVAGRANISQQGLLAATSNATDVAIQGSGFFVVSDQTSGGTTSYTRNGAFSIDNAGYLV 120

Query: 118 NVAGGVLLGYPLKNASAPLIVN-SFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           N +G  L G+   +A   ++ + S   L  IN   A  S   TT    + NL  +A    
Sbjct: 121 N-SGYYLEGWR-TDADGKIVGDASSATLSPINTNVAATSGSATTKTTFAANLPADAAT-- 176

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
                         T+ SS   YD+LG++    V + KT    W  S F     ++++  
Sbjct: 177 ------------GATYSSSMTVYDSLGTANSIQVTWIKTASNAWTAS-FANPTLSSSTST 223

Query: 237 YNVAPLNTVEVSFDPVTGYLA--NSSHKAISFNDNTSGI-DQQITID---ISKT---TQL 287
                  +V ++F+   G LA  N S   IS +  T+G  +  I++D   + KT   TQ 
Sbjct: 224 TTGTTSGSVSLTFNS-DGSLASTNPSPPTISVSGWTNGAANSTISLDLGTVGKTNGLTQY 282

Query: 288 AGGFIPQKSEI-----NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           A G       +     +G   GK    +V  DG V+  Y +G  + IY++A+AT    D 
Sbjct: 283 ASGEATPTINVTSISSDGLPYGKLSSIAVGDDGTVNATYSNGQTIAIYKIAVATFKDPDG 342

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L +     Y  T  SGD S+   G N  G+I+   LE++  D +S+   +I AQ+ Y+  
Sbjct: 343 LSVNSYGIYSVTAASGDASVQTSGSNGAGKIYGSELESSTTDTSSQFASMISAQQAYSAA 402

Query: 403 SKVFQTGSDFMDILISLKR 421
           S+V  T +   D LIS  R
Sbjct: 403 SQVITTVNKMFDTLISAMR 421


>gi|315497625|ref|YP_004086429.1| fagellar hook-basal body protein [Asticcacaulis excentricus CB 48]
 gi|315415637|gb|ADU12278.1| fagellar hook-basal body protein [Asticcacaulis excentricus CB 48]
          Length = 472

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 138/474 (29%), Positives = 219/474 (46%), Gaps = 55/474 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-TSNSYVSGG 59
           M +  SM+  ++G+ A SN +SA+S+NIAN  T  YKR    F S+V  S T   Y +GG
Sbjct: 1   MSLSASMQAGVAGLAANSNALSAISNNIANSTTTAYKRVRTDFQSIVTASSTPTGYNAGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK-----GRDNVNCLTRAGDFHINNEG 114
           +  +T+ MIS  G+L   +S  DL I G+GFFI       G ++    TR G F  + +G
Sbjct: 61  VISTTRHMISTLGTLQKASSQLDLGIDGQGFFITTQKSEPGAEDARLFTRDGSFFADEDG 120

Query: 115 FLENVAGGVLLGYPLKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT 173
           +L N +   L G+P+     P L       L  INV++      PTT   I  NL+ N T
Sbjct: 121 YLRNASNLYLQGWPITAGGGPTLSAADLSQLRTINVENIAAQIEPTTFAEIVGNLNANQT 180

Query: 174 IITPDKTPKHNGRDAEYTHKS-SFAAYDTLGSS-----VVYDVYYTKTGDKKWEVSIFR- 226
           I   D+  ++          +   +A DT  S+     +   V  ++ G+++  VS+ + 
Sbjct: 181 I--SDRADEYAASPTTLPMATYDASAPDTTTSTRPDYEITIPVSDSQGGERRLTVSMIKL 238

Query: 227 -QDQSTN-----NSFPYNVAPLNTVEVSFDPVT----------GYLA-NSSHKAISFNDN 269
             D +       N++ Y V   +  + +  P T          G+L  NS+ K     D+
Sbjct: 239 AADPTATPPIAANTWAYEVWSPDVKDSTISPATEASTNGIVSRGHLVYNSAGKLTDIVDS 298

Query: 270 TSGIDQQITIDISKTTQLAGGFIPQ--KSEINGH----------------APGKP----K 307
           T       ++++S     A G   Q  + E NG                 A G P     
Sbjct: 299 TGTSTGATSLNLSFNWNSAIGVAAQTVQVEFNGDQGGLTQLNSASTNRVDADGTPFSGLD 358

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
              +SK+G V  ++ +G+   I +LA+AT  + D L    GN Y  + DSG +++  PG 
Sbjct: 359 KVQISKEGLVTAVFKNGSTRDIAQLALATFVNADGLTPVSGNAYTVSNDSGPLTLKVPGV 418

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +  G +  G LE ++VD++ E T LI  QR Y+ NS+   T  + +  L+++KR
Sbjct: 419 SGAGLLGVGTLEASDVDLSEEFTNLIVTQRAYSANSRTITTADEMLQELLNIKR 472


>gi|126738557|ref|ZP_01754262.1| flagellar hook protein FlgE, putative [Roseobacter sp. SK209-2-6]
 gi|126720356|gb|EBA17062.1| flagellar hook protein FlgE, putative [Roseobacter sp. SK209-2-6]
          Length = 446

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 134/452 (29%), Positives = 206/452 (45%), Gaps = 50/452 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  ++   +SG+ A ++ ++A+SDNIAN  T GYKR    F S+V  S   SY +GG+
Sbjct: 14  MTISSALNAGVSGLSANASSLAAISDNIANSSTRGYKRIQTDFQSMVVGSKGGSYTAGGV 73

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
                 ++ E+G L+ T + TDLA+ G+G   V     V          LT  G F  N 
Sbjct: 74  GFDKLRLVDERGPLVGTNNATDLAVSGRGMLPVAALSEVESGNGNPTMMLTTTGSFRTNA 133

Query: 113 EGFLENVAGGVLLGYPLKNASAPL---IVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           +G+L   +G VL+G+P  NA+  +     ++ +GLE I     +L+  PTT   +  NL 
Sbjct: 134 DGYLTTASGLVLMGWP-ANANGTVDDGPRDTAEGLEPIQYNMNQLTGEPTTEVTLGVNLP 192

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSI 224
              T           G D + T   +   YD LGSS    V +T T        +W + I
Sbjct: 193 ATET---------EAGGDGD-TETLTVEYYDNLGSSQTLTVSFTPTVPATGSSNEWTMQI 242

Query: 225 FRQDQSTNNSFPYNVAPLNTVEVSFD-------------PVTG--YLANSSHKAISFNDN 269
              D ++        A +    ++FD              VTG  Y A +    I+ +  
Sbjct: 243 --SDSASGG------AVIGEYTLTFDDSRTAGGSLASVTAVTGGAYDATTGKVMINVDGG 294

Query: 270 TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
              I   +  +    TQL+  F P     +G   G      V   GYV   YD G    I
Sbjct: 295 PMEIGLGLIGESDGLTQLSDTFAPASITKDGSEVGTMVGVEVDAQGYVRANYDSGASKVI 354

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASEL 389
           Y++ +A + + + LK  D  TYLP+  SG   +   G    GE+ S ++E +  D+A+EL
Sbjct: 355 YKVPLADMANPNGLKALDKQTYLPSSQSGSYFLWDAGDGPTGEVASYSMEESATDVATEL 414

Query: 390 TELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           T++I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 415 TDMIKTQRAYSSNAKVIQTVDEMLQETTNIKR 446


>gi|163793271|ref|ZP_02187246.1| flagellar basal body FlaE domain protein [alpha proteobacterium
           BAL199]
 gi|159181073|gb|EDP65588.1| flagellar basal body FlaE domain protein [alpha proteobacterium
           BAL199]
          Length = 433

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 137/454 (30%), Positives = 211/454 (46%), Gaps = 54/454 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-YVSGG 59
           M I G M + +S + AQS     +SDNIANV+T+GYK T   F +LV  S+S+S Y  GG
Sbjct: 1   MSIYGGMFSGVSALAAQSQAFGIISDNIANVNTIGYKDTTARFQTLVTESSSSSRYSPGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN------VNCLTRAGDFHINNE 113
           +         +QG L  T SNTD+++ G GFFIV   D+         LTRAG F  + E
Sbjct: 61  VLARPFVNPEKQGLLQGTTSNTDISLVGDGFFIVNENDDPLTSGGEYLLTRAGSFTEDEE 120

Query: 114 GFLENVAGGVLLGYPLKNASAPLIVNS-----FQGLERINVKHAELSAMPTTTGFISNNL 168
           G L N AG  L G+  +  S   IVNS        LE +N+      + P++T  ++ NL
Sbjct: 121 GNLVNAAGFFLQGW--RTDSTGTIVNSNTKDQLSSLETVNLAGFTSVSNPSSTANLAVNL 178

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQ 227
             NAT  +              T  ++   +D+LG   +  + +TK     +W  S+   
Sbjct: 179 PANATTAS--------------TQTTNLTIFDSLGVEHLMTINWTKNAQANEWAYSLDVT 224

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI-------- 279
           +Q+   +     A +    + FDP  G + +  +     + +T+     IT         
Sbjct: 225 NQAGTTT-----AAIVAGTIDFDPADGTIEDIDNGGTLVDGDTAQTTLPITALAFGSGAA 279

Query: 280 ------------DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
                         +  +QL+G +       NG +P       +  +G V   + +G   
Sbjct: 280 ASSIVINWGTVGQTNGMSQLSGSYEATLLNQNGSSPSALTAVEIDNEGVVTARFKNGDTR 339

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
           PIY++AI TVP+   L+  +GN Y  +  SGD+ +   G    G I S ALE + VD++ 
Sbjct: 340 PIYKIAIGTVPAATELRSENGNAYKLSSRSGDLLLTEAGLQGAGAIESSALEQSTVDLSD 399

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E T+LI  QR Y+  +K+  TG + +D +I +KR
Sbjct: 400 EFTDLIITQRAYSAATKLITTGDELLDEIIRVKR 433


>gi|39933722|ref|NP_945998.1| flagellar hook protein FlgE [Rhodopseudomonas palustris CGA009]
 gi|39647569|emb|CAE26089.1| possible flagellar hook protein FlgE [Rhodopseudomonas palustris
           CGA009]
          Length = 421

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 142/439 (32%), Positives = 217/439 (49%), Gaps = 36/439 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVS-GG 59
           M + G++ +A+S ++AQS  +S +SDNIAN DT GYK T+  FS LV  S+S +  + GG
Sbjct: 1   MSLTGALSSAISALNAQSQSLSMISDNIANSDTTGYKTTSAMFSQLVTASSSATSYASGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN--VNCLTRAGDFHINNEGFLE 117
           + ++ +  IS+QG L  T++ TD+AIQG GFF+V  + +      TR G F I+N G+L 
Sbjct: 61  VTVAGRANISQQGLLAATSNATDVAIQGSGFFVVSDQTSGGTTSYTRNGAFSIDNAGYLV 120

Query: 118 NVAGGVLLGYPLKNASAPLIVN-SFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           N +G  L G+   +A   ++ + S   L  IN   A  S   TT    + NL  +A    
Sbjct: 121 N-SGYYLEGWR-TDADGKIVGDASSATLSPINTNVAATSGSATTKTTFAANLPADAAT-- 176

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
                         T+ SS   YD+LG++    V + KT    W  S F     ++++  
Sbjct: 177 ------------GATYSSSMTVYDSLGTANSIQVTWIKTASNAWTAS-FANPTLSSSTST 223

Query: 237 YNVAPLNTVEVSFDPVTGYLA--NSSHKAISFNDNTSGI-DQQITID---ISKT---TQL 287
                  +V ++F+   G LA  N S   IS +  T+G  +  I++D   + KT   TQ 
Sbjct: 224 TTGTTSGSVSLTFNN-DGSLASTNPSPPTISVSGWTNGAANSTISLDLGTVGKTNGLTQY 282

Query: 288 AGGFIPQKSEI-----NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           A G       +     +G   GK    +V  DG V+  Y +G  + IY++A+AT    D 
Sbjct: 283 ASGEATPTINVTSISSDGLPYGKLSSIAVGDDGTVNATYSNGQTIAIYKIAVATFKDPDG 342

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L +     Y  T  SGD S+   G N  G+I+   LE++  D +S+   +I AQ+ Y+  
Sbjct: 343 LSVNSYGIYSVTAASGDASVQTSGSNGAGKIYGSELESSTTDTSSQFASMISAQQAYSAA 402

Query: 403 SKVFQTGSDFMDILISLKR 421
           S+V  T +   D LIS  R
Sbjct: 403 SQVITTVNKMFDTLISAMR 421


>gi|296283217|ref|ZP_06861215.1| flagellar hook protein FlgE [Citromicrobium bathyomarinum JL354]
          Length = 412

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 132/421 (31%), Positives = 193/421 (45%), Gaps = 29/421 (6%)

Query: 21  VSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGGLEISTKDMISEQGSLMHTAS 79
           ++ V+DNI N++TVGYK     F +LV      +SY +GG+  + + MIS+QG L   +S
Sbjct: 1   MATVADNITNINTVGYKGAEADFRTLVTDGRLKSSYSAGGVAAAPRAMISKQGLLQAASS 60

Query: 80  NTDLAIQGKGFFIVK---GRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPL 136
            TDL I G GFF+ +   G D+    TRAG F  + +G+L N  G  L G+ L       
Sbjct: 61  QTDLGIDGGGFFVTRTGSGADSGIAFTRAGAFRPDEQGYLRNTGGYFLQGWRLDTTGGYT 120

Query: 137 IVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKS-S 195
                  LE + +     +A  TT      NL       T           A   H S +
Sbjct: 121 STGGVSELEPVRLSGLTGTATATTRLTARINLQSTQEPFTGAYAAGDMATGALEPHFSRT 180

Query: 196 FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV----EVSFDP 251
           F  +D  G      + + KTG  +W   I+          P +V   N +     V+F+P
Sbjct: 181 FEIFDAQGGGHQVTMGFVKTGPNQWVSEIYGD--------PADVTAANGLLASGNVAFNP 232

Query: 252 VTGY-LANSSHKAISFNDNTSGIDQQ----ITIDISKT------TQLAGGFIPQKSEING 300
                LANSS  A+    N S  +Q     I +++         TQ         S  +G
Sbjct: 233 DGSLDLANSS-PALFGTLNVSWANQAGSSPINLNLGSQDGLDGLTQFGSSSALIASSTDG 291

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
                     VSKDG V  ++DDGT  P+++L +AT  + D L    GN Y  ++ SG++
Sbjct: 292 GMLNNLVSVEVSKDGIVSAVFDDGTSRPVFQLPMATFANPDGLSRLPGNAYTVSQQSGNV 351

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +IG PG    G I +G LE +NVD+A E T +I  QR Y+ +SK+  T  D +  + +LK
Sbjct: 352 AIGRPGELGSGTISAGTLEASNVDLAQEFTNMIRFQRAYSASSKIITTVDDMLQEVSALK 411

Query: 421 R 421
           R
Sbjct: 412 R 412


>gi|197104253|ref|YP_002129630.1| flagellar hook protein FlgE [Phenylobacterium zucineum HLK1]
 gi|196477673|gb|ACG77201.1| flagellar hook protein FlgE [Phenylobacterium zucineum HLK1]
          Length = 452

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 130/462 (28%), Positives = 228/462 (49%), Gaps = 57/462 (12%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP-STSNSYVSGGLEISTK 65
           M   +SG+ A S+ ++A+SDNIANV+TV YKR  + F+++V   +    Y +GG++  T+
Sbjct: 1   MLAGVSGLVANSSALAAISDNIANVNTVAYKRNQVNFANVVTAQAVKGKYSAGGVQSVTR 60

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRD------NVNCLTRAGDFHINNEGFLENV 119
             +S+QG +  + S TDLAI G GFF+V  +       +    TR+G F ++++G++ N 
Sbjct: 61  QFVSQQGLIQASNSTTDLAISGDGFFVVANKGLGLTGADPRSFTRSGAFAVDSDGYMVND 120

Query: 120 AGGVLLGYPLKNASAPLIVN--SFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP 177
           AG  L G+P++ A     VN      ++ INVK+   +  PTT   ++ N++K+  +   
Sbjct: 121 AGLYLQGWPVQ-ADGTFNVNPSDLSLMQSINVKNLGSAVAPTTELGVTANVNKDGPVSAS 179

Query: 178 DKTPKHNGRDAEYTHKSSFAAY-DTLGSSVV-------YDVYYTKTGDKKWEVSIFRQDQ 229
           + T  ++G  A     +S A Y D+ G++ V        +V  +  G +K  +++ + D 
Sbjct: 180 EAT--YDGSVA----ATSMAEYADSAGATGVKPDFVIEMNVVDSAGGSRKIALAMLKDDV 233

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDN-------TSGIDQQITIDIS 282
           +          P ++V+++     G LA  +   I+FN +       T+   Q +++D S
Sbjct: 234 ANAWHAEIYAVPASSVDLAAGTPPGQLARGT---INFNADGTINLGTTTAALQSLSLDAS 290

Query: 283 K--TTQLAGGFIPQKSEIN---------------------GHAPGKPKDFSVSKDGYVDI 319
              T + A G      +IN                     G   G      V  +G V  
Sbjct: 291 AGATPRWATGLGLAAQDINLALDKLSQYSSTSTVTAIQSNGAGVGNVIAIDVDPEGVVSA 350

Query: 320 IYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALE 379
           +YD+     I ++ +AT P+ D L    GN Y PT  +G++++   G    G+I   +LE
Sbjct: 351 VYDNSQIRKIAKIGVATFPNPDALAAVSGNAYRPTIPAGEMTVKEAGIGGAGKISPSSLE 410

Query: 380 TANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            + VD+++E T LI  Q+ Y+ +SK+  T    ++ LI++KR
Sbjct: 411 ASTVDLSAEFTGLIATQKAYSASSKIITTADQMLEELINIKR 452


>gi|110677963|ref|YP_680970.1| flagellar hook protein FlgE, putative [Roseobacter denitrificans
           OCh 114]
 gi|109454079|gb|ABG30284.1| flagellar hook protein FlgE, putative [Roseobacter denitrificans
           OCh 114]
          Length = 436

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 130/454 (28%), Positives = 210/454 (46%), Gaps = 51/454 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+   S R++++SDNIAN  T GYKR    F S+V  S   +Y +GG+
Sbjct: 1   MSISSSLNAGVAGLQTNSQRLASISDNIANSSTFGYKRVQTDFESMVLSSGGGAYAAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK--------GRDNVNCLTRAGDFHINN 112
             +T+ +I E+G+L+ T+++TDLA++G G   V         G D    LT  G F  + 
Sbjct: 61  RANTQRLIDERGTLVSTSNSTDLAVRGGGMLPVAQAAQVQTAGTDAPMFLTTTGSFRPDA 120

Query: 113 EGFLENVAGGVLLGYPLK-NASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G+L + +G VL+G+P   + S P+   ++  GLE I +   +L+  PTT+  +  NL  
Sbjct: 121 DGYLTSQSGLVLMGWPAAADGSIPVYPRDTADGLEPIRIATGQLAGNPTTSMSLGINLPA 180

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-------TGDKKWEVS 223
             T              A    + S   +D LG+S    + +T             W + 
Sbjct: 181 TET----------EADSAGLVEQISVEYFDNLGTSQSVSITFTPDVPAPGNPATNTWTME 230

Query: 224 IFRQ---------------DQSTNNSFPYNVAPLNTVEVSFDPVTGYLA-NSSHKAISFN 267
           +F                 D  T     ++V P+     ++   TG +  N +   I  +
Sbjct: 231 MFDSVNPAVSIGSYTLEFNDSRTGGGTLFDVTPIG-ASPAYSDTTGLITINVAAGPIEVD 289

Query: 268 DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
               G       D    +QL+  F P     +G A G      V  +G+V   +D G   
Sbjct: 290 IGALG-------DTEGLSQLSYSFAPISVTKDGSAIGNFVGVDVDPNGFVRASFDTGEIR 342

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
            IY++ +  VP+ + L+ FD  TYLP+R SG   +   G    G+I S A E +  D+A 
Sbjct: 343 TIYQIPLINVPNPNGLQAFDSQTYLPSRQSGAFFLWNAGDGPTGDIVSFAREESTTDVAG 402

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ELT++I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 403 ELTDMIKTQRAYSSNAKVIQTVDEMLQETTNIKR 436


>gi|114799551|ref|YP_758981.1| flagellar hook protein FlgE [Hyphomonas neptunium ATCC 15444]
 gi|114739725|gb|ABI77850.1| flagellar hook protein FlgE [Hyphomonas neptunium ATCC 15444]
          Length = 434

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 130/455 (28%), Positives = 208/455 (45%), Gaps = 55/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   + G+     R++ +SDNIAN  T GYKR+A+ FSS+V    +++Y +GG+
Sbjct: 1   MSISSSLNAGVMGLSVNGTRLATISDNIANSGTYGYKRSAVDFSSMVLQQKTSAYAAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN--------CLTRAGDFHINN 112
            + T   I+  GSL+ T S TD+AI G+G   V   D            LT  G F  + 
Sbjct: 61  RVDTYKDIAATGSLIRTGSATDVAISGRGLLPVTDLDGTTNLASNRNMMLTPTGSFFADE 120

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIV--NSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
            G+L   +G  LLG+   ++     V  NS   L  +N+  ++ +A PT++  +  N+  
Sbjct: 121 NGYLRTQSGLFLLGWAADSSGGVGNVSRNSGANLVPVNISTSQFNATPTSSIDLGINIPA 180

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIF 225
           +AT       P       EY        +D LG +      +T T        +W V IF
Sbjct: 181 DATTAGGPGDPYM--LPVEY--------FDNLGRAQTVTFQFTPTVPAAGSSNEWNVEIF 230

Query: 226 RQ--DQST---NNSFPYNVAPLNTVEVS---------FDPVTGYLANSSHKA-----ISF 266
               D  T   + +  +N +P     ++         +DP TG ++ +         I  
Sbjct: 231 DSAGDPLTSVGDLALTFNDSPTAGGRIASATAANGATYDPATGRVSLTLDHGPVEVFIGR 290

Query: 267 NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
            ++++GI           TQLA  F P     NG   G  +   + + G++  IYD G R
Sbjct: 291 PNDSAGI-----------TQLAASFAPTAVTKNGSPIGDLQSIEIDEQGFLQAIYDKGFR 339

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             +Y++ +  VP+ + L+  D   Y  +  SG++ +   G    G I   +L  +  DIA
Sbjct: 340 RTLYQIPVGDVPNMNGLRALDSQAYSVSNSSGNLYLWDAGSGPVGGISGYSLMESTTDIA 399

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           SELT+LIE QR Y+ N+K+ QT  + +    +LKR
Sbjct: 400 SELTDLIETQRAYSSNAKIVQTVDEMLQETTNLKR 434


>gi|254475161|ref|ZP_05088547.1| flagellar hook protein FlgE [Ruegeria sp. R11]
 gi|214029404|gb|EEB70239.1| flagellar hook protein FlgE [Ruegeria sp. R11]
          Length = 441

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 126/453 (27%), Positives = 206/453 (45%), Gaps = 51/453 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   +SG+ A ++R++++SDNIAN  T GYKR    F S+V  S+  +Y +GG+
Sbjct: 8   MTISSSLNAGVSGLTANASRLASISDNIANSSTAGYKRVQTDFHSMVMGSSGGTYSAGGV 67

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
             +   +I E+G L+ T + TDLA++G+G   V     V          LT    F  N 
Sbjct: 68  RTTNVRLIDERGPLVSTNNATDLAVRGRGMLPVTSMTEVEVGASNPQMMLTTTASFRTNA 127

Query: 113 EGFLENVAGGVLLGYPLKNASA--PLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VL+G+P ++     P   ++  GLE +     +LS  PTT   +  NL  
Sbjct: 128 DGLLATESGLVLMGWPAQSDGTIPPYARDTSDGLEPVRFNVNKLSGEPTTEMSLGVNLPA 187

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT----KTGDK-KWEVSI- 224
            AT          +G  A  +   S   YD LG S    + +      TG+  +W + I 
Sbjct: 188 TAT---------ESGA-AGTSENLSIEYYDNLGKSESLQIEFVPTVPATGESNEWTMIIT 237

Query: 225 ---------------FRQDQSTNNSFPYNVAPLNTVEVSFDPVTG-YLANSSHKAISFND 268
                          F  ++++  +   N   L +   ++DP TG  + N +   +  N 
Sbjct: 238 DTATGATPIGEYTLTFDDNRTSGGAL--NAVTLGSAGGAYDPATGSIIVNVAGGPMEINI 295

Query: 269 NTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVP 328
              G D  +T       QL+  F P     +G   G      + + G+V   YD G    
Sbjct: 296 GMIGDDNGLT-------QLSDTFAPASISKDGAPVGNFTGVEIDEAGFVRANYDTGVSRV 348

Query: 329 IYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASE 388
           +Y++ +  +P+ + +   D  TY+P+ +SG   +   G    G+I   A E +  D+A E
Sbjct: 349 VYQVPLVDLPNPNGMIAMDRQTYMPSSESGSYFLWNAGEGPTGDILGYAREESATDVAGE 408

Query: 389 LTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           LT +I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 409 LTNMIQTQRAYSSNAKVIQTVDEMLQETTNIKR 441


>gi|77918787|ref|YP_356602.1| flagellar biosynthesis, hook protein [Pelobacter carbinolicus DSM
           2380]
 gi|77544870|gb|ABA88432.1| flagellar biosynthesis, hook protein [Pelobacter carbinolicus DSM
           2380]
          Length = 413

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 127/428 (29%), Positives = 204/428 (47%), Gaps = 22/428 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YV 56
           M +  ++ + +SGM+     +S + +NIAN +TVG+K +   FS L+  S + S     V
Sbjct: 1   MALSSALYSGISGMNTNGTAMSVIGNNIANTNTVGFKSSRTVFSDLLASSVNGSGGASQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEG 114
             G  +ST D +  QG+   T S TDLAI+G+G F+V+  +    L  TRAG F  + EG
Sbjct: 61  GRGTGLSTVDNLFSQGTFETTESQTDLAIEGEGLFVVR-EEGAESLYYTRAGSFSFDGEG 119

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
           FL N  G  + G    N     +++S    + +   +A + A  T    +S NLD N  +
Sbjct: 120 FLTNAEGYRVQGKTYVNG----VLSSADATDIMVDINAGIEAKMTDKITLSTNLDANEPV 175

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
           IT    P        Y + +S   YD+LG++ +   Y+ K+ D  W+ ++  ++ +T   
Sbjct: 176 ITAAFDPNDT---TTYNYSNSTTIYDSLGNTHLMTTYFIKSDDNTWDWNVVDENDAT--- 229

Query: 235 FPYNVAPL-NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
             Y+ A   N++E  FD     ++  +              Q I   +  TTQ A     
Sbjct: 230 -LYSSATAGNSLE--FDTSGKQISGGTATLGPLTPGAGTASQTINFALKNTTQFANDSQV 286

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                NG+  G   + S+  +G V   Y +G  +   R+ +A   S   L+    + +  
Sbjct: 287 ISQTQNGYGAGNLTNISIDNEGNVLAKYSNGEEIAKSRIVLAKFSSFSGLRKEGASLFSA 346

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T +SG   IG PG  + G IF+ ALE + VD+A+E  ++I  QR +  NSKV  T  + +
Sbjct: 347 TGESGPPRIGVPG-TELGNIFTNALEQSTVDLAAEFVKMITTQRGFQANSKVITTTDEML 405

Query: 414 DILISLKR 421
             LI+LKR
Sbjct: 406 SELINLKR 413


>gi|84502376|ref|ZP_01000512.1| flagellar hook protein FlgE, putative [Oceanicola batsensis
           HTCC2597]
 gi|84389188|gb|EAQ01985.1| flagellar hook protein FlgE, putative [Oceanicola batsensis
           HTCC2597]
          Length = 422

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 123/438 (28%), Positives = 208/438 (47%), Gaps = 49/438 (11%)

Query: 16  AQSNRVSAVSDNIANVDTVGYKRT--AIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGS 73
           A S  V+ +S NIAN DT G++R+   +  S    P+ + S  + G+        ++ G+
Sbjct: 2   ANSKAVARISYNIANSDTYGFRRSFAQMLTSGATIPTGTVS--ASGVRAEVVHQNTQDGT 59

Query: 74  LMHTASNTDLAIQGKGFFIVKGRDNVN--------CLTRAGDFHINNEGFLENVAGGVLL 125
            + T + T+LAI G GFF V    N+N         +TRAGDF  ++EG+L N +G  L 
Sbjct: 60  PLTTGAATNLAISGNGFFAVT--RNINEGTGEPEHFMTRAGDFQPDSEGYLRNASGMYLA 117

Query: 126 GYPLKNASAPLIV--NSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           G+P   + +  ++  N F GL+ + +    ++  PT+   ++ NL    T +     P  
Sbjct: 118 GFPYDESGSLGVIDRNQFSGLQTVRIAEMSIAGNPTSEMTLTGNLPSQETGLATPGDP-- 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIFRQDQSTNNSFPY---NV 239
                     SS   +  LG++      +  +    +W++ +     ++  S      + 
Sbjct: 176 --------FISSIEYFTPLGAAERLQFSWQPSSTANEWQLEVTDSSGASYGSLTATFNDS 227

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI----------DQQITIDISKT----- 284
            PL      F  VT     ++  A SF D ++G+           Q IT+D+        
Sbjct: 228 GPLAGTPSGFSAVTS--TATAPAAFSF-DTSTGVATVTVNNGTTPQTITVDMGAPNTFGG 284

Query: 285 -TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            +Q +G ++P     +G   G      +S DG V  I+D+G R  +Y++ +ATVP+ + L
Sbjct: 285 LSQFSGDYVPLVGNADGTQSGSLARAEISNDGVVYGIFDNGMRRALYQIPLATVPNPNGL 344

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
              D  T+L +  SG  ++   G    GEI  G++E++NVDIA ELTELI+ QR ++ N+
Sbjct: 345 MTADNATFLVSEASGSFTLSMAGSGTAGEITGGSVESSNVDIAEELTELIQKQRAFSSNA 404

Query: 404 KVFQTGSDFMDILISLKR 421
           K+  T  + +D  + LKR
Sbjct: 405 KIITTADEMLDETVRLKR 422


>gi|262273529|ref|ZP_06051343.1| flagellar hook protein FlgE [Grimontia hollisae CIP 101886]
 gi|262222507|gb|EEY73818.1| flagellar hook protein FlgE [Grimontia hollisae CIP 101886]
          Length = 401

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 115/412 (27%), Positives = 194/412 (47%), Gaps = 15/412 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S+   +SG+ A S++++ +S NI+NV TVGYK +   F  +  P        G    + +
Sbjct: 2   SINIGLSGLRATSDQINTISHNISNVGTVGYKSSRTEFQDVYAPQFGGGEFGGVEVSNVR 61

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
              +  G+   T  N+DLAI G+GFF+V+ ++     TR G F+++++G+L    G  L 
Sbjct: 62  QSFTS-GAATSTGRNSDLAINGEGFFMVQ-QNGQRMYTRNGIFNLDSDGYLVTADGLRLQ 119

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY +    +  I N    L  + +  A+++A  TT   +  NLD +A +I P +      
Sbjct: 120 GYGVSETGS--IQNG--ALTDLQISTADMAAKVTTKVSLGVNLDASAAVIVPKEKKFDKD 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
             + +T  +S   YD+LG       Y+ KT +  W V      +  +        P NT 
Sbjct: 176 DPSTFTCSASTTVYDSLGGEHEITQYFVKTDENTWSVHYVADGKELD--------PKNT- 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ FD     +      +++          +I +D+S+ TQ    F   +S+ +G+APGK
Sbjct: 227 QLEFDENGKLIKPEDPISVTLTPKNGSATMKIEMDVSEFTQFGSDFSINESKQDGYAPGK 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              +    DG V   Y +G      +L +A  P+++ L+   G  +  +  SG    G P
Sbjct: 287 LAGWYFDADGSVYARYSNGKTQLQGQLVLARFPNQEGLQQAGGTRWTESFSSGTALFGQP 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G  Q G +  GA E++NVD+  E+  L+ AQ NY  N+K  Q   + + IL 
Sbjct: 347 GTGQFGALRVGAYESSNVDLTEEMVSLMSAQSNYQANAKTIQASQEMVQILF 398


>gi|114569239|ref|YP_755919.1| hypothetical protein Mmar10_0688 [Maricaulis maris MCS10]
 gi|114339701|gb|ABI64981.1| protein of unknown function DUF1078 domain protein [Maricaulis
           maris MCS10]
          Length = 461

 Score =  159 bits (402), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 132/462 (28%), Positives = 215/462 (46%), Gaps = 42/462 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV-FPSTSNSYVSGG 59
           M I  ++    SG+ + SN ++++SDNIANV+TVGYKR +  F+ L    S++  Y + G
Sbjct: 1   MSINSALLAGASGLISNSNALASISDNIANVNTVGYKRASAVFTPLYDSDSSTKGYSAAG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-----CLTRAGDFHINNEG 114
           +    +  I E G L   +S TDLAI G+GFF+V+   NVN       TRAG F  +  G
Sbjct: 61  VNSVARLAIGESGLLTAGSSPTDLAISGRGFFVVRDDANVNSSDPVSFTRAGRFTPDTNG 120

Query: 115 FLENVAGGVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT 173
           +L N AG  L G+P+  + S P   +    LE IN+     +A  TT   I+ NL ++  
Sbjct: 121 YLRNDAGKYLSGWPVAADGSVPQNPSDLNALETINLSSIGGAAEATTIMGINANLQQSQA 180

Query: 174 IITPDKTPKHNGRDAEYTH-------KSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSI- 224
           I   + T          +        + S   YD++G      +   K+    +W   + 
Sbjct: 181 ISADEATYDATASATNMSSGTVTPDFQRSIPFYDSVGGVRTLTISMLKSSTPNQWHAEVH 240

Query: 225 ------------FRQDQSTNNSFPYNV-APLNTVEVSFDPVTGYLANSSHKAISFND--- 268
                           Q    +  ++    +++   +      +L++++  A+   +   
Sbjct: 241 MVPATDLTTGAGLVDGQMLTGTVAFDAQGRIDSANTTLPTQLDFLSSTNAAALGATEFQW 300

Query: 269 -NTSGID-QQITIDISKTTQLAGGFIPQKS-------EINGHAPGKPKDFSVSKDGYVDI 319
              +GID Q I +D   +    GGF    S        +NG A G      V  DG+V  
Sbjct: 301 AAATGIDAQSIALDFG-SPNAPGGFTQYDSPSALLSTNVNGSAFGNFSSVDVDDDGFVFA 359

Query: 320 IYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALE 379
            +++G    IY++ +AT  + D L+   G T+  T +SG  ++  PG    G+I +  LE
Sbjct: 360 KFNNGIVRKIYQIPVATFVNPDGLEAQSGGTFTVTPESGAYTLNPPGLGSSGQIAASTLE 419

Query: 380 TANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ++NVD+A+E T LI  QR Y+ +SK+  T  + +D  I +KR
Sbjct: 420 SSNVDLANEFTSLITTQRAYSASSKIITTADEMLDEAIRMKR 461


>gi|89067517|ref|ZP_01155030.1| flagellar hook protein FlgE, putative [Oceanicola granulosus
           HTCC2516]
 gi|89047086|gb|EAR53140.1| flagellar hook protein FlgE, putative [Oceanicola granulosus
           HTCC2516]
          Length = 433

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 119/451 (26%), Positives = 217/451 (48%), Gaps = 48/451 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+  +++G+ A ++R++ ++DNIAN  T GYKR    F S+V  +T  +Y +GG+
Sbjct: 1   MTISSSLNASVAGLTANASRLATIADNIANSSTFGYKRATTDFHSMVLNTTEGTYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK-----GRDNVN---CLTRAGDFHINN 112
            ++T+ +I ++GS++ T + TDLA++G+G   V      G  N +    LT  G F +++
Sbjct: 61  RVTTQRLIDQRGSIVSTDNVTDLAVRGRGMMPVSTEAALGTGNASSQFLLTSTGSFRVDD 120

Query: 113 EGFLENVAGGVLLGYPLK-NASAPLI-VNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G+L + +G +L+G+P   + + P    ++  GL+ I +   + +   TT   +  NL  
Sbjct: 121 QGYLASQSGLILMGWPAGIDGNVPAFPRDTADGLQPIRINANQSAGEATTYIDVGLNLPA 180

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKW----- 220
            +T  +    P+          + + A YD LG+S    + +T T        +W     
Sbjct: 181 TSTEFSSTGEPE----------ELTVAYYDNLGTSETLSITFTPTVPAAGSSNEWTMQIT 230

Query: 221 ----------EVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT 270
                     E ++   D         ++ P++    ++DPVTG +       ++     
Sbjct: 231 DSASAGAVVGEYTLVFDDTRGAGGTLASITPVS--GGAYDPVTGRVT------VNVEGGP 282

Query: 271 SGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
             +   +  +    TQL+  F P     +G+A G      +  +G++   +D G    IY
Sbjct: 283 LEVGLGLLGEPGGLTQLSDNFAPVSILKDGNAVGSMTSIDIDANGFMRAAFDTGISKVIY 342

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           ++ +  V + + L+  D  TY  T +SG   +   G    G++ S ALE +  D+A ELT
Sbjct: 343 QIPLVDVSNVNGLETLDQQTYRATPESGSYFLWDAGDGPTGDLLSYALEESATDVAGELT 402

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ELI+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 403 ELIQTQRAYSSNAKVIQTVDEMLQETTNIKR 433


>gi|255262922|ref|ZP_05342264.1| flagellar hook protein FlgE [Thalassiobium sp. R2A62]
 gi|255105257|gb|EET47931.1| flagellar hook protein FlgE [Thalassiobium sp. R2A62]
          Length = 422

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 128/436 (29%), Positives = 205/436 (47%), Gaps = 29/436 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A +++++ +SDNIAN  T GYKR    F SLV  S + +Y +GG+
Sbjct: 1   MTISSSLNAGIAGLAANASKLATISDNIANSSTFGYKRAGADFHSLVTGSGNGTYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR------DNVNCLTRAGDFHINNEG 114
            ++T+ M+  +GSL+ T++ TDL+I G+G   V  R      D+   LT  G F  ++ G
Sbjct: 61  SVTTQRMVDARGSLVSTSNATDLSISGRGMLPVTNRSGVESGDSAMMLTSTGSFRTDSNG 120

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQ-----GLERINVKHAELSAMPTTTGFISNNLD 169
           +L    G VL+G P   A    +V +F       L+ I +   +    PTT+  +  NL 
Sbjct: 121 YLTTSGGLVLMGVP---ADGDGVVPTFSRDTQAALQPIKIDRTKFVGEPTTSIQLGVNLP 177

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
                   D      G   E     +   YD LG+S    V +T TG  +WE++ F    
Sbjct: 178 AT------DAVAGALGSAQEL----AVEYYDNLGNSENLIVTFTPTGSNEWEMA-FSDPS 226

Query: 230 STNNSFPYNVAPLNTVEVS--FDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
            T  +  ++ +  N   ++   D     +A S    I    +   I   I    S     
Sbjct: 227 LTTYTLLFDDSRSNGGALADIMDSSGASIATSFTGEIELTMDAGPISVNIGELGSGGGLS 286

Query: 288 AGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
             G  F P     NG   G      V++ G V  I+D GT   +Y++ I  VP+ + LK 
Sbjct: 287 QLGGTFAPTSISKNGSPVGNMISIEVNEKGIVQGIFDTGTTRALYQVPIVDVPNPNGLKA 346

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
            +  T+  +++SG   +   G    G++ S A E +  D+A+ELT+LI+ QR Y+ N+KV
Sbjct: 347 GNQQTFSISQNSGSFYLWDAGAGPVGDVVSYAREESTTDVAAELTQLIQTQRAYSTNAKV 406

Query: 406 FQTGSDFMDILISLKR 421
            QT  + +    ++KR
Sbjct: 407 IQTVDEMLQETTNIKR 422


>gi|83595982|gb|ABC25342.1| flagellar hook protein [uncultured marine bacterium Ant24C4]
          Length = 437

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 130/456 (28%), Positives = 213/456 (46%), Gaps = 54/456 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A + R++ +SDNIAN  T GYKR    F SLV  ++++ Y +GG+
Sbjct: 1   MTISSSLNAGVAGLSANATRLATISDNIANSSTFGYKRAVTDFQSLVIENSNSKYTAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
             +T  +I E+GSL+ T + TDLA++G+G   V    +V          LT  G F  + 
Sbjct: 61  RTTTTRLIDERGSLVSTTNPTDLAVRGRGLLPVTSEASVQVANGDHPLLLTTTGSFRPDE 120

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIVN---SFQGLERINVKHAELSAMPTTTGFISNNLD 169
           +G+L + +G VL+G+   NA   +  N   S  GLE I +   + +  PTT   ++ NL 
Sbjct: 121 DGYLRSPSGLVLMGWA-ANADGTIPTNPRDSVDGLEPIKINSNQFAGEPTTEVNLAVNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSI 224
             +T              A      S   +D LG S    + +T T        +W++ I
Sbjct: 180 ATST----------EAGSATGDETLSIEYFDNLGKSANLLMTFTPTVPATGTANEWQLQI 229

Query: 225 FRQDQSTNNSFPYNVAPLNTVEVSFDP----------VTGYLA-------NSSHKAISFN 267
              D +         A + + ++SFDP          VT  L        + +  +++ N
Sbjct: 230 --ADSAGGG------AVVGSYQLSFDPSRAGGGTLLGVTDNLGVGLPTEYDPATGSVTLN 281

Query: 268 DNTSGIDQQITIDISKT--TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
            +   ++  I    S T  TQL+  F P     NG A G      V  +G+V   +D G 
Sbjct: 282 VDGGPLELAIGTLGSATGLTQLSDTFAPTSISKNGSAVGSLTAIDVDVNGFVRASFDSGI 341

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
              +Y++ +  V + + L+  D  +Y  + DSG   +   G    G++ S A E ++ D+
Sbjct: 342 NRVLYQVPLVDVSNVNGLESLDQQSYRVSPDSGTFFLWDAGDGPTGDVVSFAREESSTDV 401

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           A ELT+LI+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 402 AGELTQLIQTQRAYSSNAKVIQTVDEMLQETTNIKR 437


>gi|327478809|gb|AEA82119.1| flagellar basal body FlaE domain-containing protein [Pseudomonas
           stutzeri DSM 4166]
          Length = 396

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 124/422 (29%), Positives = 197/422 (46%), Gaps = 40/422 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLE-IST 64
           S   A++G+ A + +++ + +NIAN  TVG+K +   F SL   + +      G+E I T
Sbjct: 2   SFNIALTGLSAVNEQLNTIGNNIANSGTVGFKSSRTNFGSLYAETQAM-----GVEVIGT 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS+ G+L  T    DLAI G GFF+ +  +     TRAG F  + + ++ N  G  L
Sbjct: 57  TQSISQGGALTSTNRTLDLAISGGGFFVTRASNGDVGYTRAGIFGTDKDSYITNSLGQRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH- 183
            GYP  +A+  L   +   L+   ++   + A  T       NLD N  + T    P+  
Sbjct: 117 QGYP-ADATGNLQTGTVGDLQ---LRSGGIPARATDALSFVANLDANQEVPTVAFDPQAA 172

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS--------TNNSF 235
           +  ++ YT K     YD+ G       Y+ KTGD  W    +    +        T +S 
Sbjct: 173 DSYNSTYTTK----LYDSQGKEHTLTQYFVKTGDNSWNAHYYVDGTALAGAPQALTFDSA 228

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
               AP+ +V ++  P+TG +A  +                I +D S T+Q    F    
Sbjct: 229 GVLAAPIGSVALA-APLTGGVAPLA----------------IQLDYSGTSQYGSEFSVTN 271

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           +   G+A G+    SV KDG V   Y +G R+   ++ +A+  + + LK   G  +  T 
Sbjct: 272 NRATGYAAGEQTGMSVEKDGKVYATYSNGERMLQGQVVLASFVNAEGLKNISGTAWTETA 331

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG   +G PG  Q+G + SGALE++NVD+  +L  L+E QRNY  N++V  T  +   +
Sbjct: 332 ASGAAMLGAPGVGQYGTLASGALESSNVDLTQQLVGLMEGQRNYQANTQVISTNKELTQV 391

Query: 416 LI 417
           L 
Sbjct: 392 LF 393


>gi|304321120|ref|YP_003854763.1| putative flagellar hook protein [Parvularcula bermudensis HTCC2503]
 gi|303300022|gb|ADM09621.1| putative flagellar hook protein [Parvularcula bermudensis HTCC2503]
          Length = 446

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 129/463 (27%), Positives = 211/463 (45%), Gaps = 59/463 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+   + +++A++DNI+N +T+GYKR    F SLV  S  N+Y +GG+
Sbjct: 1   MSISSSLNAGVAGLATNAVKLAAIADNISNSETIGYKRAVAEFQSLVIDSGPNAYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
             +    + +QGSL+ T + TDLAI G+G   V  +D            LT  G F  + 
Sbjct: 61  RATPYIDVDDQGSLIGTGNATDLAIAGRGLLPVTNQDGAQAVTAERQLLLTATGSFTPDE 120

Query: 113 EGFLENVAGGVLLGYPLKNAS--APLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G+L   +G  LLG+P  +      +   S + LE + V  +  +A PT    +  NL  
Sbjct: 121 DGYLRTTSGLFLLGFPADSNGDIGTVSRQSTESLEPVRVNVSNFTATPTENVGLGINL-- 178

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK------TGDKKWEVSI 224
                 P    +       Y   + +  +D  G + V  V +T            W   I
Sbjct: 179 ------PAAATEAGATTGAYEITTEY--FDNFGRAQVLRVEFTPQPPVSGAPTNNWTAEI 230

Query: 225 FRQDQSTNNSFPYNVAPLNTVEVSF--DPVTGYLANSSHKAISFN-----------DNTS 271
           F     +  S       + T +V+F  DPV G    S + + + +           D+T+
Sbjct: 231 FDNASGSEVS-------IGTFDVTFRDDPVNGGAIESINASSATDPTTSITTTGVYDSTT 283

Query: 272 GI-------DQQITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
           G          Q+ I I +       TQLA  F P     +G   G   DF V   G +D
Sbjct: 284 GTLPVTVESGTQVNIFIGRPNDNAGLTQLAADFSPYSLTKDGAEIGNLLDFEVDGQGNLD 343

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
            ++D G R  +Y++ +A VP+ + L+  + + Y  ++ SGD+ +   G    GE+   +L
Sbjct: 344 AVFDTGFRRTLYKIPVADVPNLNGLEAANASAYKVSQSSGDLYLWDAGDGPTGEMAGFSL 403

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
             + VD+A+ELT+LI+ QR Y+ N+K+ QT  + +    SL R
Sbjct: 404 MESTVDVANELTQLIQTQRAYSSNAKIIQTVDEILQETNSLVR 446


>gi|163742565|ref|ZP_02149951.1| flagellar hook protein FlgE, putative [Phaeobacter gallaeciensis
           2.10]
 gi|161384150|gb|EDQ08533.1| flagellar hook protein FlgE, putative [Phaeobacter gallaeciensis
           2.10]
          Length = 440

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 124/450 (27%), Positives = 204/450 (45%), Gaps = 46/450 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A ++R++++SDNIAN  T GYKR    F S+V  S+  +Y +GG+
Sbjct: 8   MTISSSLNAGVAGLTANASRLASISDNIANSSTAGYKRVQTDFHSMVMSSSGGTYSAGGV 67

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
             +   +I E+G L+ T++ TDLA++G+G   V   + V          LT    F  N 
Sbjct: 68  RTTNVRLIDERGPLVSTSNATDLAVRGRGMLPVTSMNEVETGAANPQMMLTTTASFRTNA 127

Query: 113 EGFLENVAGGVLLGYPLKNASA--PLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VL+G+P ++     P   ++   LE +     +LS  PTT   +  NL  
Sbjct: 128 DGLLATESGLVLMGWPAQSDGTIPPYARDTSDALEPVRFNVNKLSGEPTTEMSLGVNLPA 187

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT----KTGDKKWEVSIFR 226
            AT  T   T          +   S   YD LG S    + +      TG+   E ++  
Sbjct: 188 TATESTAAGT----------SENLSIEYYDNLGKSESLQIEFVPTVPATGESN-EWTMII 236

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFD-------------PVTG--YLANSSHKAISFNDNTS 271
            D +T ++      P+    ++FD               TG  Y A +    +       
Sbjct: 237 TDTATGST------PIGEYTLTFDDNRTSGGALNAVAATTGGAYDAATGSIIVPVAGGPM 290

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
            I+  +  D +  TQL+  F P     +G   G      + + GYV   YD G    +Y+
Sbjct: 291 EINIGMIGDDNGLTQLSDTFAPASISKDGAPVGNFTGVEIDEAGYVHANYDTGVSRVVYQ 350

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +  +P+ + +   D  TY+P+ +SG   +   G    G+I   A E +  D+A ELT 
Sbjct: 351 VPLVDLPNPNGMIAMDRQTYMPSSESGSYFLWNAGEGPTGDILGYAREESATDVAGELTN 410

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 411 MIQTQRAYSSNAKVIQTVDEMLQETTNIKR 440


>gi|299068732|emb|CBJ39971.1| flagellar hook protein FlgE [Ralstonia solanacearum CMR15]
          Length = 401

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/417 (28%), Positives = 203/417 (48%), Gaps = 23/417 (5%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
           +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ +  G++++ 
Sbjct: 4   QQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDVTK 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                 QG++  T +  D+AI G GF+ +V         TR G F  +  G++ +  G  
Sbjct: 64  VSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATGQN 123

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY    A A   +N+   L  + +   +L+ + TT    S NLD   T+  P  TP  
Sbjct: 124 LTGYA---ADATGKINTAV-LTNLQIPVNDLAPLATTNTAFSINLDAAGTV--PTTTPFS 177

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               A Y H  S   YD  G+S +   YY +TG   W+V       + + + P    P+ 
Sbjct: 178 ATNSATYNHSVSEQVYDGTGTSHMLTNYYVRTG-TGWDVY-----STVDGAAPTGGNPV- 230

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
              ++F+      ++ S  A++F    +G+    ++D + TTQ  GGF       +G+A 
Sbjct: 231 -TSLTFNSSGALTSSPSKVAVAF----TGMSI-ASMDFTGTTQYGGGFNDTSITQDGYAT 284

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   +G
Sbjct: 285 GRLASYSVGNDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQMG 344

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 345 TPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDTILQTLVSMR 401


>gi|319944135|ref|ZP_08018413.1| flagellar hook protein FlgE [Lautropia mirabilis ATCC 51599]
 gi|319742629|gb|EFV95038.1| flagellar hook protein FlgE [Lautropia mirabilis ATCC 51599]
          Length = 417

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/434 (28%), Positives = 202/434 (46%), Gaps = 37/434 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           + +  +SG++A +  +  +  N+AN  TVG+K +   F+  V+ +T    SN     G E
Sbjct: 2   AFQQGLSGLNAAARHLDTIGHNVANASTVGFKASRAEFAD-VYATTVYGVSNVSPGIGTE 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +        QG+L  T ++ DL I G GFF +         TR G F ++  G++ N +G
Sbjct: 61  VGAIAQQFSQGALTTTNNSLDLGINGGGFFRMSDNGGAITYTREGQFKLDKSGYIVNASG 120

Query: 122 GVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI------ 174
             L GYP+ KN    ++ N     + + +   +++   TT+  +  N+D  AT       
Sbjct: 121 KRLTGYPVDKNG---VVTNGTA--QDLKLDSTDIAPKQTTSAAVRVNVDARATTPANAFT 175

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN- 233
           +T  KT         Y   +S + +D+LG   V  +Y+ KTGD  W+V      +  N  
Sbjct: 176 LTDAKT---------YDGGTSVSVFDSLGREHVMAMYFRKTGDNSWDVHGTLDGEPLNGG 226

Query: 234 ------SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT-SGIDQQITIDISKTTQ 286
                 +F  N       + + DP T   +N     +S N    +G +  ++++ + TTQ
Sbjct: 227 AAVGKLAFNPNGTLKGASDGNGDPTT---SNVMTFDVSLNMGADAGGNHTVSVNFADTTQ 283

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
               F     E NG+  GK   FSV +DG +   Y +G  V   R+A+A   +   L+  
Sbjct: 284 FGTNFTVAHQEQNGNGSGKLAGFSVGRDGSLMARYTNGQTVSKGRVALANFTNPQGLQPL 343

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN +  T DSG   +G P     G I SGALE++NVD+  EL  +I AQR Y  N++  
Sbjct: 344 GGNQWGETADSGAPLVGSPSTGTLGVIQSGALESSNVDLTQELVNMITAQRVYQANAQTV 403

Query: 407 QTGSDFMDILISLK 420
           +T    +  +++L+
Sbjct: 404 RTHDQLLQTIVNLR 417


>gi|83955135|ref|ZP_00963791.1| putative flagellar hook protein [Sulfitobacter sp. NAS-14.1]
 gi|83840464|gb|EAP79637.1| putative flagellar hook protein [Sulfitobacter sp. NAS-14.1]
          Length = 433

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 141/455 (30%), Positives = 219/455 (48%), Gaps = 56/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  +++T +SG+ A S  V ++S+NIAN +TVGY+R    F+ +V  + S     G L
Sbjct: 1   MSISSALQTGVSGLRANSKAVGSISENIANSNTVGYRR---GFAHMVTTTASGGNGDGVL 57

Query: 61  EISTKDM--ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-----LTRAGDFHINNE 113
            ++  +   IS  G L+ T S+TDLAI G GFF V    N        LTRAG F  + +
Sbjct: 58  SVNAVEELDISTAGGLISTNSSTDLAIGGNGFFAVSMNPNETVQTNYMLTRAGSFLPDEQ 117

Query: 114 GFLENVAGGVLLGYP--LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G L+N AG  L GYP  L+     +   SF+ +E +N+ +  +SA  T+T     NL   
Sbjct: 118 GNLKNAAGYYLAGYPYGLEGDIGSVDRTSFKDMETVNIGNLNISAGVTSTITAFGNL--- 174

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSV-VYDVYYTKTGDKKWEVSIFRQDQS 230
                P +        A +   S    +  LG S  V   +   T    W+++I  Q+ +
Sbjct: 175 -----PSQDTGQADPGAPFVTSSEV--FTALGESQRVSFSWAPGTTANTWDLAIADQNGN 227

Query: 231 T--------NNSFPYNVAPLN--------TVEVSF--DPVTGYLANSSHKAISFNDNTSG 272
                    NN+ P   +PL+        T   +F  DP TG         I+ ++    
Sbjct: 228 GLGSVTIEFNNAGPAAGSPLSYSNINSTATAPAAFTVDPATGV------ATITLDNGV-- 279

Query: 273 IDQQITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
           + Q+I I + K       +Q AG F     + +G + G+     +++DG +  ++D+G R
Sbjct: 280 VPQEIDITLGKPGAFDGISQFAGDF-SLAFDRDGSSAGELVRTEITEDGTLFGVFDNGMR 338

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             +Y + +A V + + L    GN Y  + ++G  S      +  G I +GALE +NVDIA
Sbjct: 339 RALYDIPVAVVANPNGLVEVKGNAYRLSGETGSFSALQANSSTVGSINAGALEGSNVDIA 398

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            E+T+LI+AQR ++ N+KV  T  D MD    LKR
Sbjct: 399 QEMTDLIKAQRAFSTNAKVITTVDDMMDETTRLKR 433


>gi|124268254|ref|YP_001022258.1| flagellar basal body and hook protein [Methylibium petroleiphilum
           PM1]
 gi|124261029|gb|ABM96023.1| flagellar basal body and hook protein [Methylibium petroleiphilum
           PM1]
          Length = 420

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 123/430 (28%), Positives = 191/430 (44%), Gaps = 26/430 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL---VFPSTSNSYVSGGLEI 62
           S +  +SG++A S  +  + +N+AN  T G K +   F  +       +  + V  G+ +
Sbjct: 2   SFQQGLSGLNAASKNLEIIGNNVANASTFGAKSSRAEFGDVYANALNGSGTNMVGIGVNL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +T      QG++  T +  DLAI G GFF V    N     R G F I+ EGF+ N +G 
Sbjct: 62  ATVAQQFTQGNITTTDNPMDLAINGSGFFQVSDGKNPTMYARNGQFKIDREGFIVNNSGY 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            LLGYP   A    ++   Q  + I +  A ++   T    I  NLD    + TP     
Sbjct: 122 KLLGYP---ADGQGVIVPGQA-QAIQLPTAGIAPRATDRIAIEMNLDARQAVTTPATGGI 177

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV--- 239
                A Y + +S   YD  G  V    Y+ K+G  +W+V +      T N  P +V   
Sbjct: 178 DFDDPATYNNATSVTVYDAKGQDVALTYYFQKSGADQWDVYV------TANGTPISVDGT 231

Query: 240 -APLNTVEVSFDPVTGYLANSSHKAISFN-----DNTSGIDQQIT---IDISKTTQLAGG 290
            A L +  ++F P  G    +   A+  N     +   G    IT   +D++  TQ   G
Sbjct: 232 GAALPSTTMTF-PANGSAPTAPVGAVPINIPATTNAAGGTTLPITGIELDVTSATQYGSG 290

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F        G+APG+    S+  +G +   Y +G   P  +L +A   +   L+    N 
Sbjct: 291 FGVTDMSQTGYAPGQLSGISIEANGVIMARYSNGQSKPGGQLELANFRNPQGLQPLGNNV 350

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           +  T  SGD  +G  G    G + SGALE +N+D+  EL  +I AQR Y  N++  +T  
Sbjct: 351 WATTFTSGDPVVGAAGDGNFGVLQSGALEESNIDLTGELVNMITAQRVYQANAQTVKTQD 410

Query: 411 DFMDILISLK 420
             M  L++L+
Sbjct: 411 SMMQTLVNLR 420


>gi|320353949|ref|YP_004195288.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
 gi|320122451|gb|ADW17997.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
          Length = 423

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 124/443 (27%), Positives = 209/443 (47%), Gaps = 42/443 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL----VFPSTSNSYV 56
           MG+  ++ TA+SG+   S  ++   +NIAN  TVG+K ++  FS L    +  S+ NS V
Sbjct: 1   MGLSSALFTAISGLQGSSQAMTVTGNNIANSSTVGFKTSSTVFSDLLSANIASSSGNSQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGF 115
             G ++ T      QG    T S TD+AI+G GFFIV     + +  TR G+F  +++G+
Sbjct: 61  GRGSQVQTVQTSFSQGGFESTESATDIAIEGSGFFIVGDPLSDTSLYTRNGNFSFDDDGY 120

Query: 116 LENVAG-----------GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFI 164
           L    G           GVL    L +    L+        +I  K  E   + T     
Sbjct: 121 LVTADGYRVQGSTYNANGVLASGNLSDIQVDLV-------SQIKAKRTENVTLQT----- 168

Query: 165 SNNLDKNATIITP---DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWE 221
             NLD N+ ++     D T   +  +    + ++   YD+LG++ +   Y+TK  D+ W 
Sbjct: 169 --NLDSNSEVLNAGVFDSTAPEDTSN----YATTTTVYDSLGTAHLLTCYFTKVNDQTWN 222

Query: 222 VSIFRQDQSTNNSFPYNVAPLNTVEVSFDP---VTGYLANSSHKAISFNDNTSGIDQQIT 278
            ++              +  + +  + FD    ++     ++   I    N +   QQ+ 
Sbjct: 223 WNLTVDGADLTGGTSGVLEIIGSGTLVFDQDGNLSTGSTGTTTSGILTWANGADQTQQLA 282

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
             +  TTQ          + +G+A G+  D  ++ DG V  +Y +G  +P+  +A+AT  
Sbjct: 283 Y-VFDTTQFDSDSTVFSQDQDGYASGEVTDVDIAADGTVSAVYSNGETIPVAMIALATFI 341

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           + D L     + Y  T +SG  +IG+PG +Q G + + ALE +NVD+A+E  +LI  Q  
Sbjct: 342 NSDGLDAVGSSLYRETGESGTPTIGYPGASQ-GTLITQALELSNVDLATEFVDLITIQNA 400

Query: 399 YAVNSKVFQTGSDFMDILISLKR 421
           Y+ NSKV  T ++ +D L++L R
Sbjct: 401 YSANSKVITTTNEMLDELVNLIR 423


>gi|163738039|ref|ZP_02145455.1| S-adenosyl-L-homocysteine hydrolase [Phaeobacter gallaeciensis
           BS107]
 gi|161388655|gb|EDQ13008.1| S-adenosyl-L-homocysteine hydrolase [Phaeobacter gallaeciensis
           BS107]
          Length = 440

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 124/457 (27%), Positives = 203/457 (44%), Gaps = 60/457 (13%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A ++R++++SDNIAN  T GYKR    F S+V  S+  +Y +GG+
Sbjct: 8   MTISSSLNAGVAGLSANASRLASISDNIANASTPGYKRVQTDFHSMVMSSSGGAYSAGGV 67

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHINN 112
             +   +I E+G L+ T++ TDLA++G+G   V   + V          LT    F  N 
Sbjct: 68  RTTNVRLIDERGPLVTTSNATDLAVRGRGMLPVASINEVETGATNPQMMLTTTASFRTNA 127

Query: 113 EGFLENVAGGVLLGYPLKNASA--PLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VL+G+P ++     P   ++   LE +     +LS  PTT   +  NL  
Sbjct: 128 DGLLATESGLVLMGWPAQSDGTIPPYARDTSDALEPVRFNVNKLSGEPTTEMSLGVNLPA 187

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----GDKKWEVSIFR 226
            AT  T           A  +   S   YD LG S    + +  T    G+   E ++  
Sbjct: 188 TATEST----------SAGTSENLSIEYYDNLGKSESLQIEFVPTVPGTGESN-EWTMII 236

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFD---------------------PVTG-YLANSSHKAI 264
            D +T  +      P+    ++FD                     P TG  +   +   +
Sbjct: 237 TDTATGGT------PIGEYTLTFDDNRTSGGALNAVTATTGGAYAPATGSIIVTVAGGPM 290

Query: 265 SFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG 324
             N  T G D  +T       QL+  F P     +G   G      + + G+V   YD G
Sbjct: 291 EINIGTLGDDNGLT-------QLSDTFAPASISKDGAPVGNFTGVEIDEAGFVHANYDTG 343

Query: 325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVD 384
               +Y++ +  +P+ + +   D  TY+P+ +SG   +   G    G+I   A E +  D
Sbjct: 344 VSRVVYQVPLVDLPNPNGMIAMDRQTYMPSSESGSYFLWNAGEGPTGDILGYAREESATD 403

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +A ELT +I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 404 VAGELTNMIQTQRAYSSNAKVIQTVDEMLQETTNIKR 440


>gi|83944165|ref|ZP_00956621.1| putative flagellar hook protein [Sulfitobacter sp. EE-36]
 gi|83845032|gb|EAP82913.1| putative flagellar hook protein [Sulfitobacter sp. EE-36]
          Length = 433

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 140/455 (30%), Positives = 219/455 (48%), Gaps = 56/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  +++T +SG+ A S  V ++S+NIAN +TVGY+R    F+ +V  + S     G L
Sbjct: 1   MSISSALQTGVSGLRANSKAVGSISENIANSNTVGYRR---GFAHMVTTTASGGNGDGVL 57

Query: 61  EISTKDM--ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-----LTRAGDFHINNE 113
            ++  +   I+  G L+ T S+TDLAI G GFF V    N        LTRAG F  + +
Sbjct: 58  SVNAVEELDIATAGGLISTNSSTDLAIGGNGFFAVSMNPNETVQTNYMLTRAGSFLPDEQ 117

Query: 114 GFLENVAGGVLLGYP--LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G L+N AG  L GYP  L+     +   SF+ +E +N+ +  +SA  T+T     NL   
Sbjct: 118 GNLKNAAGYYLAGYPYGLEGDIGSVDRTSFKDMETVNIGNLNISAGVTSTITAFGNL--- 174

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSV-VYDVYYTKTGDKKWEVSIFRQDQS 230
                P +        A +   S    +  LG S  V   +   T    W+++I  Q+ +
Sbjct: 175 -----PSQDTGQADPGAPFVTSSEV--FTALGESQRVSFSWAPGTTANTWDLAIADQNGN 227

Query: 231 T--------NNSFPYNVAPLN--------TVEVSF--DPVTGYLANSSHKAISFNDNTSG 272
                    NN+ P   +PL+        T   +F  DP TG         I+ ++    
Sbjct: 228 GLGSVTIEFNNAGPAAGSPLSYSNINSTATAPAAFTVDPATGV------ATITLDNGV-- 279

Query: 273 IDQQITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
           + Q+I I + K       +Q AG F     + +G + G+     +++DG +  ++D+G R
Sbjct: 280 VPQEIDITLGKPGAFDGISQFAGDF-SLAFDRDGSSAGELVRTEITEDGTLFGVFDNGMR 338

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             +Y + +A V + + L    GN Y  + ++G  S      +  G I +GALE +NVDIA
Sbjct: 339 RALYDIPVAVVANPNGLVEVKGNAYRLSGETGSFSALQANSSTVGSINAGALEGSNVDIA 398

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            E+T+LI+AQR ++ N+KV  T  D MD    LKR
Sbjct: 399 QEMTDLIKAQRAFSTNAKVITTVDDMMDETTRLKR 433


>gi|296535149|ref|ZP_06897378.1| flagellar hook protein FlgE [Roseomonas cervicalis ATCC 49957]
 gi|296264524|gb|EFH10920.1| flagellar hook protein FlgE [Roseomonas cervicalis ATCC 49957]
          Length = 436

 Score =  153 bits (386), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 136/455 (29%), Positives = 204/455 (44%), Gaps = 55/455 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + GS+  A SG+ AQ+  ++ VS+N+AN  T GYKR   AF+  +  ST+    S  +
Sbjct: 3   MSLNGSLYAATSGLGAQTAAITNVSNNVANSQTTGYKRVDTAFAEQLSQSTARLNGSSTV 62

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK---GRD-NVNCL-------TRAGDFH 109
             +    +S  G +    +   LAI G G F V    G D N N +       TR GDF 
Sbjct: 63  SAAPVATVSRGGDISQVENPLALAISGNGLFAVSRPAGTDANGNTVFSPTQFYTRNGDFS 122

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
              EG+L N +G  L G+P+ N +    VN  Q L  I V  A  +   TT   I  NL 
Sbjct: 123 KTAEGYLVNTSGYALEGWPVANGA----VNRGQ-LGLIQVDEAPYAPEATTQIGIGANLP 177

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            + T               E ++ +    YD LG +    + +TKTGD +W+V++   D 
Sbjct: 178 ASGT---------------ETSYSTQVPVYDNLGIARSVTLNWTKTGDYQWQVNVVGPDG 222

Query: 230 ST----------NNSFPYNVAPLNTVEVSFDPVTGYLANS------SHKAISFNDNTSGI 273
           +T          + +   N  P  T++ S    TG LA S      S   ++  D     
Sbjct: 223 TTSAGTATLNFGDGAGTGNGMPSGTLD-SITNATGALAASGFNGQGSAATLTVGDLFGAG 281

Query: 274 DQQITIDISK------TTQLAGGFIPQKS-EINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
            Q + I +         TQ AG    Q S   NG APG      + ++G V + YD+G  
Sbjct: 282 SQPVAISLGTFGSTQGVTQYAGATYQQNSVTANGAAPGAYTGVGIKENGEVVVSYDNGKS 341

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             I ++ I T  + D L+  DG  +  T+ +G   +   G    G + + ++E +NVDI 
Sbjct: 342 RTIAQVPIVTFQNADGLQREDGQAFTATQAAGQFRVLAAGEQGTGTLATSSIEASNVDIT 401

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           SE +++I AQR Y+ NS+V  T S  M   + + R
Sbjct: 402 SEFSKMIVAQRAYSANSRVLSTVSGLMSETVDMLR 436


>gi|46203395|ref|ZP_00051590.2| COG1749: Flagellar hook protein FlgE [Magnetospirillum
           magnetotacticum MS-1]
          Length = 293

 Score =  152 bits (385), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 152/291 (52%), Gaps = 21/291 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGG 59
           M ++G ++T +SGM+AQSNR+S V++NI N +T GYKRT+  FSSL+  S    +Y SG 
Sbjct: 1   MSLIGVLRTGVSGMNAQSNRISTVAENIQNANTTGYKRTSAEFSSLLLDSGDVGTYNSGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE-GFLEN 118
           +E + +  I E+G +  T S+ DLAIQG GFF+V+       LTRAG+F ++ + G L N
Sbjct: 61  VETTLRRSIGERGPISSTNSDKDLAIQGNGFFVVRDESGAPFLTRAGNFVVDGKSGNLVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  LLGY L N +   ++N    L+ +NV      A P+T   +S NL       TP 
Sbjct: 121 AGGFTLLGYSLANGAPNPVLNGVADLKPVNVNVMGQEARPSTNATVSGNLSYE----TPV 176

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P   G    Y+ K+S   YD +G  ++ DV  TKT    W V  F     T       
Sbjct: 177 YDPTAAGAIG-YSKKNSLKVYDNVGQPLILDVQMTKTSTNTWSVKFFDPAAPT------- 228

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
              L +  V+FD   G +++     ++  +      + + +D+S  TQL+G
Sbjct: 229 -VSLGSSTVTFDG-NGKVSSGGSANVAVPNG-----RTVAVDMSGLTQLSG 272


>gi|126734127|ref|ZP_01749874.1| flagellar hook protein FlgE, putative [Roseobacter sp. CCS2]
 gi|126716993|gb|EBA13857.1| flagellar hook protein FlgE, putative [Roseobacter sp. CCS2]
          Length = 444

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 129/461 (27%), Positives = 205/461 (44%), Gaps = 57/461 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+  +++G+ A + R++ +SDNI+N  T GYKR    F S+V  S   +Y +GG+
Sbjct: 1   MTISSSLNASVAGLAANATRLATISDNISNSSTYGYKRAVTDFQSMVIESGQGTYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--------DNVNCLTRAGDFHINN 112
             +T  +I E+G+L+ T++ TDLA++G+G   V           DN   LT  G F  + 
Sbjct: 61  RTTTSRLIDERGALVSTSNPTDLAVRGRGMLPVTSETSVTVDNGDNPLFLTTTGSFRPDA 120

Query: 113 EGFLENVAGGVLLGYP-LKNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G+L +  G VLLG P   + + P    +S  GL  + +   + +   TT   +S NL  
Sbjct: 121 QGYLRSPGGLVLLGVPAAADGTIPNYPRDSIDGLVPVQINANQFAGEATTRVDLSVNLPA 180

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIF 225
            +T           G   E +   S   +D LG+S      +T T        +W + I 
Sbjct: 181 TST---------REGASGE-SESLSVEYFDNLGASSNLSFTFTPTVPANGASNEWTMEIR 230

Query: 226 RQDQSTN-NSFPYNVA-----------------------PLNTVEVSFDPVTGYLA-NSS 260
             +   + +  P  V                        P   V  ++DP+TG L+ N  
Sbjct: 231 DSESDVDADGIPDVVGEYTLTFDATRGGGGTLANVDFADPAAPVGGAYDPITGALSINVD 290

Query: 261 HKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDII 320
              +  N    G    +       TQL+  F P     NG   G      V ++G+V   
Sbjct: 291 GGPMEINIGELGSSIGL-------TQLSDAFAPVSISKNGTPVGSLTSIEVDQNGFVRAS 343

Query: 321 YDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALET 380
           +D G    +Y++ +  VP+ + L+  D  +Y  T DSG   +   G    G+I   A E 
Sbjct: 344 FDIGINRVLYQIPLVDVPNVNGLETLDQQSYRVTPDSGSFFLWDAGDGPTGDIVGFAREE 403

Query: 381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +  D+A ELTELI+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 404 SATDVAGELTELIQTQRAYSSNAKVIQTVDEMLQETTNIKR 444


>gi|170735956|ref|YP_001777216.1| flagellar basal body FlaE domain-containing protein [Burkholderia
           cenocepacia MC0-3]
 gi|169818144|gb|ACA92726.1| flagellar basal body FlaE domain protein [Burkholderia cenocepacia
           MC0-3]
          Length = 414

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 122/429 (28%), Positives = 198/429 (46%), Gaps = 34/429 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYANSVATSVNTQIGIGTRLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G FH +  G + +  G  L
Sbjct: 64  VQQNFGQGTINSTKSSLDVAINGNGFFQMS-SNGVTTYSRDGTFHRDKNGAIVDAQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A A  ++N+ Q    + ++    +  P  T  I+   + NA    P KTP + 
Sbjct: 123 MGYA---AGAGGVINTAQ---TVPLQAPTSNIAPRATSKITGQFNLNAQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + SS   YDTLG S    +Y+ K     W+     Q Q+          P N 
Sbjct: 177 TDNTTYNYNSSIQVYDTLGGSQQVTMYFAKNAAGTWQAYAGVQGQT----------PTNL 226

Query: 245 VEVSFDPVTGYLANSSHKA------------ISFNDNTSGID-QQITIDISKTTQLAGGF 291
             V+FD  +G L++++  A             S  + T G + Q +T+D+  TTQ  G  
Sbjct: 227 GTVTFD-ASGRLSSTTSAATGQPTPSLGQFAFSIPNTTGGANPQNLTLDLGGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    FS+  DG +   Y +G    +  +A+A   + + L    GN Y
Sbjct: 286 GVNNLAQDGFASGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNIGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG   I  PG   HG +   ALE +NV++ +EL  LI AQRNY  N++  +T   
Sbjct: 346 AETAASGVPQISAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQTIKTQQA 405

Query: 412 FMDILISLK 420
               L++L+
Sbjct: 406 VDQTLLNLR 414


>gi|309779447|ref|ZP_07674208.1| flagellar hook protein FlgE [Ralstonia sp. 5_7_47FAA]
 gi|308921688|gb|EFP67324.1| flagellar hook protein FlgE [Ralstonia sp. 5_7_47FAA]
          Length = 404

 Score =  152 bits (384), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 122/421 (28%), Positives = 208/421 (49%), Gaps = 26/421 (6%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIS 63
            +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ +  G+ ++
Sbjct: 3   FQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVSVT 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFF--IVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
                  QG++  T +  D+AI G GF+  + +G   V   TR G F  +  G++ +  G
Sbjct: 63  KVSQAFTQGNVTITGNPLDIAINGSGFYRMVDQGSGQV-SYTRNGQFQTDKNGYVISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY + +      VN+   L ++ +   +L+ + TT    + NLD  AT+  P  TP
Sbjct: 122 QNLTGYGVDSTGK---VNTAV-LTKLQIPVNDLAPLATTNTAFAINLDAAATV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A + H  S   YD  G++ +   YY +TG   W V  + Q    N   P    P
Sbjct: 176 FSATNSATFNHSVSEQVYDGTGTAHMLTNYYVRTG-TGWNV--YSQVDGNN---PTGGNP 229

Query: 242 LNTVEVSFDPVTGYLANSSHK-AISFNDNTSGIDQQIT-IDISKTTQLAGGFIPQKSEIN 299
           +    ++F+  +G L +S  K A++F   T      I+ ID + TTQ  GG+       +
Sbjct: 230 V--TSLTFN-TSGQLTSSPSKVAVAFGTPTG---MSISNIDFTGTTQYGGGYNDTTVTQD 283

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A G+   +SV  DG +   Y +G    + ++A+A   + + L+   GN ++ T +SG 
Sbjct: 284 GYATGRLASYSVGTDGTITGRYSNGRTSVLGQIAMANFKAPEGLQNIGGNQWVETSNSGA 343

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
             +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+SL
Sbjct: 344 PGLGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDTILQTLVSL 403

Query: 420 K 420
           +
Sbjct: 404 R 404


>gi|86747891|ref|YP_484387.1| flagellar hook protein FlgE [Rhodopseudomonas palustris HaA2]
 gi|86570919|gb|ABD05476.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 421

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 136/435 (31%), Positives = 217/435 (49%), Gaps = 33/435 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF-PSTSNSYVSGG 59
           M + G++ +A+S ++AQS+ ++ +SDNIAN  TVGYK ++ +F SLV   S ++SY SGG
Sbjct: 1   MSLSGALSSAISALNAQSSALAMISDNIANSSTVGYKTSSASFESLVTNTSGASSYSSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLE 117
           +  S    I+ QG L  T + T++AIQG GFF V           TR G F I+++G+L 
Sbjct: 61  VTASATSNITTQGLLTSTTTATNIAIQGNGFFPVTTSLTGGSTLYTRNGAFTIDSDGYLV 120

Query: 118 NVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP 177
           N  G  LLG+        +   S   L  I+   A+ S+  TTT   + NL  +A +   
Sbjct: 121 N-NGAYLLGWRTDTDGNVIGTASEGNLVPIDTSVAKTSSGATTTTSFAANLPADAAV--- 176

Query: 178 DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
                        T  +S   YD+LG+S    V +TKT +  W  S  +   +++++   
Sbjct: 177 -----------NDTFTTSMPLYDSLGTSSTMQVTWTKTAENTWSASFGKPTLASDSTTTL 225

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHK--AISFNDNTSGI-DQQITIDISKT------TQLA 288
             AP +T+ VSF+   G LA++S     ++ +D T+G  +  IT+D+         TQL+
Sbjct: 226 AAAPTDTISVSFNS-DGSLASTSPSPATVTISDWTTGAANSTITLDLGTVGGKDGLTQLS 284

Query: 289 GGF-IPQKS----EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
                P  +    E +G A GK    +V  DG V+  Y +G  + IY++ +AT  +   L
Sbjct: 285 SDLSTPAVTIDSIESDGLAFGKLSSVAVGDDGTVNATYSNGETIAIYKIPVATFTASAEL 344

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
           +   G  Y  T  SG  ++   G N  G I+   LE++  D   + + +I AQ+ Y+  S
Sbjct: 345 EAQSGGLYATTAASGSATLQESGANGAGTIYGSELESSTTDTNEQFSSMISAQQAYSAAS 404

Query: 404 KVFQTGSDFMDILIS 418
           +V    +   D LI+
Sbjct: 405 QVITAVNKMFDTLIA 419


>gi|107026757|ref|YP_624268.1| flagellar hook protein FlgE [Burkholderia cenocepacia AU 1054]
 gi|116692051|ref|YP_837584.1| flagellar hook protein FlgE [Burkholderia cenocepacia HI2424]
 gi|105896131|gb|ABF79295.1| flagellar basal body FlaE [Burkholderia cenocepacia AU 1054]
 gi|116650051|gb|ABK10691.1| flagellar basal body FlaE domain protein [Burkholderia cenocepacia
           HI2424]
          Length = 414

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 122/429 (28%), Positives = 198/429 (46%), Gaps = 34/429 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYANSVATSVNTQIGIGTRLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G FH +  G + +  G  L
Sbjct: 64  VQQNFGQGTINSTKSSLDVAINGNGFFQMS-SNGVTTYSRDGTFHRDKNGAIVDAQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A A  ++N+ Q    + ++    +  P  T  I+   + NA    P KTP + 
Sbjct: 123 MGYA---AGAGGMINTAQ---TVPLQAPTSNIAPRATSKITGQFNLNAQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + SS   YDTLG S    +Y+ K     W+     Q Q+          P N 
Sbjct: 177 TDNTTYNYNSSIQVYDTLGGSQQVTMYFAKNAAGTWQAYAGVQGQT----------PTNL 226

Query: 245 VEVSFDPVTGYLANSSHKA------------ISFNDNTSGID-QQITIDISKTTQLAGGF 291
             V+FD  +G L++++  A             S  + T G + Q +T+D+  TTQ  G  
Sbjct: 227 GTVTFD-ASGRLSSTTSAATGQPTPSLGQFAFSIPNTTGGANPQNLTLDLGGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    FS+  DG +   Y +G    +  +A+A   + + L    GN Y
Sbjct: 286 GVNNLAQDGFASGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNIGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG   I  PG   HG +   ALE +NV++ +EL  LI AQRNY  N++  +T   
Sbjct: 346 AETAASGVPQISAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQTIKTQQA 405

Query: 412 FMDILISLK 420
               L++L+
Sbjct: 406 VDQTLLNLR 414


>gi|187924404|ref|YP_001896046.1| flagellar basal body FlaE domain protein [Burkholderia phytofirmans
           PsJN]
 gi|187715598|gb|ACD16822.1| flagellar basal body FlaE domain protein [Burkholderia phytofirmans
           PsJN]
          Length = 410

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 124/428 (28%), Positives = 205/428 (47%), Gaps = 33/428 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL---VFPSTSNSYVSGGLEI 62
           S +T +SG+ A S  +  + +NIAN +TVG+K +   F+ +      + +N+ V  G  +
Sbjct: 2   SYQTGLSGLSAASTDLDVIGNNIANANTVGFKSSTAQFADMYANAVMTAANNQVGIGTRL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           ST +     G+   T    D+AI G GFF +     +   +R G FH++  G +EN  G 
Sbjct: 62  STAEQDFSNGTFSKTDRPLDIAINGNGFFQLSNNGAL-VYSRNGVFHLDKSGVIENAQGL 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L+GY    +  P    +   +  + V  A L    T T   + NLD    + T    P 
Sbjct: 121 PLMGY----SPGPDGKMNTGSVGPLMVSSASLPPTATKTISAAFNLDSQDPVPT---NPF 173

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +    A Y++    + Y++LG S   +VY+ K     ++V       S N   P    P 
Sbjct: 174 NPSDPASYSYGQPMSVYNSLGGSQSTNVYFVKKATGSYDV----YGTSGNPPAPVGPNPS 229

Query: 243 NTV-EVSFDPVTGYLANSSHKAISFN-----DNTSGIDQQITIDISKTTQLAG-----GF 291
            ++  ++FD  +G+L + +  A++FN     DN +   Q +T++++ TTQ AG       
Sbjct: 230 GSMGTITFD-TSGHLTSPNASALTFNIPNAADNGA-TTQSLTLNLTGTTQYAGKNGVTAL 287

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
           +P     +G++ G+   FSV +DG +   Y +G  + + ++A+AT  + + L     N Y
Sbjct: 288 LP-----DGNSSGQLTGFSVGEDGTLTGSYSNGATLVLGQVALATFSNPNGLANMGNNLY 342

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T DSG   +  PG   HG +  G  E +NVD+  +L +LI AQRNY  NS+  +T   
Sbjct: 343 AQTGDSGAAQVSSPGSTNHGVLLGGQTEDSNVDLTHQLVDLITAQRNYQANSQTIKTQQT 402

Query: 412 FMDILISL 419
               LI+L
Sbjct: 403 VDQALINL 410


>gi|310764860|gb|ADP09810.1| Flagellar hook protein FlgE [Erwinia sp. Ejp617]
          Length = 410

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/426 (27%), Positives = 207/426 (48%), Gaps = 28/426 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A ++ +  V +NIAN  T G+K  +I F+  +F          G++++  
Sbjct: 2   SFSQGLSGLNAAASALDVVGNNIANSQTFGFKAGSIGFAD-IFAGAQGM----GVQVAGS 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV-L 124
               + G L  T  N D+ I G GFF +         +R G F  +  G++ N+  G+ L
Sbjct: 57  SQNFKDGGLTGTGRNMDMGINGNGFFRLMDEAGQAYYSRNGQFDTDVNGYITNLTNGLRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY  +    P  + +   +  I +    +  + +T+G ++ NL  +A ++T  KTP  +
Sbjct: 117 TGY--QATGTPPAIQAGAAVAPIQIDKTGMPPVASTSGKLNGNLTASAEVVT--KTPFDH 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS---TNNSFPYNVAP 241
                +   S   A+D+LG+    D+YY KT   +W+   +  D S   T+ + P   + 
Sbjct: 173 TDGETFNSSSQIEAFDSLGNRHTIDIYYVKTATGEWKA--YANDASAPVTSGTPPK--SE 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ----QITIDISKTTQL---AGGFIPQ 294
              +++ FD   G L N +  +I  N  ++G++      + +D+S  TQ    A  F P 
Sbjct: 229 YTELDIKFDE-NGKLTNDAASSI-LNVKSAGLNGATPLDLQLDLSGITQHESDASTFEPV 286

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
           K++  GHA G   +F +  +G +   YD+G +  I ++ +A   +   L+    NT++ +
Sbjct: 287 KTD--GHAAGNYVNFQIGDNGEITANYDNGEKQLIAQVVLANFANPGGLQQNGNNTWVES 344

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   IG  G    G +  GALE +NVD+ SE+  +I  QRNY  NS+  +T S+ + 
Sbjct: 345 PQSGGSIIGMAGTGSFGSLTGGALENSNVDLGSEMVNMIVYQRNYQSNSQTIKTQSEMLQ 404

Query: 415 ILISLK 420
            L++L+
Sbjct: 405 TLVNLR 410


>gi|56695115|ref|YP_165462.1| flagellar hook protein FlgE, putative [Ruegeria pomeroyi DSS-3]
 gi|56676852|gb|AAV93518.1| flagellar hook protein FlgE, putative [Ruegeria pomeroyi DSS-3]
          Length = 431

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 127/450 (28%), Positives = 209/450 (46%), Gaps = 48/450 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++ + A ++R++ +SDNIAN  T GYKR    F +LV  S    Y +GG+
Sbjct: 1   MTISSSLNAGVAALSANASRLATISDNIANSSTYGYKRVETDFHALVNASGRGKYTAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEG 114
             +T+ +I ++GSL+ T+++TDLA++G+G   V     +        L   G F  ++EG
Sbjct: 61  RTTTQRLIDQRGSLVSTSNSTDLAVRGRGMLPVMRSSQLALPQQDMLLATTGSFRTDDEG 120

Query: 115 FLENVAGGVLLGYPLK-NASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
           +L++ AG VL+G+    + S P L  ++  GL  + +   +LS  PTT   +  NL   A
Sbjct: 121 YLKSEAGLVLMGWRANPDGSIPNLPRDTSDGLVPVQLSVNQLSGAPTTEMVLRMNLPATA 180

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSS--VVYDVYYT--KTGDKKWEVSIFR-- 226
           T              A  T   S   +D LG S  V  ++  T   TG+      I R  
Sbjct: 181 T----------EAGSAGDTQPLSVEYFDNLGKSENVQIELVPTVPATGESNEWTMILRDT 230

Query: 227 --------------QDQSTNNSFPYNVAPLNTVEVSFDPVTGYLA-NSSHKAISFNDNTS 271
                          D  T+     +V    T   ++D  TG +  N +   +  N    
Sbjct: 231 ASGGAVVGEYTLTFSDARTDGGTLASVTA--TTGGAYDATTGSVVINVAGGPMEINIGQL 288

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           G    I       TQL+  F P     +G A G      V ++G+V   +D+G    +++
Sbjct: 289 GASDGI-------TQLSDTFAPVSITKDGTAVGTMSRVEVDENGFVYAFFDNGVSRRVFQ 341

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +  +P+ + L   D  TY P+R+SG   +   G    G++ S A E +  D+A+ELT 
Sbjct: 342 IPLVDMPNPNGLVALDSQTYEPSRESGTFFLWDAGDGPTGDLVSFAREESTTDVATELTA 401

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +I+ QR Y+ ++KV QT  + +    ++KR
Sbjct: 402 MIQTQRAYSSSAKVIQTVDEMLQETTNIKR 431


>gi|163735543|ref|ZP_02142975.1| flagellar hook protein FlgE, putative [Roseobacter litoralis Och
           149]
 gi|161391163|gb|EDQ15500.1| flagellar hook protein FlgE, putative [Roseobacter litoralis Och
           149]
          Length = 416

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 126/434 (29%), Positives = 201/434 (46%), Gaps = 51/434 (11%)

Query: 21  VSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASN 80
           ++++SDNIAN  T GYKR    F S+V  S   SY +GG+  +T+ +I E+G+L+ T+++
Sbjct: 1   MASISDNIANSSTFGYKRVQTDFESMVLSSGGGSYAAGGVRANTQRLIDERGTLVSTSNS 60

Query: 81  TDLAIQGKGFFIVK--------GRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLK-N 131
           TDLA++G G   V         G D    LT  G F  + EG+L + +G VL+G+P   +
Sbjct: 61  TDLAVRGGGMLPVAQSAQVQTAGADAPMFLTTTGSFRTDAEGYLTSQSGLVLMGWPAAAD 120

Query: 132 ASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEY 190
            S P+   ++  GLE + +   +L+  PTT+  +  NL    T              A  
Sbjct: 121 GSIPVYPRDTADGLEPVRIATGQLAGNPTTSMSLGINLPATET----------EADSAGL 170

Query: 191 THKSSFAAYDTLGSSVVYDVYYTK-------TGDKKWEVSIFRQ---------------D 228
           T + S   +D LG+S    + +T             W + +F                 D
Sbjct: 171 TEQISVEYFDNLGTSQSVSITFTPDVPAPGNPATNTWTMEMFDSVNPAVSIGSYTLEFND 230

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLA-NSSHKAISFNDNTSGIDQQITIDISKTTQL 287
             T     ++V P+     ++   TG +  N +   I  +    G       D    +QL
Sbjct: 231 SRTGGGSLFDVTPIG-ASPAYSDTTGLITINVAAGPIEVDIGALG-------DTEGLSQL 282

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
           +  F P     +G A G      V  +G+V   +D G    IY++ +  VP+ + L+ FD
Sbjct: 283 SYSFAPISVTKDGSAIGNFVGVDVDPNGFVRASFDTGEIRTIYQIPLINVPNPNGLQAFD 342

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
             TYLP+R SG   +   G    G+I S A E +  D+A ELT++I+ QR Y+ N+KV Q
Sbjct: 343 SQTYLPSRQSGAFFLWNAGDGPTGDIVSFAREESTTDVAGELTDMIKTQRAYSSNAKVIQ 402

Query: 408 TGSDFMDILISLKR 421
           T  + +    ++KR
Sbjct: 403 TVDEMLQETTNIKR 416


>gi|284989548|ref|YP_003408102.1| flagellar hook-basal body protein [Geodermatophilus obscurus DSM
           43160]
 gi|284062793|gb|ADB73731.1| flagellar hook-basal body protein [Geodermatophilus obscurus DSM
           43160]
          Length = 408

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 131/436 (30%), Positives = 211/436 (48%), Gaps = 45/436 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSG 58
           +L SM +A+SG+ A   ++    +NIANV+TVGYK +   F    S +V   ++ +  +G
Sbjct: 1   MLRSMNSAISGLRAHQTKLDVTGNNIANVNTVGYKASQTVFEDTLSQVVRNGSAPTAQAG 60

Query: 59  G-------LEISTKDMIS--EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
           G       L +    + +  EQGS  +T  +TD  I G GFFI +   N    TRAG F 
Sbjct: 61  GTNPAQVGLGVKVAGITTNFEQGSAQNTGRSTDFMISGDGFFITQA-GNEQLYTRAGSFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +  G L    G +L G+   +     +VN+   + ++ V   ++   PT T        
Sbjct: 120 YDGAGNLVTPDGALLQGWMATDG----VVNTNGPIRQLTVPFGDV-MQPTET-------- 166

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            N  ++    +   NG   +    +    YD LG +    + +TKTGD  W V    +++
Sbjct: 167 DNGAVVGNLSSAAANGTGVQ----TQMTMYDALGKAHQISLSFTKTGDNTWNVVARDENE 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHK-AISFNDNTSG-IDQQITIDISKTTQL 287
           +          PL     +F+PV G L  +S    I+ + + +G    Q+TID++   Q 
Sbjct: 223 AV---LASTAGPL-----AFNPVAGTLPAASRTFQITPDASMAGSWPGQVTIDLADLRQF 274

Query: 288 AG--GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
            G  G  P +  ++G+A G  +  S+S DG V  +Y +  R PI +LA+AT  +   L  
Sbjct: 275 GGPSGLTPAR--VDGNAMGSLQSISLSGDGTVMGVYSNNLREPIGKLALATFANPGGLAK 332

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              +++    +SG  +IG PG    G + +GALE +NVD+A E T LI AQR +  NS+V
Sbjct: 333 AGNSSFRVGDNSGQPAIGEPGGGGRGSLVAGALEMSNVDLAEEFTGLIVAQRGFQANSRV 392

Query: 406 FQTGSDFMDILISLKR 421
             +  + +  L++LKR
Sbjct: 393 ISSSDEVLQDLVNLKR 408


>gi|254248705|ref|ZP_04942025.1| Flagellar hook protein FlgE [Burkholderia cenocepacia PC184]
 gi|124875206|gb|EAY65196.1| Flagellar hook protein FlgE [Burkholderia cenocepacia PC184]
          Length = 414

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 197/429 (45%), Gaps = 34/429 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYANSVATSVNTQIGIGTRLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G FH +  G + +  G  L
Sbjct: 64  VQQNFGQGTINSTKSSLDVAINGNGFFQMS-SNGVTTYSRDGTFHRDKNGAIVDAQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A A  ++N+ Q    + ++    +  P  T  I+   + NA    P KTP + 
Sbjct: 123 MGYA---AGAGGVINTAQ---TVPLQAPTSNIAPRATSRITGQFNLNAQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + SS   YDTLG S    +Y+ K     W+     Q Q+          P N 
Sbjct: 177 TDNTTYNYNSSIQVYDTLGGSQQVTMYFAKGAAGTWQAYAGVQGQT----------PTNL 226

Query: 245 VEVSFDPVTGYLANSSHKA------------ISFNDNTSGID-QQITIDISKTTQLAGGF 291
             V+FD  +G L++++  A             S    T G + Q +T+D+  TTQ  G  
Sbjct: 227 GTVTFD-ASGRLSSTTSAATGQPTPSLGQFAFSIPSTTGGANPQNLTLDLGGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    FS+  DG +   Y +G    +  +A+A   + + L    GN Y
Sbjct: 286 GVSNLAQDGFASGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNIGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG   +  PG   HG +   ALE +NV++ +EL  LI AQRNY  N++  +T   
Sbjct: 346 AETAASGVPQVSAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQTIKTQQA 405

Query: 412 FMDILISLK 420
               L++L+
Sbjct: 406 VDQALLNLR 414


>gi|167626155|ref|YP_001676449.1| flagellar hook protein FlgE [Shewanella halifaxensis HAW-EB4]
 gi|167356177|gb|ABZ78790.1| flagellar basal body FlaE domain protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 402

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 192/416 (46%), Gaps = 22/416 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  TVG++     FS++      N   +GG+ + +T
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANSSTVGFRSGRSEFSAIY-----NGGQAGGVNVMNT 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S  GSL +T    D+ IQG+GFF++ G+D      RAG F+ N +GF+ + AG  L
Sbjct: 57  SQNFSAGGSLTYTGRQLDMGIQGEGFFMLSGQDGSTTYARAGMFNQNADGFITDPAGSRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+  A+  L   +   L+   V+   L A  T+T  + +NLD     I P  TP  +
Sbjct: 117 QGYPVG-ATGNLQTGNVTDLQ---VQAGALPAKATSTVGLISNLDARVETIDPAATPFDS 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + Y   S+  AYD+LG       YY KT D  W V     D         +V P   
Sbjct: 173 DDASTYHSSSTVTAYDSLGKEHALTQYYVKTADNTWSVHYMMGDT--------DVTPAGG 224

Query: 245 VEVSFDPVTGYLANSSHKAISFND-NTSGIDQQITIDIS--KTTQLAGGFIPQKSEINGH 301
            +++FD   G L       +   D N  G    +++ +S  K+TQ A  +       NG+
Sbjct: 225 HQLNFDS-NGMLTGGQDLTLDITDPNIVGGASNMSLALSYDKSTQYASDYNNSSLSQNGY 283

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+     +   G +   Y +G      ++ +A   + + L+    N +  T  +G   
Sbjct: 284 TSGELNGIRLDDSGMLYGTYTNGQEQLQGQVVLADFNNPNGLEPVSNNAWAATNAAGQPI 343

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           IG P     G I  G LE +NVD  +E+  L+ AQRNY  N+KV  T S     L+
Sbjct: 344 IGTPTTGTLGSIAGGYLEGSNVDQTAEMVNLMTAQRNYQSNAKVLDTNSTMQQALL 399


>gi|157147102|ref|YP_001454421.1| hypothetical protein CKO_02879 [Citrobacter koseri ATCC BAA-895]
 gi|157084307|gb|ABV13985.1| hypothetical protein CKO_02879 [Citrobacter koseri ATCC BAA-895]
          Length = 396

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 198/416 (47%), Gaps = 28/416 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A SG++A + +++A+S+NIAN  TVG+K     FSSL   S        G+  S  
Sbjct: 2   SFNIATSGLNAITEQLNAISNNIANSGTVGFKSGRAEFSSLYAESQPLGVGVSGVTQS-- 59

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             I+  G++  T +  DLAI   GFF+V+        TRAG F  ++ G L N  G  L 
Sbjct: 60  --ITRGGNISTTGNALDLAISDSGFFMVRDSTGTTAYTRAGYFGTDSSGNLINNLGMYLQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+ NA+  + V +   +  + +    + A  T +   + NLD  A    P+  P +  
Sbjct: 118 GYPV-NANGEIEVGT---IGNLTISSGSIPAKATDSLDFTANLDARAA--EPETAPFNPK 171

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y +  +   +D+LG     + Y+ KTG+  W+V  +  D            P ++ 
Sbjct: 172 DSTSYNNTYTTQVFDSLGREHTLNQYFVKTGENTWQVHYYMDDVEI---------PDSSQ 222

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGID--QQITIDIS--KTTQLAGGFIPQKSEINGH 301
            + F    G L       +   + T+ I     ++ID+S   T+Q    F   K+  +G+
Sbjct: 223 AIEFTE-QGVL----KSPVGLTNLTTSISGAADLSIDLSYNGTSQYGSDFSVSKNNSSGY 277

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+    ++ +DG V   + +G R+   +L +A   + + L   DG T++ T  SG   
Sbjct: 278 ASGERTGQAIDEDGSVYATFSNGERMLQGQLVLANFANPNGLASKDGTTWVQTASSGAPL 337

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
            G PG    G + SGALE++NVD+ SEL  L+ AQRNY  N+KV  T  + M+ L 
Sbjct: 338 TGTPGTGLLGSVKSGALESSNVDLTSELVGLMTAQRNYQANTKVISTNDNMMNALF 393


>gi|83747654|ref|ZP_00944690.1| FlgE [Ralstonia solanacearum UW551]
 gi|207728346|ref|YP_002256740.1| flagellar hook protein flge [Ralstonia solanacearum MolK2]
 gi|207739737|ref|YP_002258130.1| flagellar hook protein flge [Ralstonia solanacearum IPO1609]
 gi|83725706|gb|EAP72848.1| FlgE [Ralstonia solanacearum UW551]
 gi|206591592|emb|CAQ57204.1| flagellar hook protein flge [Ralstonia solanacearum MolK2]
 gi|206593119|emb|CAQ60025.1| flagellar hook protein flge [Ralstonia solanacearum IPO1609]
          Length = 401

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 205/418 (49%), Gaps = 25/418 (5%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
           +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ +  G++++ 
Sbjct: 4   QQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDVTK 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                 QG++  T +  D+AI G GF+ +V         TR G F  +  G++ +  G  
Sbjct: 64  VSQSFTQGNVTVTGNPLDIAINGTGFYRMVDTSSGQVSYTRNGQFQTDKNGYIISATGQN 123

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY    A A   +N+   L  + +   +L+ + TT    + NLD   T+  P  TP  
Sbjct: 124 LTGYA---ADATGKINTAV-LTNLQIPVNDLAPLATTNTAFTINLDAAGTV--PTTTPFS 177

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               A Y H  S   YD  G+S +   YY +T    W+V       + + + P    P+ 
Sbjct: 178 ATNSATYNHSVSEQVYDGTGTSHMLTNYYVRTA-AGWDVY-----STVDGAAPTGGNPV- 230

Query: 244 TVEVSFDPVTGYLANSSHK-AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
              ++F+  +G L +S  K A++F    +G+    ++D + TTQ  GGF       +G+A
Sbjct: 231 -TSLTFNS-SGVLTSSPSKVAVAF----TGMSI-ASMDFTGTTQYGGGFNDTSVTQDGYA 283

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   +
Sbjct: 284 TGRLASYSVGNDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQM 343

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 344 GTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVSMR 401


>gi|91794995|ref|YP_564646.1| flagellar hook protein FlgE [Shewanella denitrificans OS217]
 gi|91716997|gb|ABE56923.1| flagellar basal body FlaE [Shewanella denitrificans OS217]
          Length = 402

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 198/418 (47%), Gaps = 26/418 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ + +  ++ +S+NIAN  TVG++     F+++      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQSTTQDLNTISNNIANSSTVGFRGGRSEFAAIY-----NGGQAGGVSVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               ++ GSL +T    D+ IQG GFF++KG D  N   RAG FH +++GF+ +  G  L
Sbjct: 57  TQNFTKGGSLTYTGRQLDMGIQGDGFFVLKGTDGANMYARAGMFHQDSQGFVVDPVGNRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY    ASA   + +   ++ + ++ A L+A  TT   + +NLD    +I P  TP   
Sbjct: 117 QGY---GASATGRIQTGNAID-LQIQTASLAAKATTDVALVSNLDARVAVIDPLVTPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
            +   +   ++ + YD+LG+      YY KTG   W V      +        +V P   
Sbjct: 173 TKSDTFHSSNTVSVYDSLGTEHAMIQYYVKTGPNDWNVHFMMDGK--------DVTPAAG 224

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNT-----SGIDQQITIDISKTTQLAGGFIPQKSEIN 299
            +++FD   G L       ++  D T     S +   I  D  K+TQ A  +       +
Sbjct: 225 HKMTFDS-NGVLQTGKTLNLAIADPTLLKGASALSFDIAYD--KSTQYAANYNNSSLRQD 281

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G   G+ K   +  +G V   Y +G  +   ++A+A   + + LK    N ++ + ++G 
Sbjct: 282 GFTSGELKGVRLDDNGLVYGTYTNGQELLQGQVALANFSNPNGLKPVSNNAWIASNEAGQ 341

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
             +G P     G +  G LE +NVD  +E+  L+ AQRNY  N+KV    S     L+
Sbjct: 342 AIMGAPSTGTMGTVTGGYLEGSNVDTTAEMVNLMSAQRNYQSNAKVLDVNSTMQQALL 399


>gi|325529014|gb|EGD06027.1| flagellar hook protein FlgE [Burkholderia sp. TJI49]
          Length = 413

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 196/418 (46%), Gaps = 18/418 (4%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEISTKD 66
            +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++  
Sbjct: 6   GLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTTLASVQ 65

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLG 126
               QG++  T+S+ D+AI G GFF +   +     TR G F  +  G++ N  G  L+G
Sbjct: 66  QQFGQGAINATSSSLDVAINGNGFFQMS-NNGAMTYTRDGTFQRDKNGYIVNAQGLNLMG 124

Query: 127 YPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           Y   KN     ++N+ Q    + ++    +  PT T  I+   + N+    P KT     
Sbjct: 125 YAADKNG----VINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDALPTKTQFDPT 177

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIFRQDQSTNNSFPYNVAPLNT 244
            +  Y + +S   YD+LG S   ++Y+ K+    +WE     Q  ST +           
Sbjct: 178 DNTTYNYSTSIQVYDSLGGSQPVNMYFVKSATSGQWEAYAGVQGGSTTDLGTVTFDSTGA 237

Query: 245 VEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           ++ +  P     A  S    +F   N++ SG  Q +T+D++ TTQ  G         +G 
Sbjct: 238 IQSTVAP--DGTATKSLGQFTFTIDNNDGSGTPQSLTLDLTGTTQYGGKDGVNNLAQDGF 295

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G    F++  DG V   Y +G    + ++A+A   + + L    GN Y+ T  SG   
Sbjct: 296 ASGTLTTFTIGNDGKVTGNYSNGQTATLGQIALANFNNPNGLVNIGGNQYVETAASGVPQ 355

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 356 ISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|241589579|ref|YP_002979604.1| protein of unknown function DUF1078 domain protein [Ralstonia
           pickettii 12D]
 gi|240868291|gb|ACS65950.1| protein of unknown function DUF1078 domain protein [Ralstonia
           pickettii 12D]
          Length = 401

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 122/419 (29%), Positives = 207/419 (49%), Gaps = 25/419 (5%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIS 63
            +  +SG+DA S  +S++  N+ANV+TVGYK++ + F  +   S    +++ +  G+ ++
Sbjct: 3   FQQGLSGLDAASKNLSSIGSNVANVNTVGYKKSTVQFGDVYARSLVGATDNQIGQGVSVT 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                  QG++  T +  D+AI G GF+ +V         TR G F  +  GF+ +  G 
Sbjct: 63  RVSQSFTQGNVTVTGNPLDIAINGMGFYRMVDSSSGQVSYTRNGQFQTDKNGFVISATGQ 122

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY + +AS  +   +   L RI V       +P  T   +  ++ NA    P  TP 
Sbjct: 123 NLTGYGV-DASGKVNTAALTNL-RIPVNDL----VPQATRNTAFGVNLNAAAAVPGATPF 176

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                A + H  S   YD  G+  +   YY +TG   W+V  + Q   T+   P +  P+
Sbjct: 177 SPTNSATFNHSVSEQVYDGTGAPHMMTNYYVRTG-AGWKV--YSQVDGTS---PVSGNPV 230

Query: 243 NTVEVSFDPVTGYLANSSHK-AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            T+  + +   G L + S K A+SF     G+    +ID + TTQ  GG+     + +G+
Sbjct: 231 TTLTFNSN---GQLTSGSTKIAVSF----PGMSIN-SIDFAGTTQYGGGYNDVMVKQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG V   Y +G      ++A+A   + + L+   GN ++ T +SG  +
Sbjct: 283 ATGRLASYSVGIDGTVTGQYSNGRSAVFGQIAMANFKAPEGLQNIGGNQWVETANSGSPN 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD++ EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 LGTPGMGSFGLLRSSAVEQSNVDLSVELVNMIVAQRSYQANAQTIKTEDSLLQTLVSIR 401


>gi|259907634|ref|YP_002647990.1| Flagellar hook protein FlgE [Erwinia pyrifoliae Ep1/96]
 gi|224963256|emb|CAX54740.1| Flagellar hook protein FlgE [Erwinia pyrifoliae Ep1/96]
 gi|283477476|emb|CAY73392.1| flgE [Erwinia pyrifoliae DSM 12163]
          Length = 410

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 117/426 (27%), Positives = 207/426 (48%), Gaps = 28/426 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A ++ +  V +NIAN  T G+K  +I F+  +F          G++++  
Sbjct: 2   SFSQGLSGLNAAASALDVVGNNIANSQTFGFKAGSIGFAD-IFAGAQGM----GVQVAGS 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV-L 124
               + G L  T  N D+ I G GFF +         +R G F  +  G++ N+  G+ L
Sbjct: 57  SQNFKDGGLTGTGRNMDMGINGNGFFRLMDEAGQAYYSRNGQFDTDVNGYITNLTNGLRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY  +    P  + +   +  I +    +  + +T+G ++ NL  +A ++T  KTP  +
Sbjct: 117 TGY--QATGTPPAIQAGAAVAPIQIDKTGMPPVASTSGKLNGNLTASAEVVT--KTPFDH 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS---TNNSFPYNVAP 241
                +   S   A+D+LG+    D+YY KT   +W+   +  D S   T+ + P   + 
Sbjct: 173 TDGETFNSSSQIEAFDSLGNRHTIDIYYVKTATGEWKA--YANDASAPVTSGTPPK--SE 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ----QITIDISKTTQL---AGGFIPQ 294
              +++ FD   G L N +  +I  N  ++G++      + +D+S  TQ    A  F P 
Sbjct: 229 YTELDIKFDE-NGKLTNDAASSI-LNVKSAGLNGATPLDLQLDLSGITQHESDASTFEPV 286

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
           K++  GHA G   +F +  +G +   YD+G +  I ++ +A   +   L+    NT++ +
Sbjct: 287 KTD--GHAAGNYVNFQIGDNGEITANYDNGEKQLIAQVVLANFANPGGLQQNGNNTWVES 344

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   IG  G    G +  GALE +NVD+ SE+  +I  QRNY  NS+  +T S+ + 
Sbjct: 345 PQSGGSIIGTAGTGSFGSLTGGALENSNVDLGSEMVNMIVYQRNYQSNSQTIKTQSEMLQ 404

Query: 415 ILISLK 420
            L++L+
Sbjct: 405 TLVNLR 410


>gi|300693338|ref|YP_003749311.1| flagellar hook protein flge [Ralstonia solanacearum PSI07]
 gi|299075375|emb|CBJ34670.1| flagellar hook protein FlgE [Ralstonia solanacearum PSI07]
          Length = 401

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 205/418 (49%), Gaps = 25/418 (5%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
           +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ +  G++++ 
Sbjct: 4   QQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDVTK 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                 QG++  T +  D+AI G GF+ +V         TR G F  +  G++ +  G  
Sbjct: 64  VSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATGQN 123

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY +    A   +N+   L  + +   +L+ + TT    + NLD  AT+  P  TP  
Sbjct: 124 LTGYGVD---ATGKINTAV-LTNLQIPVNDLAPLATTNTAFTINLDAAATV--PTTTPFS 177

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               A + H  S   YD  G+S +   YY +T    W+V  + Q    N   P    P+ 
Sbjct: 178 ATNSATFNHSVSEQVYDGTGTSHMLTNYYVRTA-TGWDV--YSQVDGAN---PTGGNPV- 230

Query: 244 TVEVSFDPVTGYLANSSHK-AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
              ++F+  +G L +S  K A++F    +G+     +D + TTQ  GGF       +G+A
Sbjct: 231 -TSLTFNS-SGTLTSSPSKVAVAF----AGMSI-ANMDFTGTTQYGGGFNDTTVSQDGYA 283

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   +
Sbjct: 284 TGRLASYSVGTDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQM 343

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 344 GTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVSMR 401


>gi|260768782|ref|ZP_05877716.1| flagellar hook protein FlgE [Vibrio furnissii CIP 102972]
 gi|260616812|gb|EEX41997.1| flagellar hook protein FlgE [Vibrio furnissii CIP 102972]
          Length = 397

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 124/411 (30%), Positives = 193/411 (46%), Gaps = 25/411 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG++A +  ++ +S+NIANV T G+K +   F S+      N   +GG+++   
Sbjct: 2   SFNIALSGLNASNQELNTISNNIANVSTTGFKESRTEFGSVY-----NGQQAGGVQVMGI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                  GS+  T  + D+A+ G GFF+V+ ++     TR+G F ++++G + +  GG L
Sbjct: 57  SQNFEATGSMSATGRSLDMALTGSGFFVVQDKNGQLSYTRSGVFGLDSQGNVISNTGGSL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L+  S   L+   V  + L A  T     + NLD     I   + P   
Sbjct: 117 QGYTV-DGNNNLLAGSMGPLK---VDMSSLEAKATNKVDFAANLDDRVDAIDTKENPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV-SIFRQDQSTNNSFPYNVAPLN 243
                Y +  +   YD+ G+      Y+ KTGD  WE+ SI   D ST          L 
Sbjct: 173 KNVDSYNNSYTTPVYDSKGNEHTLTQYFVKTGDNTWEIHSIVDGDTST----------LT 222

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGHA 302
           T   +FD   G L  +S  A + + + +G D   IT+D++  +Q    F+  K+  NG+ 
Sbjct: 223 TTPATFDS-KGNL--TSATAYTISASAAGADTLNITVDMTNLSQYGSDFVVSKNNPNGYT 279

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G   D  V  +G V   Y +G  +   +L +A   +   L       +  T  SG    
Sbjct: 280 SGSFTDIRVEANGMVYATYSNGQSLLQGQLVLANFNAPQELMQTSNTAWTQTYGSGQPVY 339

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           G PG  Q GE+ SG LE +NVD+ SEL  L+ AQRNY  N+K   T    M
Sbjct: 340 GIPGSGQFGELASGVLEGSNVDLTSELVHLMSAQRNYQANTKTITTADQLM 390


>gi|310816852|ref|YP_003964816.1| flagellar hook protein FlgE [Ketogulonicigenium vulgare Y25]
 gi|308755587|gb|ADO43516.1| flagellar hook protein FlgE [Ketogulonicigenium vulgare Y25]
          Length = 432

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 125/449 (27%), Positives = 203/449 (45%), Gaps = 45/449 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  SM   ++G+ A +N+++ +SDNIAN  T GYKR    F ++V  S+S  Y +GG+
Sbjct: 1   MSISSSMNAGVAGLSANANKLATISDNIANSSTNGYKRAQTEFYAMVIGSSSTKYTAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-------LTRAGDFHINNE 113
             +   +I E+G L+ T++ TD+AI G+GF  V     +         +T  G F  N  
Sbjct: 61  RTTATRVIDERGPLVSTSNATDIAISGRGFLPVTTLSAIEAGGALPFQMTTTGSFSPNAA 120

Query: 114 GFLENVAGGVLLGYPLKNASA--PLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G+L   +G VL+G+   +  +      ++  GL  + V   ++   PTT   ++ NL   
Sbjct: 121 GYLTTASGHVLMGWAADSTGSIGTQSRDTTSGLTPVRVLTNQVVGSPTTQLTLAANLP-- 178

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT----KTGDK-KWEVSIFR 226
           AT      T     +  EY        YD LG +    V Y      TG+   W V I+ 
Sbjct: 179 ATSTEAGATGTVETQVIEY--------YDNLGKTKTLSVNYIPTVPATGESNTWTVEIYD 230

Query: 227 QDQSTNNSFPYNVA----------PLNTVEVS---FDPVTGYLA-NSSHKAISFNDNTSG 272
             Q       Y++            L+   ++   +DP TG ++ + +   ++ N    G
Sbjct: 231 DAQGGALVGTYDLVFDDSRTGGGRLLSVTTIAGGPYDPATGLMSIDVASGPLTINLGVPG 290

Query: 273 IDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRL 332
                       TQL+ GF P     +G   G      V   G +   Y +G    +Y++
Sbjct: 291 -------QADGMTQLSDGFAPVAVTRDGAPSGTLTGVEVDASGKLYGTYSNGLTRLLYQI 343

Query: 333 AIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTEL 392
            +  VP+ + L+     TY  ++DSG   +   G    GE+   A E + VD+A+ELT++
Sbjct: 344 PVVDVPNVNGLQALGSQTYAVSQDSGAFFLWDAGAGPTGEMLGYASEGSAVDVATELTQM 403

Query: 393 IEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           I+ QR Y+ N+KV QT  + +    +LKR
Sbjct: 404 IQTQRAYSSNAKVIQTVDEMLQETTNLKR 432


>gi|78067837|ref|YP_370606.1| flagellar hook protein FlgE [Burkholderia sp. 383]
 gi|77968582|gb|ABB09962.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 413

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 119/428 (27%), Positives = 203/428 (47%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   F+ +      +++N+ +  G  ++ 
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFADMYANSVATSTNTQIGIGTSLNA 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T+S+ D+AI G GFF +   + V   +R G F  +  GF+ +  G  L
Sbjct: 64  VQQNFGQGTINTTSSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGFIVDSQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+A  ++N+ Q    + ++    +  PT T  IS   + N+   TP KTP   
Sbjct: 123 MGYA---ANAGGVINTAQ---TVPLQAPTTNIAPTATTKISAQFNLNSQDTTPTKTPFSA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + +S   YD+LG S   ++Y+ K+    WE     Q  ST +        L T
Sbjct: 177 TDNTTYNYSTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGSTTD--------LGT 228

Query: 245 VEVSFDPVTGYLANSSHKAISF-------------NDNTSGIDQQITIDISKTTQLAGGF 291
           V  +FD  +G + +++    +              N + S   Q +T+D++ TTQ  G  
Sbjct: 229 V--TFDS-SGAIKSTTTGTPATPTTSVGQFQFTVPNTDGSATPQSLTLDLTGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G+A G    +++  DG +   Y +G    +  +A+A   + + L    GN Y
Sbjct: 286 GVNNLAQDGYASGTLTTYTIGADGKLTGNYSNGQTAVLGEIALANFNNPNGLVNLGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             +  SG   I  PG   HG++   ALE +NVD+ S+L  LI AQRNY  N++  +T   
Sbjct: 346 AESAASGVPQISAPGSTNHGKLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQA 405

Query: 412 FMDILISL 419
               +I+L
Sbjct: 406 VDQTIINL 413


>gi|115353118|ref|YP_774957.1| flagellar hook protein FlgE [Burkholderia ambifaria AMMD]
 gi|115283106|gb|ABI88623.1| flagellar basal body FlaE domain protein [Burkholderia ambifaria
           AMMD]
          Length = 413

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 126/428 (29%), Positives = 196/428 (45%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +S+
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTALSS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNAQGLNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     +VN+ Q    + ++    +  PT T  I+   + N+    P KTP  
Sbjct: 123 MGYLADKNG----VVNTAQ---TVPLQAPTTNISPTATTKITGQFNLNSQDKVPTKTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               + Y + +S   YD+LG S   ++Y+ K+    WE     Q  +T +        L 
Sbjct: 176 ATDTSTYNYSTSVQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATTD--------LG 227

Query: 244 TVEVSFDP-------VTGYLANSSHKAISFNDNTSGID-----QQITIDISKTTQLAGGF 291
           TV  +FD         TG  A  +     F       D     Q +T+D++ TTQ  G  
Sbjct: 228 TV--TFDSSGAIKSTTTGTPAVPTTSVGQFQFTVPTTDGSTTPQPLTLDLTGTTQFGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G+A G    FS+  DG +   Y +G    + ++AIA   + + L    GN Y
Sbjct: 286 GVNNLAQDGYASGTLTTFSIGADGKLTGNYSNGQTAVLGQIAIANFNNPNGLVNLGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T   
Sbjct: 346 AETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQT 405

Query: 412 FMDILISL 419
               LI+L
Sbjct: 406 VDQTLINL 413


>gi|238762359|ref|ZP_04623330.1| Lateral flagellar hook protein (FlgE-like) [Yersinia kristensenii
           ATCC 33638]
 gi|238699344|gb|EEP92090.1| Lateral flagellar hook protein (FlgE-like) [Yersinia kristensenii
           ATCC 33638]
          Length = 397

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 127/421 (30%), Positives = 197/421 (46%), Gaps = 33/421 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY-VSGGLEIST 64
           S   A +G+ A + +++ +S+NIAN  T G+K     FSS+   S      VSG     T
Sbjct: 2   SFSIANTGLSAVTEQLNTISNNIANSATKGFKSGRTEFSSMYAQSQPLGVGVSG-----T 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              I ++GS+  T +  DLAI G GFF+VK  +     TRAG F  +N G L N +G  L
Sbjct: 57  SQSIRKEGSIDRTGNAMDLAISGNGFFVVKNSNGDEAYTRAGMFTTDNNGLLVNASGMKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY   +A+  +   +   L+         S +P      S+ LD  A +   D  P + 
Sbjct: 117 QGYS-ADATGNIQTGTIGDLK------ISTSGLPAKA---SSKLDFMANLPASDTPPTNR 166

Query: 185 ----GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTNNSFPYNV 239
                 +  Y + S+  AYD+LG   +   Y+ K+    +W+V               +V
Sbjct: 167 IFSPSNEDSYNYMSTSTAYDSLGREHLLTQYFVKSSAPSEWKVHTALD----------SV 216

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEI 298
               + ++ FD  +G L + + + IS   + +G D   I I+ + TTQ    F+P  ++ 
Sbjct: 217 LKTGSHDLKFD-TSGVLTSGNTQNISGTYSPAGADNFSIDINYTGTTQFQSAFLPTVNKS 275

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+  G      V  DG V   + +G R+   +LA+A   + + L   +G T+  T  SG
Sbjct: 276 NGYTAGTKNGERVESDGSVFATFSNGERMLQGKLALANFANANGLAAQNGTTWSATSKSG 335

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
              +G PG    G I  GALE +NVD+ +EL  L+ AQRNY  N+K+  T    M+ L  
Sbjct: 336 AALLGAPGTGLLGGIEVGALEASNVDLTAELVGLMTAQRNYQANTKIISTNDSMMNALFQ 395

Query: 419 L 419
           +
Sbjct: 396 V 396


>gi|114765247|ref|ZP_01444379.1| putative flagellar hook protein [Pelagibaca bermudensis HTCC2601]
 gi|114542382|gb|EAU45410.1| putative flagellar hook protein [Roseovarius sp. HTCC2601]
          Length = 433

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 135/454 (29%), Positives = 212/454 (46%), Gaps = 54/454 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  +M + +SG+ A S  V  +S NIAN DTVGY+R   +FS +V   ++++  S   
Sbjct: 1   MSISNAMASGVSGLMANSKAVEKISYNIANADTVGYRR---SFSQMVTSGSTSASGSFST 57

Query: 61  EISTKDMISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNV-----NCLTRAGDFHINNE 113
            ++T+   S   +GS M T+ N++L I G GFF+V    +      N  TR G F  + +
Sbjct: 58  GVATEVTHSNTAEGSFMDTSVNSNLTITGSGFFVVNSNIDASYTAGNMFTRVGSFEPDED 117

Query: 114 GFLENVAGGVLLGYPLKNASAPLIVN--SFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G L N AG  L+G+   +      V+  SF  LE +N+ +  +S   TT   IS NL   
Sbjct: 118 GNLVNAAGLYLMGFGYGDDGTLGAVDRASFNDLEPVNIANQTISGTATTAVSISGNLPSQ 177

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFR---- 226
            T +    TP     DA  T    F A   LG S    + +  +  D +W V++      
Sbjct: 178 ETGL---DTPG----DAFVTSAEYFNA---LGESERLTLSFQPSVNDDEWVVTVSDATTE 227

Query: 227 --------QDQSTNNSFP-----YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI 273
                    D   N   P       V        +FDP TG +       ++ ++ T   
Sbjct: 228 YGTVTMSFNDTGENAGAPAAYGDVTVTAAAPAGFAFDPATGEMT------LTIDNGTE-- 279

Query: 274 DQQITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
            Q +T+ +         TQ +G + P     NG   G        + G V  ++D+GTR 
Sbjct: 280 PQVVTMALGAPGSFEGLTQFSGDYTPMTVRPNGSESGTLTRVEFDEFGDVWGVFDNGTRK 339

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
            +Y + +AT  + + L+  + +T+  +  SG   +G PG  + G + SG +E+ANVDIA 
Sbjct: 340 ALYSIPLATFANPNGLETSNNSTFHTSNTSGSYYLGQPGTGETGTMTSGGVESANVDIAE 399

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ELT LI+ QR Y+ N+K+  T  + ++  ++LKR
Sbjct: 400 ELTSLIQRQRAYSSNAKIITTADEMLNETVNLKR 433


>gi|206562843|ref|YP_002233606.1| flagellar hook protein FlgE [Burkholderia cenocepacia J2315]
 gi|198038883|emb|CAR54845.1| flagellar hook protein 2 FlgE2 [Burkholderia cenocepacia J2315]
          Length = 414

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 198/429 (46%), Gaps = 34/429 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYANSVATSVNTQIGIGTRLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G FH +  G + +  G  L
Sbjct: 64  VQQNFGQGTINSTKSSLDVAINGNGFFQMS-SNGVTTYSRDGTFHRDKNGAIVDAQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A A  ++N+ Q    + ++    +  P  T  I+   + NA    P KTP + 
Sbjct: 123 MGYA---AGAGGVINTAQ---TVPLQAPTNNIAPRATSKITGQFNLNAQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + SS   YDTLG S    +Y+ K+    W      Q Q+          P N 
Sbjct: 177 TDNTTYNYNSSIQVYDTLGGSQQVTMYFAKSAAGTWLAYAGVQGQT----------PTNL 226

Query: 245 VEVSFDPVTGYLANSSHKA------------ISFNDNTSGID-QQITIDISKTTQLAGGF 291
             V+FD  +G +++++  A             S  + T G + Q +T+D+  TTQ  G  
Sbjct: 227 GTVTFD-ASGRISSTTSAATGQPTPSLGQFAFSIPNTTGGANPQNLTLDLGGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    FS+  DG +   Y +G    +  +A+A   + + L    GN Y
Sbjct: 286 GVTNLAQDGFASGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNIGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG   I  PG   HG +   ALE +NV++ +EL  LI AQRNY  N++  +T   
Sbjct: 346 AETAASGVPQIAAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQTIKTQQA 405

Query: 412 FMDILISLK 420
               L++L+
Sbjct: 406 VDQTLLNLR 414


>gi|315180485|gb|ADT87399.1| flagellar hook protein E [Vibrio furnissii NCTC 11218]
          Length = 397

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 124/411 (30%), Positives = 193/411 (46%), Gaps = 25/411 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG++A +  ++ +S+NIANV T G+K +   F S+      N   +GG+++   
Sbjct: 2   SFNIALSGLNASNQELNTISNNIANVSTTGFKESRTEFGSVY-----NGQQAGGVQVMGI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                  GS+  T  + D+A+ G GFF+V+ ++     TR+G F ++++G + +  GG L
Sbjct: 57  SQNFEATGSMSATGRSLDMALTGSGFFVVQDKNGQLSYTRSGVFGLDSQGNVISNTGGSL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L+  S   L+   V  + L A  T     + NLD     I   + P   
Sbjct: 117 QGYTV-DGNNNLLAGSMGPLK---VDMSSLEAKATNKVDFAANLDDRVDAIDTTENPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV-SIFRQDQSTNNSFPYNVAPLN 243
                Y +  +   YD+ G+      Y+ KTGD  WE+ SI   D ST          L 
Sbjct: 173 KNVDSYNNSYTTPVYDSKGNEHTLTQYFVKTGDNTWEIHSIVDGDTST----------LT 222

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGHA 302
           T   +FD   G L  +S  A + + + +G D   IT+D++  +Q    F+  K+  NG+ 
Sbjct: 223 TTPATFDS-KGNL--TSATAYTISASAAGADTLNITVDMTNLSQYGSDFVVSKNNPNGYT 279

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G   D  V  +G V   Y +G  +   +L +A   +   L       +  T  SG    
Sbjct: 280 SGSFTDIRVEANGMVYATYSNGQSLLQGQLVLANFNAPQELMQTSNTAWTQTYGSGQPVY 339

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           G PG  Q GE+ SG LE +NVD+ SEL  L+ AQRNY  N+K   T    M
Sbjct: 340 GIPGSGQFGELASGVLEGSNVDLTSELVHLMSAQRNYQANTKTITTADQLM 390


>gi|312876506|ref|ZP_07736489.1| fagellar hook-basal body protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796717|gb|EFR13063.1| fagellar hook-basal body protein [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 494

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 132/498 (26%), Positives = 214/498 (42%), Gaps = 83/498 (16%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S VF S   S        
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFAS-VFASVLKSASAPDTAS 59

Query: 55  --------YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAG 106
                    +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG
Sbjct: 60  GRGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAG 119

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINV-KHAELSAMPTTTGFIS 165
           +F ++  G L    G  +LG+     +    +++ +   +IN+     LS   T    + 
Sbjct: 120 NFSLDKMGNLVTATGLNVLGWMYDPENKQ--IDTTKSPSKINILAFPTLSPQATDQIILD 177

Query: 166 NNLDKNATII----------TPDKTPKHNGRDA------------------------EYT 191
            NLD N  I+            DK  K  G D                         +  
Sbjct: 178 GNLDSNKKIVEIQYDNDGNGKIDKDEKLTGEDVYNKIKDPSMSVLDKYQKILNKIGDDMK 237

Query: 192 HKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY---NVAPLNTVEVS 248
              SF  +D+ G      + + K    KW   I    + ++N   Y   N+   NT  ++
Sbjct: 238 SSISFRIFDSQGGEHTLSLTFVKYDSNKW-FWIIDSPRKSDNYAKYLDDNIEGANTNFIA 296

Query: 249 FDPV------------------------TGYLANSSHKAISFNDNTSGIDQQITI-DISK 283
           F  +                        T    N+S   I+F+ +    D+ + I     
Sbjct: 297 FGRIEFDSKGQVINVQLEGAQNQNSNKFTIKFKNNSLDEITFDTSIGNTDETLNIFKFDY 356

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
             Q + G   +  +I+G+A G  + F+V   G +  +Y +G    I ++A+AT  +   L
Sbjct: 357 IKQYSLGSSIRTKKISGYAAGSLQGFNVDATGKIIGVYSNGLNQIIGQIAVATFANPAGL 416

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
           +    N Y+ T +SGD  IG PG    G IF G LE +NVD+A E T++I  QR Y  N+
Sbjct: 417 QRIGDNLYINTPNSGDPEIGIPGTGSRGTIFQGTLEMSNVDLAKEFTDMIVTQRGYQANA 476

Query: 404 KVFQTGSDFMDILISLKR 421
           +V     + +  L+++KR
Sbjct: 477 RVITASDELLQDLVNIKR 494


>gi|294675564|ref|YP_003576179.1| flagellar hook protein FlgE [Rhodobacter capsulatus SB 1003]
 gi|294474384|gb|ADE83772.1| flagellar hook protein FlgE [Rhodobacter capsulatus SB 1003]
          Length = 452

 Score =  149 bits (376), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 131/464 (28%), Positives = 210/464 (45%), Gaps = 55/464 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--PSTSNSYVSG 58
           M I  S+   ++G+ A + R++ +SDNIAN  T GYKR    F S+V     +S +Y +G
Sbjct: 1   MSISSSLNAGVAGLAANATRLATISDNIANSGTYGYKRATADFESMVLTQARSSGTYSAG 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--------DNVNCLTRAGDFHI 110
           G+  S+  +I ++GSL+ T++  D+AI G+GF  V           D    +T  G FH 
Sbjct: 61  GVRASSGRLIDQRGSLIGTSNAMDIAISGRGFLPVANTSALANGLGDQPLTMTSTGSFHT 120

Query: 111 NNEGFLENVAGGVLLGYP-LKNASAPL-IVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           + +G L   +G VLLG+  L + + P+   ++  GL+ + +   + +  PTT      NL
Sbjct: 121 DKDGVLRTDSGLVLLGWAALADGTIPVNARDTVTGLQPVVINANQTAGDPTTVMNWGINL 180

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----GD---KKWE 221
             + T  T              T  SS   +  LG+S    V +T T    GD    +W 
Sbjct: 181 PASETADTA----------GGETLTSSIEYFGNLGNSNTLQVSFTPTIPAAGDPDSNQWT 230

Query: 222 VSIFRQDQSTNNSFPYNVAPLNTVEVSFD-------------PVTGYLANSSHKAISFND 268
           ++I R   +T + +   V  +    + FD              + G   +S+   ++F D
Sbjct: 231 MTI-RDSATTTDPYGLGVGVVGQYTLDFDNTGTNGGTLSNVTTIQGPAWDSTEGTLNFTD 289

Query: 269 NTSGID-----QQITIDISKT------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYV 317
             SG       Q ITI I K       TQLA  F P     +G   G      + ++G++
Sbjct: 290 -ASGFALADGLQDITITIGKQGDTNGLTQLASDFAPTSINKDGSPVGNLTSVEIDENGFI 348

Query: 318 DIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGA 377
              YD G    +Y++ +  V + + L   D  T+  +  SG   +   G    G +   A
Sbjct: 349 KATYDTGFIRTVYQVPLVDVSNINGLTALDNQTFQVSSTSGSFYLWDAGDGPTGAVEGYA 408

Query: 378 LETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            E + VD+A ELT LI+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 409 REGSAVDVAQELTNLIQTQRAYSSNAKVIQTVDEMLQETTNIKR 452


>gi|300696913|ref|YP_003747574.1| flagellar hook protein FlgE [Ralstonia solanacearum CFBP2957]
 gi|299073637|emb|CBJ53157.1| flagellar hook protein FlgE [Ralstonia solanacearum CFBP2957]
          Length = 401

 Score =  149 bits (376), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 204/418 (48%), Gaps = 25/418 (5%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
           +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ +  G++++ 
Sbjct: 4   QQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDVTK 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                 QG++  T +  D+AI G GF+ +V         TR G F  +  G++ +  G  
Sbjct: 64  VSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATGQN 123

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY    A A   +N+   L  + +   +L+ + TT    S NLD   T+  P  TP  
Sbjct: 124 LTGYA---ADATGKINTAV-LTNLQIPVNDLAPLATTNTAFSINLDAAGTV--PTTTPFS 177

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               + Y H  S   YD  G+S +   YY +T    W+V       + + + P    P+ 
Sbjct: 178 ATDSSTYNHSVSEQVYDGTGTSHMLTNYYVRTA-SGWDVY-----STVDGAAPTGGNPV- 230

Query: 244 TVEVSFDPVTGYLANS-SHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
              ++F+  +G L +S S  A++F    +G+     +D + TTQ  GGF       +G+A
Sbjct: 231 -TSLTFNS-SGVLTSSPSTVAVAF----TGMSI-ANMDFTGTTQYGGGFNDTSVTQDGYA 283

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   +
Sbjct: 284 TGRLASYSVGNDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQM 343

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 344 GTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVSMR 401


>gi|146341767|ref|YP_001206815.1| flagellar hook protein FlgE [Bradyrhizobium sp. ORS278]
 gi|146194573|emb|CAL78598.1| putative flagellar hook protein FlgE [Bradyrhizobium sp. ORS278]
          Length = 415

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 138/437 (31%), Positives = 202/437 (46%), Gaps = 38/437 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV-FPSTSNSYVSGG 59
           M + G++ +A+S ++AQS+ ++ +SDNI+N DT GYK T+  F  LV   S+S +Y SGG
Sbjct: 1   MSLSGALSSAISALNAQSSSLAMISDNISNADTTGYKTTSGLFEQLVTASSSSKAYSSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC---LTRAGDFHINNEGFL 116
           + +S +  I++QG L  T + TD+AIQG GFF+             TR G F  +N G++
Sbjct: 61  VSVSGRSNITQQGLLAATTNATDVAIQGSGFFVATSSTAAGGETFYTRNGAFTTDNAGYI 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           EN  G  L G+   +AS  ++     GLE IN K A  +   TT   ++ NL        
Sbjct: 121 EN-NGYYLEGWR-TDASGNVV---GSGLEPINTKVALTNGGATTKTSLAANL-------- 167

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK----TGDKKWEVSIF--RQDQS 230
               P     +A  T  SS   YD+LG +   DV +TK    T   +W   I      + 
Sbjct: 168 ----PADAADNA--TFSSSMTVYDSLGQAHTMDVTWTKVATSTASNEWTAQIAPATSSEG 221

Query: 231 TNNSFPYNV-----APLNTVE-VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT 284
           T  S  Y +       LN V   S        A  S  A+SF     G D    +    T
Sbjct: 222 TVTSGTYTIDFNSDGSLNKVSSTSLGIQWKNGAADSTIALSFGTTGGGTDGLTQLSSGST 281

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           T     F    +  +G + G     SV K G V+  Y +G  VPIY++A+AT    + L 
Sbjct: 282 TPSVSNF---SANSDGISFGTLSSISVGKSGLVEATYSNGQTVPIYKIAVATFADPNGLV 338

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
                 Y  T  SG+ ++   G N  G I+   LE++  D   + + +I AQ+ Y+  S+
Sbjct: 339 AHSSGMYTSTATSGNATLQASGENGAGTIYGSELESSTTDTTGQFSNMISAQQAYSAASQ 398

Query: 405 VFQTGSDFMDILISLKR 421
           V    +   D LIS  R
Sbjct: 399 VVSAVNKMYDTLISSMR 415


>gi|254251191|ref|ZP_04944509.1| flagellar hook protein FlgE [Burkholderia dolosa AUO158]
 gi|124893800|gb|EAY67680.1| flagellar hook protein FlgE [Burkholderia dolosa AUO158]
          Length = 413

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 120/427 (28%), Positives = 200/427 (46%), Gaps = 32/427 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTTLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   TR G F  +  G++ N  G  L
Sbjct: 64  VQQQFAQGTINTTNSSLDVAINGNGFFQMS-NNGVITYTRDGTFQRDKNGYIVNSQGMNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A A  ++N+ Q    + ++    +  PT T  I+   + N+    P KTP   
Sbjct: 123 MGYA---AGANGVINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDKVPTKTPFDP 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + +S   YD+LG S   ++Y+ K+    WE     Q  +  +        L T
Sbjct: 177 TDNTTYNYSTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGTATD--------LGT 228

Query: 245 VEVSFD---PVTGY-LANSSHKAISF--------NDNTSGIDQQITIDISKTTQLAGGFI 292
           +  +FD    ++G  L  S+    +         N + S   Q +T+D++ TTQ  G   
Sbjct: 229 I--TFDTSGAISGTTLPGSTTPTTTLGQFQFTVPNTDGSATPQSLTLDLTGTTQYGGKDG 286

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 NG+A G    +++  DG +   Y +G    + ++AIA   + + L    GN ++
Sbjct: 287 VNNLAQNGYASGTLTTYTIGADGKLTGNYSNGQTAVLGQIAIANFNNPNGLVAIGGNQFV 346

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T    
Sbjct: 347 ETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTV 406

Query: 413 MDILISL 419
              LI+L
Sbjct: 407 DQTLINL 413


>gi|17548566|ref|NP_521906.1| flagellar hook protein FlgE [Ralstonia solanacearum GMI1000]
 gi|17430814|emb|CAD17496.1| probable flagellar hook protein flge [Ralstonia solanacearum
           GMI1000]
          Length = 401

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 204/418 (48%), Gaps = 25/418 (5%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
           +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ +  G++++ 
Sbjct: 4   QQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDVTK 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                 QG++  T +  D+AI G GF+ +V         TR G F  +  G++ +  G  
Sbjct: 64  VSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATGQN 123

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY +    A   +N+   L  + +   +L+ + TT    S NLD   T+  P  TP  
Sbjct: 124 LTGYGVD---ATGKINTAV-LTNLQIPVNDLAPLATTNTAFSINLDAAGTV--PTTTPFS 177

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               A + H  S   YD  G+S +   YY +T    W+V  + Q    N   P    P+ 
Sbjct: 178 ATNSATFNHSVSEQVYDGTGTSHMLTNYYVRTA-AGWDV--YSQVDGAN---PTGGNPV- 230

Query: 244 TVEVSFDPVTGYLANSSHK-AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
              ++F+  +G L +S  K A++F    +G+     +D + TTQ  GGF       +G+A
Sbjct: 231 -TSLTFNS-SGVLTSSPSKVAVAF----AGMSI-ANMDFTGTTQYGGGFNDTTVSQDGYA 283

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   +
Sbjct: 284 TGRLASYSVGTDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGAPQM 343

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 344 GTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDTILQTLVSMR 401


>gi|89056664|ref|YP_512115.1| hypothetical protein Jann_4173 [Jannaschia sp. CCS1]
 gi|88866213|gb|ABD57090.1| flagellar hook protein FlgE putative [Jannaschia sp. CCS1]
          Length = 452

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 125/447 (27%), Positives = 206/447 (46%), Gaps = 60/447 (13%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+   ++R++ ++DNIAN  T GYKR    FSS+V      +Y +GG+
Sbjct: 14  MTISSSLNAGVAGLSVNASRLATIADNIANSGTNGYKRATADFSSMVIDQGGGTYSAGGV 73

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC---------LTRAGDFHIN 111
            ++T  +I + G+L  T + TDLA++G+GF  V     VN          L   G F  +
Sbjct: 74  RVTTGRLIDQSGALATTNNGTDLAVRGRGFLPVTRSSAVNAAAGAELPLYLATTGSFRTD 133

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSF-----QGLERINVKHAELSAMPTTTGFISN 166
            +G+L   +G  L+G+P   A A   V SF      GLE + V   + ++ PTT   +  
Sbjct: 134 ADGYLVTSSGVTLMGWP---ADADGNVPSFPRDTSAGLEPVQVNVNQFTSEPTTRISLGV 190

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----GDKK--- 219
           NL         D T + +G     T + S   +D LG+S   + ++T T    GD     
Sbjct: 191 NLPGT------DTTSESSGD----TRQLSVEYFDNLGTSQSIEAFFTPTVPVVGDPASNT 240

Query: 220 WEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVT---GYLANSSHKAISFNDNTSGIDQQ 276
           W +++  +D ++NN      A +    V FD      G + + S          S  +  
Sbjct: 241 WTMTL--RDSASNN------AVIGEYTVVFDDSRTGGGTIQSVSQPLPVTGGGWSATEGT 292

Query: 277 ITIDI---------------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIY 321
           +T+D+               S  TQL+  F P     +G   G      V  +G+V   +
Sbjct: 293 LTVDVLGGPIEINIGAQGSGSGLTQLSDNFAPTSISKDGSPVGNLVSVEVDPNGFVKANF 352

Query: 322 DDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETA 381
           D G    +Y++ +  +P+ + L   D   Y  + +SG   +   G    G++ + ALE +
Sbjct: 353 DVGITRTVYQIPLIDLPNPNGLIAEDNQLYTTSAESGSFFLWDAGDGPTGDVVAFALEES 412

Query: 382 NVDIASELTELIEAQRNYAVNSKVFQT 408
             D+A+ELT+LI+ QR Y+ N+K+ QT
Sbjct: 413 TTDVAAELTQLIQTQRAYSSNAKIIQT 439


>gi|312792656|ref|YP_004025579.1| fagellar hook-basal body protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179796|gb|ADQ39966.1| fagellar hook-basal body protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 494

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 135/500 (27%), Positives = 213/500 (42%), Gaps = 87/500 (17%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S VF S   S        
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFAS-VFASVLKSASAPDTAS 59

Query: 55  --------YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAG 106
                    +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG
Sbjct: 60  GRGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAG 119

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINV-KHAELSAMPTTTGFIS 165
           +F ++  G L    G  +LG+     +    +++ +   +IN+     LS   T    + 
Sbjct: 120 NFSLDKMGNLVTATGLNVLGWMYDPVNKQ--IDTTKSPSKINILAFPTLSPQATDQIILD 177

Query: 166 NNLDKNATII----------TPDKTPKHNGRDAEYTHKS--------------------- 194
            NLD N  I+            DK  K  G D     K                      
Sbjct: 178 GNLDSNKKIVEIQYDNDGNGKIDKDEKLTGEDVYNKIKDPSMSVLDKYQKILNKIGDDMK 237

Query: 195 ---SFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY---NVAPLNTVEVS 248
              SF  +D+ G      + + K    KW   I    +  NN   Y   N+   NT  ++
Sbjct: 238 SSISFRIFDSQGGEHTLSLTFVKYDSNKW-FWIIDSPRKNNNYTEYLDDNIEGANTNFIA 296

Query: 249 FDPV------------------------TGYLANSSHKAISFNDNTSGIDQQITI---DI 281
           F  +                        T    N+S   I+F+ +    D+ + I   D 
Sbjct: 297 FGRIEFDSKGQVINVQLEGAQNQNSNKFTIKFKNNSLDEITFDTSIGNTDETLNIFKFDY 356

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
            K   L      +K  ++G+A G  + F+V   G +  +Y +G    I ++A+AT  +  
Sbjct: 357 IKQYSLDSSIRAKK--VSGYAAGSLQGFNVDATGKIIGVYSNGLNQIIGQIAVATFANPA 414

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+    N Y+ T +SGD  IG PG    G IF G LE +NVD+A E T++I  QR Y  
Sbjct: 415 GLQRIGDNLYINTPNSGDPEIGIPGTGSRGTIFQGTLEMSNVDLAKEFTDMIVTQRGYQA 474

Query: 402 NSKVFQTGSDFMDILISLKR 421
           N++V     + +  L+++KR
Sbjct: 475 NARVITASDELLQDLVNIKR 494


>gi|292489133|ref|YP_003532020.1| flagellar hook protein FlgE [Erwinia amylovora CFBP1430]
 gi|292900252|ref|YP_003539621.1| flagellar hook protein [Erwinia amylovora ATCC 49946]
 gi|291200100|emb|CBJ47226.1| flagellar hook protein [Erwinia amylovora ATCC 49946]
 gi|291554567|emb|CBA22181.1| Flagellar hook protein flgE [Erwinia amylovora CFBP1430]
 gi|312173291|emb|CBX81546.1| Flagellar hook protein flgE [Erwinia amylovora ATCC BAA-2158]
          Length = 410

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 117/426 (27%), Positives = 207/426 (48%), Gaps = 28/426 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A ++ +  V +NIAN  T G+K  +I F+  +F          G++++  
Sbjct: 2   SFSQGLSGLNAAASALDVVGNNIANSQTFGFKSGSIGFAD-IFAGAQGM----GVQVAGS 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV-L 124
               + G L  T  N D+ I G GFF +         +R G F  +  G++ N+  G+ L
Sbjct: 57  GQNFKDGGLTGTGRNLDMGINGNGFFRLMDEAGQAYYSRNGQFDTDVNGYITNLTNGLRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY  +    P  + +   +  I +    +  + +T+G ++ NL  ++ +IT  KTP  +
Sbjct: 117 TGY--QATGTPPAIQAGAAVAPIQIDKTGMPPVASTSGKLNGNLTASSEVIT--KTPFDH 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS---TNNSFPYNVAP 241
                +   S   A+D+LG+    D+YY KT   +W+   +  D S   T+ + P   + 
Sbjct: 173 TDADTFNSSSQIEAFDSLGNRHTIDIYYVKTATGEWKA--YANDASAPVTSGTPPK--SE 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ----QITIDISKTTQL---AGGFIPQ 294
              + ++FD   G L N +  +I  N  ++G++      + +D+S  TQ    A  F P 
Sbjct: 229 YTELAITFDE-NGKLTNDAASSI-LNVKSAGLNGATPLDLQLDLSGITQHESDASTFEPV 286

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
           K++  GHA G   +F +  +G +   YD+G +  I ++ +A   +   L+    NT++ +
Sbjct: 287 KTD--GHAAGNYVNFQIGDNGEITANYDNGEKQLIAQVVLANFANPGGLQQNGNNTWVES 344

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   IG  G    G +  GALE +NVD+ SE+  +I  QRNY  NS+  +T S+ + 
Sbjct: 345 PQSGGSIIGTAGSGSFGSLTGGALENSNVDLGSEMVNMIVYQRNYQSNSQTIKTQSEMLQ 404

Query: 415 ILISLK 420
            L++L+
Sbjct: 405 TLVNLR 410


>gi|134297198|ref|YP_001120933.1| flagellar hook protein FlgE [Burkholderia vietnamiensis G4]
 gi|134140355|gb|ABO56098.1| flagellar basal body FlaE domain protein [Burkholderia
           vietnamiensis G4]
          Length = 413

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 123/430 (28%), Positives = 201/430 (46%), Gaps = 38/430 (8%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  + +
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTTLGS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQKQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNAQGMNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     +V++ Q    + ++    +  PT T  I    + N+  + P KTP +
Sbjct: 123 MGYAADKNG----VVSTAQ---TVPLQAPTSNIAPTPTTKIVGQFNLNSQDVVPTKTPFN 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               A Y + ++   YD+LG S   ++Y+ K+    WE     Q  +T +        L 
Sbjct: 176 ATDSATYNYSTAIQVYDSLGGSQAVNMYFVKSAAGAWEAYAGVQGGTTTD--------LG 227

Query: 244 TVEVSFDPVTGYLANSSHKA--------------ISFNDNTSGIDQQITIDISKTTQLAG 289
           TV+  FD  +G + +++  A              +   D +S   Q +T+D++ TTQ  G
Sbjct: 228 TVK--FDS-SGAITSTTLPASATPTASLGQFQFSVPTTDGSS-TPQALTLDLTGTTQYGG 283

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                    +G+A G    FS+  DG +   Y +G    + ++AIA   + + L    GN
Sbjct: 284 KDGVNNLAQDGYASGTLTTFSIGADGKLTGNYSNGQTAVLGQIAIANFNNPNGLINLGGN 343

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T 
Sbjct: 344 QYAETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQ 403

Query: 410 SDFMDILISL 419
                 LI+L
Sbjct: 404 QTVDQTLINL 413


>gi|171321838|ref|ZP_02910739.1| flagellar basal body FlaE domain protein [Burkholderia ambifaria
           MEX-5]
 gi|171092876|gb|EDT38128.1| flagellar basal body FlaE domain protein [Burkholderia ambifaria
           MEX-5]
          Length = 413

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 125/428 (29%), Positives = 195/428 (45%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTALAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNAQGLNL 122

Query: 125 LGY-PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     +VN+ Q    + ++    +  PT T  I+   + N+    P K P  
Sbjct: 123 MGYLSDKNG----VVNTAQ---TVPLQAPTTNISPTATTKITGQFNLNSQDKVPTKAPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               + Y + +S   YD+LG S   ++Y+ K+    WE     Q  +T +        L 
Sbjct: 176 ATDTSTYNYSTSVQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATTD--------LG 227

Query: 244 TVEVSFDP-------VTGYLANSSHKAISFNDNTSGID-----QQITIDISKTTQLAGGF 291
           TV  +FD         TG  A  +     F       D     Q +T+D++ TTQ  G  
Sbjct: 228 TV--TFDSSGAIKTTTTGTPAVPTASVGQFQFTVPTTDGSTTPQPLTLDLTGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  NG+A G    FS+  DG +   Y +G    + ++AIA   + + L    GN Y
Sbjct: 286 GVNNLAQNGYASGTLTTFSIGADGKLTGNYSNGQTAVLGQIAIANFNNPNGLVNLGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T   
Sbjct: 346 AETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQT 405

Query: 412 FMDILISL 419
               LI+L
Sbjct: 406 VDQTLINL 413


>gi|78062976|ref|YP_372884.1| flagellar hook protein FlgE [Burkholderia sp. 383]
 gi|77970861|gb|ABB12240.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 414

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/434 (27%), Positives = 202/434 (46%), Gaps = 44/434 (10%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   +N +  + +NIAN +TVG+K+    F+ +      +++N+ +  G  + +
Sbjct: 4   QQGLSGLAGAANHLDVIGNNIANANTVGFKQGRANFADMYANSVATSTNTQIGIGTRLVS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G FH +  G + +     L
Sbjct: 64  VQQQFGQGTINSTKSSLDIAINGNGFFQMS-NNGVTTYSRDGVFHRDKSGAIVDAQNRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+ P    +      +    + +S   TT   I+   + N+    P KTP + 
Sbjct: 123 MGY----AAGPGGAINTAATVPLQAPTSNISPQATTK--ITGQFNLNSQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
           G +  Y + SS   YD+LG +    +Y+TK     W+     Q Q+          P N 
Sbjct: 177 GDNTTYNYNSSIQVYDSLGGAQQVSMYFTKNAAGTWQAYAGVQGQT----------PTNL 226

Query: 245 VEVSFDPVTGYLANSSHKA------------ISFNDNTSGID-QQITIDISKTTQLAGGF 291
             V+FD  +G +++++  A             S  + + G + Q +T+D+  TTQ  G  
Sbjct: 227 GTVTFD-ASGRISSTTSAATGQPTPSLGQFAFSIPNASGGANPQNLTLDLGGTTQFGG-- 283

Query: 292 IPQKSEIN-----GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
              KS +N     G A G    FS+  DG +   Y +G    +  +A+A   + + L+  
Sbjct: 284 ---KSGVNNLAQDGFASGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLENI 340

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN Y+ T  SG   I  PG   HG +   ALE +NVD+ +EL  LI+AQR+Y  N++  
Sbjct: 341 GGNQYVETAASGVPQISAPGSTNHGTLQGSALENSNVDLTTELVNLIKAQRDYQANAQTI 400

Query: 407 QTGSDFMDILISLK 420
           +T       L++++
Sbjct: 401 KTQQTVDQTLLNMR 414


>gi|149203100|ref|ZP_01880071.1| flagellar hook protein FlgE, putative [Roseovarius sp. TM1035]
 gi|149143646|gb|EDM31682.1| flagellar hook protein FlgE, putative [Roseovarius sp. TM1035]
          Length = 433

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 122/438 (27%), Positives = 205/438 (46%), Gaps = 48/438 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+  +++G++A + R++ +SDNIAN  T GY+R    F S+V      SY +GG+
Sbjct: 1   MTISSSLNASVAGLNANATRLATISDNIANSSTFGYRRVEADFESVVIAGRGGSYAAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFF--------IVKGRDNVNCLTRAGDFHINN 112
              T+ +I + G+++ +++ TDLA++ +GF         +V   D    LT  G F  + 
Sbjct: 61  RAGTQRLIDQGGAIVSSSNPTDLAVRDRGFLPVARVTDLVVGNGDPRMLLTTTGSFRADP 120

Query: 113 EGFLENVAGGVLLGYPLK-NASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VLLG+P   + + P    ++  GLE + +   +L+  PTT   +  NL  
Sbjct: 121 QGRLVTESGLVLLGWPANPDGTIPEFSRDTSTGLEPVQINVNQLTGEPTTAINLGVNLPA 180

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIF 225
             T       P+      EY        +D LG+S    + +T T        +W V++ 
Sbjct: 181 TDTRFDSLGDPRQ--LSIEY--------FDNLGTSETISIQFTPTIPATGLSNEWTVTL- 229

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVT---GYLANSSHKAISFNDNTSG---ID---QQ 276
             D +  N+       +    ++FD      G L N         D TSG   +D     
Sbjct: 230 -TDSAQGNAL------IGEYVLTFDDARETGGTLLNVQSVTGGTYDPTSGAIIVDVAGGP 282

Query: 277 ITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
           I I+I +       +QL+  F P     +G   G     +V  +G+V   +D G    +Y
Sbjct: 283 IEINIGRPGTSAGMSQLSDSFAPHSIAKDGSPVGNMTSANVDANGFVRATFDTGVSRIVY 342

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           ++ +  +P+ + +   D  TYLP+ DSG   +   G    G+I + A + +  D+A ELT
Sbjct: 343 QVPLVDLPNPNGMVSMDQQTYLPSTDSGSFFLWDAGAGPTGDIVAFARQESATDVAGELT 402

Query: 391 ELIEAQRNYAVNSKVFQT 408
           ++I+ QR Y+ N+KV QT
Sbjct: 403 DMIQTQRAYSSNAKVIQT 420


>gi|260429561|ref|ZP_05783538.1| flagellar hook protein FlgE [Citreicella sp. SE45]
 gi|260420184|gb|EEX13437.1| flagellar hook protein FlgE [Citreicella sp. SE45]
          Length = 431

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 122/442 (27%), Positives = 205/442 (46%), Gaps = 32/442 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   +SG+   ++R++A+SDNIAN  T GY+R    F++LV  S + +Y +GG 
Sbjct: 1   MTISSSLNAGVSGLSGNASRLAAISDNIANSSTYGYRRVETDFTALVMSSGTRTYTAGGT 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-------LTRAGDFHINNE 113
            +    ++ + G+L+ T++ TDLAI G G   V               LT  G F I+  
Sbjct: 61  SVDNLRVVDQGGALVSTSNATDLAIDGIGMLPVVAVSQYEATGEPELLLTSTGSFRIDEN 120

Query: 114 GFLENVAGGVLLGYP--LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G+L + +G  L+G+P  L         ++  GLE I    + L+  PTT+  ++ NL   
Sbjct: 121 GYLASESGYYLMGWPANLDGTIPNYPRDTINGLEPIQFSLS-LTGDPTTSVDMALNLPAT 179

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIFR 226
           AT           G   E T       +D +G S    + +T T        +W + +  
Sbjct: 180 AT---------QAGASGE-TEYLEIEYFDNVGISQSVSITFTPTVPATGMSNEWTMVMTD 229

Query: 227 QDQSTNNSFPYNVAPLNTVE-----VSFDPVTGYLANSSHKAISFNDNTSGIDQQITI-- 279
             Q+      Y +   NT       +S   +TG + + +    + N +   I+  I    
Sbjct: 230 SAQAGAVIGEYTITFDNTTGSGGTILSVADITGGVYDGATGLFTVNVSGGPIEFHIGAVG 289

Query: 280 DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPS 339
           +    +QL  GF P     +G + G      V ++GYV  +YD G    +Y++ +A +P+
Sbjct: 290 ETGGLSQLGDGFAPISISKDGSSVGNMVSVEVDENGYVSALYDSGQSQVLYQIPLADLPN 349

Query: 340 EDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNY 399
            + +   DG+T+ P+ +SG   +   G    G + S A + +  DIA ELT++I  QR Y
Sbjct: 350 YNGMIAVDGSTFRPSPESGSFFLWDAGDGPTGSVKSYARQESATDIARELTDMIRTQRAY 409

Query: 400 AVNSKVFQTGSDFMDILISLKR 421
           + N+KV QT  + +    ++KR
Sbjct: 410 SSNAKVIQTVDEMLQETTNIKR 431


>gi|224825164|ref|ZP_03698270.1| flagellar basal body FlaE domain protein [Lutiella nitroferrum
           2002]
 gi|224602835|gb|EEG09012.1| flagellar basal body FlaE domain protein [Lutiella nitroferrum
           2002]
          Length = 419

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 123/432 (28%), Positives = 209/432 (48%), Gaps = 33/432 (7%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIS 63
            +  +SG+ A S ++  V +N+AN  T G+KR+   F+ +   S    SN+    G+  +
Sbjct: 3   FQQGLSGLAAASKQLEVVGNNVANASTNGFKRSRSEFADMYGSSLYGVSNAQAGIGVRTA 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVK---GRDNVNCLTRAGDFHINNEGFLENVA 120
               + +QG++  T +N DLAI GKGFF++K      + +  +R G F ++  G+L N  
Sbjct: 63  EVSQLFDQGNINSTGNNLDLAISGKGFFVLKSPSAASSQDAYSRNGAFQVDANGYLVNGD 122

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY  +N     ++        +  + + +S   T+   +  NL+ +A +I+P  T
Sbjct: 123 GYKLQGYAAQNG----VIQYTATPVDLQFQTSLISPTATSNVDLGVNLNSSAMVISP--T 176

Query: 181 PKHNGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTK-----TGDKKWEVSIFRQDQSTNNS 234
           P  N  D + Y   +S   YD+LG++     Y+ K     TG   W V+++    +    
Sbjct: 177 PTVNPTDTSTYNSATSVKVYDSLGNTHDLSFYFVKGTPTATG-TDWTVNLYVDGTAV--- 232

Query: 235 FPYNVAPLNTVEVSFDP-----VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
                +P     +SFD        G L+N  + A + N +T+ +    T+D+SK+TQ   
Sbjct: 233 ----TSPAGPQTLSFDTNGVLTSGGVLSNIQYTATTPNGSTTPMTI-ATVDLSKSTQFNS 287

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
            F       +G+APG     +++  G ++  Y +G  V I ++A+A   +   L+   GN
Sbjct: 288 SFGVNSLSADGNAPGTLTSTNINNQGIIEATYSNGKTVAIGQVALANFTNVQGLQSMGGN 347

Query: 350 TYLPTRDS-GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
            +     S G   +G P     GEI S ALE +NVD+ SEL ++I AQR Y  N++  +T
Sbjct: 348 LWKDVASSTGGAKVGAPMSADLGEIQSQALEQSNVDLNSELVDMIVAQRFYQANAQSIKT 407

Query: 409 GSDFMDILISLK 420
               +  LI+L+
Sbjct: 408 EDTILQTLINLR 419


>gi|170734374|ref|YP_001766321.1| flagellar hook protein FlgE [Burkholderia cenocepacia MC0-3]
 gi|254246965|ref|ZP_04940286.1| Flagellar hook protein FlgE [Burkholderia cenocepacia PC184]
 gi|124871741|gb|EAY63457.1| Flagellar hook protein FlgE [Burkholderia cenocepacia PC184]
 gi|169817616|gb|ACA92199.1| flagellar basal body FlaE domain protein [Burkholderia cenocepacia
           MC0-3]
          Length = 413

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 120/429 (27%), Positives = 201/429 (46%), Gaps = 36/429 (8%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLSGASNALDVIGNNIANANTVGFKSSTAQFADMYANSVATSVNTQIGIGTTLNS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNAQGMNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  I+   + N+    P KTP +
Sbjct: 123 MGYMADKNG----VLNTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPAKTPFN 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                 Y + +S   YD+LG S   ++Y+ K+    WE     Q  +TN+        L 
Sbjct: 176 AADTTTYNYSTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATND--------LG 227

Query: 244 TVEVSFDPVTGYLANS----------SHKAISF---NDNTSGIDQQITIDISKTTQLAGG 290
           T+  +FD  +G + ++          S     F   N + S   Q +T+D++ TTQ  G 
Sbjct: 228 TI--TFD-TSGAIKSTTTGTPATPTASLGQFQFTVPNTDGSATPQNLTLDLTGTTQYGGK 284

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
                   +G+A G    +S+  DG +   Y +G    + ++A+A   + + L    GN 
Sbjct: 285 DGVNNLAQDGYASGTLTTYSIGTDGKLTGNYSNGQTAVLGQIALANFNNPNGLVNLGGNQ 344

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y  +  SG   +  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T  
Sbjct: 345 YAESAASGVPQVSAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQ 404

Query: 411 DFMDILISL 419
                LI+L
Sbjct: 405 TVDQTLINL 413


>gi|261341494|ref|ZP_05969352.1| flagellar hook protein FlgE [Enterobacter cancerogenus ATCC 35316]
 gi|288316290|gb|EFC55228.1| flagellar hook protein FlgE [Enterobacter cancerogenus ATCC 35316]
          Length = 395

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 122/422 (28%), Positives = 197/422 (46%), Gaps = 41/422 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---GLEI 62
           S   A+SG++A + ++ A+S+NIAN  TVG+K     F+SL        Y  G   G+ +
Sbjct: 2   SFDIAISGLNAINEQLGAISNNIANSGTVGFKSGRAEFASL--------YAEGQPLGVGV 53

Query: 63  S-TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +     IS+ G++  +AS+ DLAI G+GFF+++        TRAG    ++ G L N  G
Sbjct: 54  TNVAQSISKNGTVFASASSLDLAINGQGFFVMRDSSGTTAYTRAGYMQTDSNGNLVNNQG 113

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GYP+ +A+  +   +   +  + +    L A  T++      LD  A +   ++ P
Sbjct: 114 MYLQGYPV-DANGVIQTGT---VGNLTISSGSLPAKATSS------LDFTANLNANEEKP 163

Query: 182 KHNGRD----AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
           K    D      Y H  +   YD+LG       Y+ KT D  W+V  +  D+S  ++   
Sbjct: 164 KTATFDPTDETSYNHTYATQVYDSLGREHTLKQYFVKTDDNTWQVHYYMDDKSMGDAKDM 223

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS--KTTQLAGGFIPQK 295
                N   +   P         + A++      G D  I++D++   TTQ    F   K
Sbjct: 224 ---TFNEQGILLKP---------NGAVNLTAAIPGADS-ISLDLNYNGTTQFGSDFSVSK 270

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           +  NG+A G+    ++ KDG V   + +G R+   ++ +A   + + L   +G T+  T 
Sbjct: 271 NNGNGYASGERTGQTIDKDGSVYATFSNGERLLQGQVVLANFSNPNGLSSQNGTTWTQTA 330

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG   +G PG    G + S  LE +NV++  EL  L+ AQRNY  N+KV  T    M  
Sbjct: 331 SSGAPLLGTPGTGLLGALTSNTLEGSNVNLTDELVGLMTAQRNYQANTKVISTNDSMMTA 390

Query: 416 LI 417
           L 
Sbjct: 391 LF 392


>gi|218509412|ref|ZP_03507290.1| flagellar hook protein FlgE [Rhizobium etli Brasil 5]
          Length = 196

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 111/189 (58%), Gaps = 7/189 (3%)

Query: 234 SFPYNVA-PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
           SFPY     + T  ++FD   G +  +S  A++ ND  +G  Q I +D S  TQL   F 
Sbjct: 14  SFPYTAGGAVGTGSLTFD-ANGKM--TSSGAVTINDGVTG--QSIAMDFSGLTQLGADFS 68

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
              +  NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D L L  GN Y 
Sbjct: 69  GTGTP-NGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLMSGNVYS 127

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
               SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  NSKVFQTGSD 
Sbjct: 128 ANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTANSKVFQTGSDI 187

Query: 413 MDILISLKR 421
           MD+L++LKR
Sbjct: 188 MDVLVNLKR 196


>gi|148254600|ref|YP_001239185.1| flagellar hook protein FlgE [Bradyrhizobium sp. BTAi1]
 gi|146406773|gb|ABQ35279.1| putative flagellar hook protein FlgE [Bradyrhizobium sp. BTAi1]
          Length = 412

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 138/434 (31%), Positives = 211/434 (48%), Gaps = 35/434 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGG 59
           M + G++ +A+S ++AQS+ ++ +SDNI+N DT GYK T+  F  LV  S+ S +Y SGG
Sbjct: 1   MSLSGALSSAISALNAQSSSLAMISDNISNADTTGYKTTSGLFEQLVTASSNSKAYSSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC---LTRAGDFHINNEGFL 116
           + +S++  I++QG L  T + TD+AIQG GFF+     +       TR G F  +N G+L
Sbjct: 61  VSVSSRTNITQQGLLATTTNATDVAIQGSGFFVATDSTSAGGETFYTRNGAFTTDNAGYL 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           EN  G  L G+   +AS  ++     GLE +N K A  +   TT   ++ NL  +A   +
Sbjct: 121 EN-NGYYLEGWR-TDASGNVV---GSGLEPVNTKVALTNGGATTKTSLAANLPADA--AS 173

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEVSIFRQDQS----T 231
            D            T  SS   YD+LG S   +V +TK T   +W  S      S    T
Sbjct: 174 GD------------TFSSSMTVYDSLGQSHTLNVTWTKGTTANEWTASFAPATASDGTVT 221

Query: 232 NNSFPYNV---APLNTVEVSFDPVT-GYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
           + ++  N      L+TV  +   +T    A +S  A+SF     G D    +    TT  
Sbjct: 222 SGTYTINFNSDGSLSTVSSTNLGITWNNGAAASSIALSFGTTGGGTDGLTQLASGSTTPS 281

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F    +  +G + G     SV K+G V+  Y +G  VPIY++A+AT    + L    
Sbjct: 282 VSNF---SANSDGISFGTLSSISVGKNGLVEATYSNGQTVPIYKIAVATFADPNGLVAHS 338

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
              Y  T  SG+ ++   G N  G I+   LE++  D   + + +I AQ+ Y+  S+V  
Sbjct: 339 NGMYTATATSGNATLQASGENGAGTIYGSELESSTTDTTGQFSNMISAQQAYSAASQVIS 398

Query: 408 TGSDFMDILISLKR 421
             +   D LIS  R
Sbjct: 399 AVNKMYDTLISSMR 412


>gi|114762177|ref|ZP_01441645.1| flagellar hook protein FlgE, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114545201|gb|EAU48204.1| flagellar hook protein FlgE, putative [Roseovarius sp. HTCC2601]
          Length = 432

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 127/449 (28%), Positives = 205/449 (45%), Gaps = 45/449 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-SYVSGG 59
           M I  S+   +SG+   ++R+SA+SDNIAN  T GY+R    F++LV  S S  +Y +GG
Sbjct: 1   MTISSSLNAGVSGLAGNASRLSAISDNIANSSTYGYRRVETDFTALVMSSGSQRAYTAGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-------LTRAGDFHINN 112
             I    +I E G+++ T++ TDLA+ G G   V  +            LT  G F I+ 
Sbjct: 61  TAIDNLRLIDEGGAIVSTSNATDLAVDGIGMLPVASQAQYEATGEPELLLTSTGSFRIDE 120

Query: 113 EGFLENVAGGVLLGYP--LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
            G+L +  G  L+G+P  L  +  P   ++  GLE +    + L+  PTT   ++ NL  
Sbjct: 121 NGYLASENGYYLMGWPAALDGSIPPYPRDTINGLEPVKFSLS-LTGDPTTAVDMALNLPA 179

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW---EVSIFRQ 227
                   +T      DAEY     F   D +G S    + +T T        E S+   
Sbjct: 180 T-------ETQAGAAGDAEYLEIEYF---DNVGISQSISITFTPTVPATGISNEWSMVMT 229

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGY------LANSSHKAISFNDNTSGIDQQ---IT 278
           D + +       A +    ++FD  TG       +  ++  A +       +D     I 
Sbjct: 230 DSAQDG------AVIGDYTITFDATTGAGGTIATVVETTGGAYNAGTGLFTVDVAGGPIE 283

Query: 279 IDISKT------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRL 332
            DI  T      +QL   F P     +G + G      V ++GYV  +YD G    +Y++
Sbjct: 284 FDIGATGTTGGLSQLGDSFAPISISKDGSSVGNMVSVEVDENGYVSALYDSGQSQVLYQI 343

Query: 333 AIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTEL 392
            +  +P+ + +   DG+T+ P+ +SG   +   G    G + S A + +  DIA ELT++
Sbjct: 344 PLVDLPNYNGMIAVDGSTFRPSPESGSFFLWDAGDGPTGSVKSYARQESATDIAQELTDM 403

Query: 393 IEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           I  QR Y+ N+KV QT  + +    ++KR
Sbjct: 404 IRTQRAYSSNAKVIQTVDEMLQETTNMKR 432


>gi|107023953|ref|YP_622280.1| flagellar hook protein FlgE [Burkholderia cenocepacia AU 1054]
 gi|116691040|ref|YP_836663.1| flagellar hook protein FlgE [Burkholderia cenocepacia HI2424]
 gi|105894142|gb|ABF77307.1| flagellar basal body FlaE [Burkholderia cenocepacia AU 1054]
 gi|116649129|gb|ABK09770.1| flagellar basal body FlaE domain protein [Burkholderia cenocepacia
           HI2424]
          Length = 413

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 195/419 (46%), Gaps = 16/419 (3%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLSGASNALDVIGNNIANANTVGFKSSTAQFADMYANSVATSVNTQIGIGTTLNS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNAQGMNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  I+   + N+    P KTP +
Sbjct: 123 MGYMADKNG----VLNTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPAKTPFN 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                 Y + +S   YD+LG S   ++Y+ K+    WE     Q  +TN+          
Sbjct: 176 ATDTTTYNYSTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATNDLGTITFDTSG 235

Query: 244 TVEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            ++ S    T     +S     F   N + S   Q +T+D++ TTQ  G         +G
Sbjct: 236 AIK-STTTGTPATPTASLGQFQFTVPNTDGSATPQNLTLDLTGTTQYGGKDGVNNLAQDG 294

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +A G    +S+  DG +   Y +G    + ++A+A   + + L    GN Y  +  SG  
Sbjct: 295 YASGTLTTYSIGTDGKLTGNYSNGQTAVLGQIALANFNNPNGLVNLGGNQYAESAASGVP 354

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            +  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 355 QVSAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|313901443|ref|ZP_07834901.1| fagellar hook-basal body protein [Thermaerobacter subterraneus DSM
           13965]
 gi|313468293|gb|EFR63749.1| fagellar hook-basal body protein [Thermaerobacter subterraneus DSM
           13965]
          Length = 406

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 126/437 (28%), Positives = 204/437 (46%), Gaps = 49/437 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL-----------VFPS- 50
           ++ S+   +SG+     R+  + +NIANV+TVGYK + + F  L             P+ 
Sbjct: 1   MMRSLYAGISGLQNHQLRMDVIGNNIANVNTVGYKSSRVTFKELFNQTLRGASAPAGPAR 60

Query: 51  --TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
             T+   +  G  +   D+I + G+   T   TD+AIQG GFF+++        TRAGDF
Sbjct: 61  GGTNPIQIGLGTALGGIDVIHQAGNPQVTGVVTDMAIQGDGFFVLQDATGGYAYTRAGDF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            ++ EG+L N  G  +LG+  +    P       G  R+ V  A + A  +T    S+NL
Sbjct: 121 RLDAEGYLVNADGLRVLGWQAQGGVLPARDALNLGAVRVPVDLA-VPAQASTRVTWSSNL 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ- 227
           D  A    P  +          T   +   YD+LG+       +T+TG  +W  +     
Sbjct: 180 DATA----PTSS----------TLTQAIDVYDSLGNPHTLIFTFTRTGSNQWSWNAAAAA 225

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ-ITIDISKTTQ 286
           D +T+         L +  ++F    G L   S   ++++    G D+  +T+D +  TQ
Sbjct: 226 DPATS---------LGSGTLTFSSA-GLLTAGSPGTVNYSP--PGADRMTLTVDFAGLTQ 273

Query: 287 LAGGFIPQKSEI--NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
            AG   P  +E   +G+  G+   FSV   G +   + +G   PI ++A+A   +   L 
Sbjct: 274 YAG---PSTAEATADGYPAGQLTSFSVDASGTITGTFSNGMTQPIAQVALAAFANPAGL- 329

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
           L DGN Y  + +SG   IG  G    G +  GALE +NVD++ E  ++I  QR +  NS+
Sbjct: 330 LRDGNLYWESNNSGVARIGEAGTGGRGSVTPGALEMSNVDLSREFVDMIVTQRGFQANSR 389

Query: 405 VFQTGSDFMDILISLKR 421
           V  T  + +  L++LKR
Sbjct: 390 VITTSDEMLQELVNLKR 406


>gi|212637785|ref|YP_002314310.1| flagellar hook protein FlgE [Shewanella piezotolerans WP3]
 gi|212559269|gb|ACJ31723.1| Flagellar basal body rod protein FlaE [Shewanella piezotolerans
           WP3]
          Length = 402

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 123/418 (29%), Positives = 190/418 (45%), Gaps = 26/418 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  TVG++     FS++      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANSSTVGFRSGRSEFSAIY-----NGGQAGGVNVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S  GSL++T    D+ IQG GFF++  +D      RAG F+ + +GF+ + AG  L
Sbjct: 57  SQNFSMGGSLVYTGRQLDMGIQGDGFFVLSSQDGNTMYARAGMFNQDADGFVTDPAGNRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTT-GFISNNLDKNATIITPDKTPKH 183
            GY +         N    +  + V+   L A  T+T G ISN LD     I P   P  
Sbjct: 117 QGYSVSGTGNLQTGN----VTDLQVQAGALPAKATSTIGLISN-LDARVDPIDPVVNPFD 171

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               A Y   S+ AAYD+LG+      YY KT D  W V     D         +V P  
Sbjct: 172 PDNAATYHSSSTVAAYDSLGNEHALTQYYVKTADNTWSVHYMMDD--------VDVTPAA 223

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS----KTTQLAGGFIPQKSEIN 299
             +++FD   G L       ++ ND  + I    T++++    K+TQ A  +       N
Sbjct: 224 GHQLTFDS-DGMLTGGDSLTLNIND-PAIIGGASTLNLALGYDKSTQYASDYNNSSLNQN 281

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+  G+     + + G +   Y +G      ++ +A   + + L     N +  T  +G 
Sbjct: 282 GYTSGELNGIRLDESGMLYGTYTNGQEQLQGQVVLADFNNPNGLIPVSNNAWTATNAAGQ 341

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
             +G P     G + SG LE +NVD  +E+  L+ AQRNY  N+KV    S     L+
Sbjct: 342 PIVGTPTTGTLGSVASGYLEGSNVDTTAEMVSLMTAQRNYQSNAKVLDANSTMQQALL 399


>gi|289208114|ref|YP_003460180.1| fagellar hook-basal body protein [Thioalkalivibrio sp. K90mix]
 gi|288943745|gb|ADC71444.1| fagellar hook-basal body protein [Thioalkalivibrio sp. K90mix]
          Length = 408

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 119/417 (28%), Positives = 192/417 (46%), Gaps = 20/417 (4%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEISTKD 66
            +SG+++    +    +N++N  T G+KR+   F  +    F   S +   GG  +    
Sbjct: 6   GLSGLNSAQADLQTTGNNVSNAGTTGFKRSRAEFGDVFAQSFGGVSQTATGGGSRLMAVT 65

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLG 126
               QG    T +  DLAI G+GFF++    N    TRAG+F +N +G L N  G  L G
Sbjct: 66  QQFSQGRTEFTENGLDLAIDGEGFFVMNDGGN-RVYTRAGEFQVNRDGNLVNNQGQQLQG 124

Query: 127 YPLKN-ASAPLIVNSFQ-GLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           YP  N  S     N+ Q G  R+    +   A       +  NL  +A I+ P +  + +
Sbjct: 125 YPPINPGSTDTDFNTGQLGDLRLQTGASAPQATSDIEALV--NLQSDAPILDPGEF-EFD 181

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             D+ Y + +S   YD+LG+S    +Y+ K+ +++W   +    +  N    +       
Sbjct: 182 DPDS-YNYSTSLTVYDSLGTSRDARIYFVKSDEREWTAFMSVDGEPINEEEGF------- 233

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGHAP 303
            E+SFD  +G L  ++    S +D T+G +    TID + TTQ  G F       +G A 
Sbjct: 234 -ELSFD-ASGQLDGNTEFPFSTDDFTNGAEGLDGTIDFAGTTQFGGDFAVNDLGQDGFAS 291

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+     +   G V   + +G    + ++A+A   +   L+    N +  T  +GD    
Sbjct: 292 GRLTGVDIDSSGVVFARFTNGQSSVLGQVALANFTNPQGLEQLGNNNWAETFAAGDPVFA 351

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            PG    GEI +GALE +NVDIA EL  LI AQRN+  N++   T       +I+++
Sbjct: 352 SPGTGNLGEIQAGALEASNVDIAQELVNLITAQRNFQANAQTISTADQVTQTIINIR 408


>gi|238028849|ref|YP_002913080.1| flagellar hook protein FlgE [Burkholderia glumae BGR1]
 gi|237878043|gb|ACR30376.1| Hypothetical protein bglu_1g33140 [Burkholderia glumae BGR1]
          Length = 412

 Score =  146 bits (368), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 200/435 (45%), Gaps = 49/435 (11%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---GLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K  +  FS L   S S +  +G   G +++T
Sbjct: 4   QQGLSGLQGASSDLDVIGNNIANANTVGFKAASAQFSDLYANSVSGAVANGIGIGTQLAT 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              + +QG    + +   +AI G GFF V   + V   TR G F  N  G + N AGG L
Sbjct: 64  VAQVFQQGGFATSQNPLSMAISGNGFFQVN-SNGVTTYTRDGQFSPNASGNITNSAGGQL 122

Query: 125 LGYPLK-----NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           +GY +      N SA + + + QG    N+        P  T  I+   + + T      
Sbjct: 123 MGYGVNADGSINTSAIVPLTAPQG----NIP-------PKATSSITGQFNLSTTDTAQTN 171

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEVSIFRQDQSTNNSFPYN 238
           +P +    + YT K    AYD+LG++   ++Y+ K T    WEV               N
Sbjct: 172 SPFNFSDSSTYTLKQPVQAYDSLGNAKTVNLYFVKSTTVGSWEVYAGAD----------N 221

Query: 239 VAPLNTVEVSFDP---VTGYLANS---SHKAISFN-DNTSG--IDQQITIDISKTTQLAG 289
            AP +    SFD    +TG  A S   S    +F+  NT+G    Q +++D++ +TQ   
Sbjct: 222 TAPTDLGTASFDSSGKLTGLTAKSATASGNKFTFSIANTTGAVTPQSVSLDLTGSTQ--- 278

Query: 290 GFIPQKSEI-----NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
            F   KS +     +G A G  +++SV+ DG +   Y +G  + + ++ +        L 
Sbjct: 279 -FGATKSGVSNLVADGFASGALQNYSVAADGTITGSYSNGQSMKLGQVFVVNFNDPQGLT 337

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
              GN Y+ T  SG   IG PG   HG I     E + VD+  EL  LI AQRNY  N++
Sbjct: 338 SIGGNQYIQTAASGVPQIGVPGSTNHGTIKGSTTENSTVDLTGELVNLITAQRNYQANAQ 397

Query: 405 VFQTGSDFMDILISL 419
             +T       L++L
Sbjct: 398 TIKTQQTVDQTLLNL 412


>gi|172061972|ref|YP_001809624.1| flagellar hook protein FlgE [Burkholderia ambifaria MC40-6]
 gi|171994489|gb|ACB65408.1| flagellar basal body FlaE domain protein [Burkholderia ambifaria
           MC40-6]
          Length = 413

 Score =  146 bits (368), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 120/428 (28%), Positives = 199/428 (46%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTGLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  GF+ +  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGFIVDSQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A +  ++N+ Q    + ++    +  PT T  I+   + N+    P KTP   
Sbjct: 123 MGYT---AGSGGVINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPTKTPFSA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y + +S   YD+LG S   ++Y+ K+    WE     Q  +T +        L T
Sbjct: 177 TDSTTYNYSTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATTD--------LGT 228

Query: 245 VEVSFDPVTGYLANS----------SHKAISF---NDNTSGIDQQITIDISKTTQLAGGF 291
           V  +FD  +G + ++          S     F   N + S   Q +T+D++ TTQ  G  
Sbjct: 229 V--TFD-TSGAIKSTTTGTPAAPTTSLGQFQFTVPNTDGSATPQSLTLDLTGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G+A G    +S+  DG +   Y +G    + ++A+A   + + L    GN Y
Sbjct: 286 GVNNLAQDGYASGTLTTYSIGADGKLTGNYSNGQTAVLGQIALANFNNPNGLVNLGGNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             +  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T   
Sbjct: 346 AESSASGVPQISAPGSTNHGVLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQT 405

Query: 412 FMDILISL 419
               LI+L
Sbjct: 406 VDQTLINL 413


>gi|159045919|ref|YP_001534713.1| flagellar hook protein FlgE [Dinoroseobacter shibae DFL 12]
 gi|157913679|gb|ABV95112.1| flagellar hook protein FlgE [Dinoroseobacter shibae DFL 12]
          Length = 434

 Score =  146 bits (368), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 206/448 (45%), Gaps = 41/448 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF-PSTSNSYVSGG 59
           M I  S+   +SG++A + R++ +SDNIAN  T GYKR    F SLV   ++S +Y +GG
Sbjct: 1   MTISSSLNAGVSGLNANATRLATISDNIANSSTYGYKRAEADFQSLVINGNSSGTYSAGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN--------CLTRAGDFHIN 111
           + ++T  +I EQG L+ T++ TDLA+ G G   V     ++         L   G F  N
Sbjct: 61  VRVTTTRVIDEQGPLVTTSNPTDLAVGGSGMLPVTTLSALDENTGGYPLSLMTTGSFSPN 120

Query: 112 NEGFLENVAGGVLLGYPL-KNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +G L    G VL+G+P   + + P    ++  GLE I V   + +  PTT   +  NL 
Sbjct: 121 ADGVLTTETGMVLMGWPAAPDGTVPEFPRDTVDGLEPITVNLNQFAGDPTTRIDLGVNLP 180

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQD 228
            + T    +     +  D    +  +    +TLG  V Y      +G    W ++I   D
Sbjct: 181 ASET----EAGSSGDSIDLSIEYFGNLGTSETLG--VTYTPQVPASGASNTWTMTI--TD 232

Query: 229 QSTNNSFPYNVAPLNTVEVSFDP---VTGYLANSSHKAISFNDNTSGIDQ------QITI 279
            ++  +       +   E++FD      G LA+ +  +    D   G  +       +T+
Sbjct: 233 SASGGAV------VGEYELTFDDSRGAGGTLASVTAVSGGPFDPVQGTVEITADGGPVTV 286

Query: 280 DISKT------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLA 333
            I         TQL+  F P     NG   G      V  +G+V  +YD G    IY++ 
Sbjct: 287 KIGSVGDENGMTQLSDTFAPVSISKNGSPVGNLSTVEVDPNGFVVAVYDTGFTRTIYQVP 346

Query: 334 IATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELI 393
           +A VP+ + L   D  +Y+ + +SG   +   G    G++   ALE +  D+A ELT LI
Sbjct: 347 LADVPNPNGLLSRDNQSYMISPESGPFFLWNAGEGPTGDVIGFALEESAADVAGELTRLI 406

Query: 394 EAQRNYAVNSKVFQTGSDFMDILISLKR 421
             QR Y+ N+K+ QT  + +    ++KR
Sbjct: 407 TTQRAYSSNAKIIQTVDEMLQETTNIKR 434


>gi|205373385|ref|ZP_03226189.1| flagellar hook protein FlgE [Bacillus coahuilensis m4-4]
          Length = 426

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 127/436 (29%), Positives = 216/436 (49%), Gaps = 27/436 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           +L SM + +SGM     ++  + +NIANV+T G+K+  + F  L+  + S +        
Sbjct: 1   MLRSMYSGISGMKNAQTKLDVIGNNIANVNTYGFKKGRVTFQDLMNQTMSGATTPTENRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 +  G  I++ D+IS QGSL  T  + D+AI G G+F+V+   N    TRAG+F+
Sbjct: 61  GQNAKQIGLGGTIASIDIISTQGSLQTTGRSLDVAISGDGYFVVRNGQN-EMYTRAGNFY 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS--NN 167
           +++ G L +  G ++ GY    A A  +++ + G+  I V  ++ +  P +T  ++   N
Sbjct: 120 LDSNGSLVDGNGNLIQGYQ---ADANGVID-YGGMTDI-VIDSDSTMAPRSTSEVTFNGN 174

Query: 168 LDKNATII-TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           L  +A I    + T +    D   T    ++  D+LGS +   V +TKT    W+ +I  
Sbjct: 175 LKASAPIYDATNATTQAATADGRVTVD--YSVKDSLGSDIPLKVTFTKTASNSWDTTISY 232

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFDPVT-GYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
            D           A   + +   DP T   LAN +    + N       Q I ID ++ T
Sbjct: 233 TDTLGATQTITGPALSFSSDGKLDPATVTTLANINLPVNNINPGAVS-PQAIDIDFAQIT 291

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q         + ING++ G  + F++S  G ++ IY +G    I +L +AT  +   L  
Sbjct: 292 QFDSSTSANINTINGNSEGYLESFTISSSGEINGIYSNGEVQAISQLVMATFSNAGGLLS 351

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
             GNT+  + +SG  + G   +   G I SG+LE +NVD++ E TE+I AQR++  N+++
Sbjct: 352 QGGNTFTASNNSGLPNYGIA-NEGRGAIQSGSLEMSNVDLSEEFTEMITAQRSFQANTRI 410

Query: 406 FQTGSDFMDILISLKR 421
             T  + +  L++LKR
Sbjct: 411 ITTSDEILQELVNLKR 426


>gi|170703096|ref|ZP_02893916.1| flagellar basal body FlaE domain protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131993|gb|EDT00501.1| flagellar basal body FlaE domain protein [Burkholderia ambifaria
           IOP40-10]
          Length = 413

 Score =  145 bits (367), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 116/418 (27%), Positives = 193/418 (46%), Gaps = 14/418 (3%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTGLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  GF+ +  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGFIVDSQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A +  ++N+ Q    + ++    +  PT T  I+   + N+    P KTP   
Sbjct: 123 MGYT---AGSGGVINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPTKTPFSA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y + +S   YD+LG S   ++Y+ K+    WE     Q  +T +           
Sbjct: 177 TDSTTYNYSTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATTDLGTITFDTSGA 236

Query: 245 VEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           ++ S    T     +S     F   N + S   Q +T+D++ TTQ  G         +G+
Sbjct: 237 IK-STTTGTPAAPTTSLGQFQFTVPNTDGSATPQSLTLDLTGTTQYGGKDGVNNLAQDGY 295

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G    +S+  DG +   Y +G    + ++A+A   + + L    GN Y  +  SG   
Sbjct: 296 ASGTLTTYSIGADGKLTGNYSNGQTAVLGQIALANFNNPNGLVNLGGNQYAESSASGVPQ 355

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 356 ISAPGSTNHGVLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|90422390|ref|YP_530760.1| flagellar hook protein FlgE [Rhodopseudomonas palustris BisB18]
 gi|90104404|gb|ABD86441.1| flagellar basal body FlaE [Rhodopseudomonas palustris BisB18]
          Length = 419

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 138/452 (30%), Positives = 206/452 (45%), Gaps = 64/452 (14%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVS-GG 59
           M + G++ +A+S + AQS+ ++ +SDNIAN  TVGYK T+ +F +LV  S+S +  S GG
Sbjct: 1   MSLSGALSSAISALSAQSSAMAMISDNIANSQTVGYKTTSASFQALVTSSSSATTYSSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--RDNVNCLTRAGDFHINNEGFLE 117
           +   ++  ISEQG L  T S TD+ I G GFF V           TR+G F I++ G+L 
Sbjct: 61  VTTLSRSNISEQGLLTTTTSATDIGISGNGFFPVTTALTGGSTLYTRSGSFTIDDSGYLV 120

Query: 118 NVAGGVLLGYPLK---NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
           +  G  LLG+      N +     N+   LE IN   A  S   +T    + NL      
Sbjct: 121 SSGGAYLLGWRTDADGNITGSADSNN---LEPINTAVAATSGSASTETKFALNL------ 171

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI---------- 224
                 P     DA +T  SS + YD+LG++    V +TKTG   W  S           
Sbjct: 172 ------PADAATDATFT--SSMSVYDSLGTASSIQVTWTKTGSNTWSASFGNPTLSSDST 223

Query: 225 -------------FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFND--N 269
                        F +D S        +A  +  ++S    TG  A +S  A++F     
Sbjct: 224 TSTGTTTGSATITFNEDGS--------LASQSATDISVAWSTG--AATSTIALNFGTVGG 273

Query: 270 TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
           T G+ Q+ + + + +  L         E +G A GK    +V  DG V+  Y +G  + I
Sbjct: 274 TDGLTQKASGETTPSINL------TSIESDGLAYGKLSSIAVGDDGKVNATYSNGETIAI 327

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASEL 389
           Y++ +AT  + D L       Y  +  SG   +   G N  G I+ G LE +  D   E 
Sbjct: 328 YKIPVATFSAPDQLVAKSNGLYAASAASGTAMVQASGTNGAGTIYGGELEASTSDTNQEF 387

Query: 390 TELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           + +I AQ+ Y+  ++V    SD  D LIS  R
Sbjct: 388 SNMISAQQAYSAAAQVMSAVSDMYDTLISAMR 419


>gi|229029434|ref|ZP_04185517.1| Flagellar hook protein flgE [Bacillus cereus AH1271]
 gi|228731893|gb|EEL82792.1| Flagellar hook protein flgE [Bacillus cereus AH1271]
          Length = 409

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/433 (27%), Positives = 199/433 (45%), Gaps = 38/433 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-----SNSY-- 55
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ ++      N Y  
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGSKGDNKYAG 60

Query: 56  -----VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSAGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I++  ++ N  G  +  YP   A+  + ++   G  +I +  A +  + TT G I  N+ 
Sbjct: 121 ISSNYYITNTEGQYVFAYPANAATGEVDLSGIPGPLQIPMGTA-IGGIQTTKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            N + IT D                    YD  G++    V +TKT D ++   + R++ 
Sbjct: 180 VNESKITQD-----------------LPFYDDAGNTWTMRVEFTKTNDHEYTYKVQRRND 222

Query: 230 STNN-SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           S  +  F       +T  + FD V          AI FN  T      I +D S+ T   
Sbjct: 223 SAKDPKFEEVTGAGSTGTLKFDKVGNPDPVQQGAAIPFNGGT------INLDFSQLTNHP 276

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 277 TDKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 336

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 337 GNYTATNTTGILALGASGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKV 396

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 397 SDEVLNEVVNLIR 409


>gi|220917665|ref|YP_002492969.1| protein of unknown function DUF1078 domain protein
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955519|gb|ACL65903.1| protein of unknown function DUF1078 domain protein
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 428

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 124/446 (27%), Positives = 194/446 (43%), Gaps = 43/446 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-- 58
           M +L ++ +  +G+ A S  +S V DNIAN +TVG+K    AF   +    S S + G  
Sbjct: 1   MSLLTALSSGTTGLQASSLELSVVGDNIANANTVGFKSGRAAFEDAL----SQSVIGGTG 56

Query: 59  ----GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR---DNVNCLTRAGDFHIN 111
               G  ++    I  QG+L  T   TDLA+QG GFF+V+G          TR G F ++
Sbjct: 57  QIGLGSRLAGVQKILTQGALASTGLATDLALQGNGFFVVRGAHAGQTGTFYTRDGQFTVD 116

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGL-ERINVKHAELSAMPTTTGFISNNLDK 170
           ++G+L N+ G  + G+P   + A        GL + + V  A      TT   +  NL  
Sbjct: 117 DDGYLVNLEGLRVQGFPADPSGA------LAGLPDDLLVGTASAQPRATTRLTLKANLQA 170

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS 230
           +A + T    P + G  + ++  ++   YD LG+     VY+ KTGD  W+         
Sbjct: 171 DAAVPTAAWDPANPGATSNFS--TTMTVYDALGAGHAVQVYFRKTGDGAWDWHALTDGAG 228

Query: 231 TNNSFPYNVAPLNTVEVSF---DPVTGYLANSSHKA----------ISFNDNTS--GIDQ 275
                   +  +    ++F     +T     SS              SF D TS  G   
Sbjct: 229 VAGGTAGQLTQIAGGTLAFGDGGELTSMTQTSSFTPAGQAAPQPLDFSFGDATSAGGTGL 288

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                 S T+  A  FI Q    +G+  G+     V  +G +  ++ +G    + ++A+A
Sbjct: 289 AGVTQFSATS--ASTFIGQ----DGYGSGQLASVRVGPEGVISGVFTNGQTRVLGQVAVA 342

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
              + D L    GN    T  SG   +G  G      + +G+LE +NVD+A +   LI A
Sbjct: 343 GFAAPDQLDRAGGNLLQQTPGSGQPVVGAAGSGGRASVVAGSLEQSNVDLAEQFVRLIAA 402

Query: 396 QRNYAVNSKVFQTGSDFMDILISLKR 421
           QR +  NSK   T    +  LI++KR
Sbjct: 403 QRAFQANSKTITTADQLLSELIAMKR 428


>gi|316936123|ref|YP_004111105.1| flagellar hook-basal body protein [Rhodopseudomonas palustris DX-1]
 gi|315603837|gb|ADU46372.1| flagellar hook-basal body protein [Rhodopseudomonas palustris DX-1]
          Length = 422

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 135/445 (30%), Positives = 208/445 (46%), Gaps = 47/445 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGG 59
           M + G++ +A+S ++AQS  ++ +SDNIAN  TVGYK T+ +FS LV  ++ +++Y SGG
Sbjct: 1   MSLTGALSSAISALNAQSQSLAMISDNIANSQTVGYKTTSASFSQLVTAASGASTYSSGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFF--IVKGRDNVNCLTRAGDFHINNEGFLE 117
           + +  +  I+ QG L  T S+TD+ I G GFF             TR G F ++N G+L 
Sbjct: 61  VTVLARSNITTQGLLTTTTSSTDIGISGNGFFPVTTAVTGGTTLYTRGGSFTLDNSGYLV 120

Query: 118 NVAGGVLLGYPLK-------NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           N +G  LLG+           ASA  +V        I+   A  S   TTT  ++ NL  
Sbjct: 121 NASGAYLLGWRTDADGNVAGGASADTMV-------PIDTSVAATSGSATTTTTVAANLPA 173

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS 230
           +A +                T  +S + YD+LG++    + +TKT +  W  +      +
Sbjct: 174 DAAV--------------NDTFTTSMSLYDSLGTANSMQITWTKTAENSWTATFANPTLA 219

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLA--NSSHKAISFNDNTSGI-DQQITIDISKT--- 284
           +N +         ++ +SF+   G LA  N S   IS    T+G  D  IT+D+      
Sbjct: 220 SNTATATGTVS-GSIAISFNS-DGSLASTNPSPATISVTGWTNGAADSVITMDLGTAGGT 277

Query: 285 ---TQLAGGFIP-----QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
              TQ + G           E +G A GK    ++  DG V   Y +G    IY++ +AT
Sbjct: 278 DGLTQYSSGATTPAVDLTSIESDGMAYGKLSSIAIGDDGTVSATYSNGKTTTIYKVPVAT 337

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             + D L+  D   Y  T  SG   +   G N  G I  G LE +  D  +E + +I AQ
Sbjct: 338 FAAADQLEAKDNGMYAATLASGTAVVQLSGTNGAGSIEGGVLEASTSDTNTEFSSMISAQ 397

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           + Y+  S+V    ++  D LIS  R
Sbjct: 398 QAYSAASQVISAVNEMYDTLISAIR 422


>gi|197122873|ref|YP_002134824.1| hypothetical protein AnaeK_2470 [Anaeromyxobacter sp. K]
 gi|196172722|gb|ACG73695.1| protein of unknown function DUF1078 domain protein
           [Anaeromyxobacter sp. K]
          Length = 428

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 124/446 (27%), Positives = 194/446 (43%), Gaps = 43/446 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-- 58
           M +L ++ +  +G+ A S  +S V DNIAN +TVG+K    AF   +    S S + G  
Sbjct: 1   MSLLTALSSGTTGLQASSLELSVVGDNIANANTVGFKSGRAAFEDAL----SQSVIGGTG 56

Query: 59  ----GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR---DNVNCLTRAGDFHIN 111
               G  ++    I  QG+L  T   TDLA+QG GFF+V+G          TR G F ++
Sbjct: 57  QIGLGSRLAGVQKILTQGALASTGLATDLALQGNGFFVVRGAHAGQTGTFYTRDGQFTVD 116

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGL-ERINVKHAELSAMPTTTGFISNNLDK 170
           ++G+L N+ G  + G+P   + A        GL + + V  A      TT   +  NL  
Sbjct: 117 DDGYLVNLEGLRVQGFPADPSGA------LAGLPDDLLVGTASAQPRATTRLTLKANLQA 170

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS 230
           +A + T    P + G  + ++  ++   YD LG+     VY+ KTGD  W+         
Sbjct: 171 DAAVPTAAWDPANPGATSNFS--TTMTVYDALGAGHAVQVYFRKTGDGAWDWHALTDGAG 228

Query: 231 TNNSFPYNVAPLNTVEVSF---DPVTGYLANSSHKA----------ISFNDNTS--GIDQ 275
                   +  +    ++F     +T     SS              SF D TS  G   
Sbjct: 229 VAGGTAGQLTQIAGGTLAFGDGGELTSMTQTSSFTPAGQAAPQPLDFSFGDPTSAGGTGL 288

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                 S T+  A  FI Q    +G+  G+     V  +G +  ++ +G    + ++A+A
Sbjct: 289 AGVTQFSATS--ASTFIGQ----DGYGSGQLASVRVGPEGVISGVFTNGQTRVLGQVAVA 342

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
              + D L    GN    T  SG   +G  G      + +G+LE +NVD+A +   LI A
Sbjct: 343 GFAAPDQLDRAGGNLLQQTPGSGQPVVGAAGSGGRASVVAGSLEQSNVDLAEQFVRLIAA 402

Query: 396 QRNYAVNSKVFQTGSDFMDILISLKR 421
           QR +  NSK   T    +  LI++KR
Sbjct: 403 QRAFQANSKTITTADQLLSELIAMKR 428


>gi|332525066|ref|ZP_08401246.1| flagellar basal body and hook protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332108355|gb|EGJ09579.1| flagellar basal body and hook protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 432

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 119/439 (27%), Positives = 200/439 (45%), Gaps = 32/439 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---GLEI 62
           S +  +SG++A S  +  + +NIAN +T G K +   FS +   + + + V+    G+ +
Sbjct: 2   SFQQGLSGLNATSKSLDVIGNNIANANTYGAKVSRAEFSDMYATALNGAGVNNVGIGVTL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                   QG++  T +  D+AI G GFF V    +    TR G F ++ EG++ N    
Sbjct: 62  GAVSQQFTQGNISTTGNAMDMAINGAGFFQVTDGVSPTVYTRNGQFKVDREGYIVNNEKL 121

Query: 123 VLLGYPLKNASAPLIVNSFQ-GLER-INVKHAELSAMPTTTGFISNNLDKNATIITP--D 178
            L+GYP           + Q GL + + +  A ++   T+   +  NL  ++ +  P   
Sbjct: 122 KLMGYPADGTG------TIQPGLAQPLKLPTAGIAPSATSKIELEFNLKADSVVTAPAAT 175

Query: 179 KTPKHNGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
            TP+ +  D + Y + +S  AYD+ G  V    Y+ K  + KW V +    Q  N     
Sbjct: 176 ATPQIDFTDKSTYNNATSVVAYDSKGQDVALSYYFQKESNDKWNVYVTANGQPVNVDAAG 235

Query: 238 NVAPLNTVEVSFDPVTGYLAN---SSHKAISFN------DNTSG-------IDQQITIDI 281
           N     T+E  FD  TG LA+   +   A+S        D  +G       +   +++++
Sbjct: 236 NPVKWQTLE--FDNTTGRLASPDPADALALSITNDLIITDPVTGRETSRIVVPLNMSVNV 293

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           +  TQ    F       NG+A G+    ++  DG V   Y +G   P  +L +A   +  
Sbjct: 294 ASATQYDQTFGVTNLTQNGYAAGQLTSIAIEADGIVLARYSNGQSKPAGQLELANFRNPQ 353

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+   GN +  T  SGD  +G P     G I +GALE +N+D+  EL  +I AQR Y  
Sbjct: 354 GLQPLGGNVWASTYASGDAVVGVPSEGNMGVIQAGALEESNIDLTGELVNMITAQRIYQA 413

Query: 402 NSKVFQTGSDFMDILISLK 420
           N++  +T    M  L++++
Sbjct: 414 NAQTIKTQDQVMQTLVNMR 432


>gi|227112521|ref|ZP_03826177.1| flagellar hook protein FlgE [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 400

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 201/416 (48%), Gaps = 26/416 (6%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A SN +  + +NIAN  TVG+K   + F+ +     + S V  G+++++     
Sbjct: 6   AVSGLNAASNNLDVIGNNIANSATVGFKSGTVTFADMF----AGSKVGMGVKVASVLQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L GYP+
Sbjct: 62  GNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNGRNIV-NAQGMQLTGYPV 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
             A  P +V +      + V   ++ A  TTT  I  NL K++  +       + G +  
Sbjct: 121 --AGTPPVVQTGADPVPLTVPDGDMLASQTTTASIVANL-KSSDAVPATAWATNPGAEGT 177

Query: 190 YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSF 249
           Y  K++   YD+ G+   + +Y+ KT +  W+   + +D S + +   N   LN      
Sbjct: 178 YNSKTALTTYDSQGNVHNFTLYFVKTANNTWQT--YAKDDSVSPATYQNAGTLN------ 229

Query: 250 DPVTGYLANSSHKA-ISFNDNTSGIDQQ----ITIDISKTTQLAGGFIPQKSEINGHAPG 304
                + AN +      FN N +G +       T++++ + Q    +  +    NG APG
Sbjct: 230 -----FAANGALTGHTPFNINLTGTNGAANGVFTLNLTGSVQQNTEYSYKSPTQNGFAPG 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               F+++ DG ++  Y +G + P+ ++ +A+  + + L     N +  T  SG   +G 
Sbjct: 285 SLTGFAINDDGTIEGSYSNGQKQPLGQILLASFANPEGLSPEGDNAWSETASSGQAVVGL 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G    G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 345 AGTGSLGKLIGKSTESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 400


>gi|39995527|ref|NP_951478.1| flagellar hook protein FlgE [Geobacter sulfurreducens PCA]
 gi|39982290|gb|AAR33751.1| flagellar hook protein FlgE [Geobacter sulfurreducens PCA]
 gi|298504527|gb|ADI83250.1| flagellar hook protein FlgE [Geobacter sulfurreducens KN400]
          Length = 419

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 122/443 (27%), Positives = 202/443 (45%), Gaps = 46/443 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-SYVSGG 59
           M +  ++ T +SG++A    +S + +NI+NV+T+G+K+  + FS ++  + S  S +  G
Sbjct: 1   MSVTSALYTGISGLNANGEAMSVIGNNISNVNTIGFKQGRMLFSDVLSSTISGGSQIGRG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
           ++I T +    QGS   T S TDLAIQG  FF+V+        TRAG F  N +  L N 
Sbjct: 61  VQIQTVENQFTQGSFESTESGTDLAIQGDSFFVVQNTSG-RYYTRAGAFSFNKDKTLVNP 119

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTT-------TGFISNNLDKNA 172
            G  ++GY +  +S         GL    +K  +L+   TT         F+ N LD   
Sbjct: 120 EGYQVMGYGIIPSS---------GLSDGVLKPIDLTNFATTPPKQTSTVKFVVN-LDSTQ 169

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
           T  T    P +    + Y+  +S + YD+ G++    VY+ KT D  W+  +   D    
Sbjct: 170 TTPTLAWDPANPVATSNYS--TSLSVYDSQGNAHTATVYFRKTADNAWDWHVILPD---- 223

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT-------------- 278
                  A   T   +  P+ G L   +  A++     +G  Q IT              
Sbjct: 224 -------AAAGTPGSTTTPIDGTLTFDATGALTAQTPLAGAAQNITFAGGVTAPQPIFFD 276

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
           + +  TTQ A   +      +G+  G     ++   GYV+ +Y +G    +Y++A+A   
Sbjct: 277 LGVGATTQYASSSVVSSQTQDGYYQGTLTKVTIDDKGYVNGVYSNGQLQKLYQVALAKFS 336

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           S   L    G  +  T +SG            G+I + +LE +NVD+A++  ++I  QR 
Sbjct: 337 STAGLSKAGGTLFEETLESGQPLFSDASTPGVGKILANSLEQSNVDMAAQFVKMITTQRG 396

Query: 399 YAVNSKVFQTGSDFMDILISLKR 421
           Y+ NSK   T  + +  ++SLKR
Sbjct: 397 YSANSKTITTADEMLQEVLSLKR 419


>gi|238796904|ref|ZP_04640408.1| Flagellar basal body FlaE domain protein [Yersinia mollaretii ATCC
           43969]
 gi|238719164|gb|EEQ10976.1| Flagellar basal body FlaE domain protein [Yersinia mollaretii ATCC
           43969]
          Length = 407

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 117/417 (28%), Positives = 194/417 (46%), Gaps = 23/417 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
            +SG++A S  +  V +NIAN  TVG+K  +IAF+ +     + S V  G+++S+ +   
Sbjct: 6   GLSGLNAASQALDVVGNNIANSQTVGFKSGSIAFADVF----AGSQVGMGVQVSSVNQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G L   AS+ D+ IQG GFF +         +R G F  +  GF+ N  G  L GY  
Sbjct: 62  SDGVLGSGASSLDMGIQGNGFFRLTNEAGRVFYSRNGQFKQDENGFIINNQGMFLTGY-- 119

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT--PKHNGRD 187
           + +  P  +     +  I +   ++ A  +  G +S NLD    ++ P     P  N   
Sbjct: 120 QASGTPPAIQPGAAVGPIQIPSGQMPARASDGGSLSGNLDSGTEVVDPAIKFDPADN--- 176

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL-NTVE 246
             Y+  S    YD+LG+    +VYY KT D +W+   +  D +T+     N  P+   +E
Sbjct: 177 KSYSSVSQVDGYDSLGNRHTINVYYVKTSDNEWKA--YSSD-TTSPKLDNNGDPVYQELE 233

Query: 247 VSFDPVTGYL----ANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           + FD  +G L    A  S ++ ++N    G      +D+   TQ A           G+A
Sbjct: 234 LKFD-TSGQLTTKPAKLSVQSAAYN---GGEPLDFELDMDGMTQQASDTAMASPTTTGYA 289

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
           PG+   ++V  +G +   Y +G +  + ++ ++   +   L     N +  T  SG    
Sbjct: 290 PGQMNGYTVGDNGQIIASYSNGQQQLLGQVVLSNFTNPGGLSSQGDNCWSETPASGQPVD 349

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           G  G    G +F   LE +NVD++ E+  +I  QRNY  NS+  +T S+ + IL +L
Sbjct: 350 GIAGTGNLGNLFGNRLEASNVDLSKEMVNMIVYQRNYQSNSQTIKTQSELLQILANL 406


>gi|292492363|ref|YP_003527802.1| flagellar basal body FlaE domain protein [Nitrosococcus halophilus
           Nc4]
 gi|291580958|gb|ADE15415.1| flagellar basal body FlaE domain protein [Nitrosococcus halophilus
           Nc4]
          Length = 425

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 112/428 (26%), Positives = 211/428 (49%), Gaps = 17/428 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S  T++SG++A S+ +  VS+NIAN +T G+KR+   F+ +   S+  S    V  G+ +
Sbjct: 2   SFNTSLSGLNAASSDLDVVSNNIANANTTGFKRSRAEFADIFAVSSFGSPKTAVGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
           +      +QG+L  T +  DLA+ G+GFF +      N L  +RAG F IN +G++ N A
Sbjct: 62  NRAAQQFDQGNLDFTQNILDLAVSGRGFFALSPNLTNNELVYSRAGAFSINKDGYVVNGA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  YP+ N    +  +S +  + + +  +  +   T+   I  NL  +A  + P   
Sbjct: 122 GQFLRTYPV-NQDGTVTASSLESSQPVRLPTSAGTPQATSQVSIGANLPADAASLDP--- 177

Query: 181 PKHNGRDAE-YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
              +  DA+ +T  +S   +D+LG+S +  +Y+ K  +   + +++        +     
Sbjct: 178 ANFDPLDADTFTASTSTTVFDSLGNSHISTLYFVKDTNSPNQWAVYNALDGALVNVSGGT 237

Query: 240 APLNTVE---VSFDPVTGYLANSSHKAIS----FNDNTSGIDQQITIDISKTTQLAGGFI 292
           A    ++   ++FD   G +  +    ++      +  + +   +    + TTQ+A  F 
Sbjct: 238 AGAGGIQYGTLNFDSSGGLMGTTPSPLVTDPIVLGNGANDMTLTLNFPSTNTTQVASPFN 297

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
               + +G   G+     +S+ G +   + +G  + + ++A+A  P+E  L+    N++ 
Sbjct: 298 VTALDQDGFTSGRLTGLDISETGVIRANFSNGQNLALGKVALAQFPNEQGLRQLGNNSWA 357

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T DSG    G  G+   G I  GALE++NVD+ +EL  LI AQRN+  N++  +T S  
Sbjct: 358 GTIDSGAAIAGEAGNGSFGLIQGGALESSNVDLTAELVHLITAQRNFQANARAIETASTL 417

Query: 413 MDILISLK 420
            D +++++
Sbjct: 418 TDSILNIR 425


>gi|47566136|ref|ZP_00237174.1| flagellar hook protein flgE, putative [Bacillus cereus G9241]
 gi|47557053|gb|EAL15383.1| flagellar hook protein flgE, putative [Bacillus cereus G9241]
          Length = 409

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 116/433 (26%), Positives = 198/433 (45%), Gaps = 38/433 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGNYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + TT G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIQTTKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            N + IT D                    YD  G++    V +TKT + ++   + R++ 
Sbjct: 180 VNESKITQD-----------------LPFYDDAGNTWTMRVEFTKTSEHEYTYKVQRRND 222

Query: 230 STNNS-FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           S  +S F       +T  + F+ V           I FN  T      I +D SK T   
Sbjct: 223 SVKDSKFEEVTGAGSTGTLKFNNVGNPNPVQQGANIPFNGGT------INLDFSKLTNHP 276

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 277 TDKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 336

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G+I  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 337 GNYTATNTTGILALGASGQNGAGKIRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKV 396

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 397 SDEVLNEVVNLIR 409


>gi|15639714|ref|NP_219164.1| flagellar hook protein FlgE [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025952|ref|YP_001933724.1| flagellar hook protein FlgE [Treponema pallidum subsp. pallidum
           SS14]
 gi|6015169|sp|O07884|FLGE_TREPA RecName: Full=Flagellar hook protein flgE
 gi|2196893|gb|AAB61251.1| FlgE [Treponema pallidum]
 gi|3323028|gb|AAC65692.1| flagellar hook protein (flgE) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018527|gb|ACD71145.1| flagellar hook protein [Treponema pallidum subsp. pallidum SS14]
 gi|291060091|gb|ADD72826.1| flagellar hook protein FlgE [Treponema pallidum subsp. pallidum
           str. Chicago]
          Length = 463

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 119/468 (25%), Positives = 216/468 (46%), Gaps = 54/468 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-----NSYVS 57
           ++ S+ + +SGM     R+  + +N+ANV+T G+KR  + F  L+    S     N  V 
Sbjct: 1   MMRSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSAAARPNEEVG 60

Query: 58  G--------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
           G        G+ I++ D +  QG+L  T  NTD++IQG GFF++K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGVLIASIDTVHTQGALQTTGINTDVSIQGSGFFVLKSGEKT-FFTRAGAFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           ++N G L N A G+ + G+  ++ +   ++NS    + + +   + + A  T+T   + N
Sbjct: 120 VDNAGTLVNPANGMRVQGWMAQDVAGERLINSSAQTQDLVIPIGQKIDAQQTSTVHYACN 179

Query: 168 LDKNATIITPDKTPKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVSI 224
           LDK      P+     N  D  + T  + F  YD+ G      + +++    + +W+ ++
Sbjct: 180 LDKRL----PELAADANEADVRKSTWTTDFQVYDSFGQQHTLQINFSRVPGTNNQWQATV 235

Query: 225 F-----RQDQSTNNSFPYNVAPLNTVEVSFD-----------------PVTGYLANSSHK 262
                   D  T      +    NT  V+FD                 P    L  +S+ 
Sbjct: 236 AVDPGTEVDTQTRVGVGTSDGAANTFIVNFDNFGHLASVTDTAGNVTGPTGQVLLEASYD 295

Query: 263 AISFNDNTSG--IDQQITIDISKT-------TQLAGGFIPQKSEINGHAPGKPKDFSVSK 313
            +  N + +G       T+++ +        TQ A     +    +G+A G  ++F + +
Sbjct: 296 VVGANPDDAGQVTRHAFTLNLGEIGTARNTITQFAERSTTKAYRQDGYAMGYLENFKIDQ 355

Query: 314 DGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEI 373
            G +  +Y +G    I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++
Sbjct: 356 SGVITGVYSNGVSQDIGQLALAGFANQGGLEKAGENTYVQSNNSGIANISTSGVMGKGKL 415

Query: 374 FSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            +G LE +NVD+  + T++I  Q+ +   +K  QT    +D ++SLKR
Sbjct: 416 IAGTLEMSNVDLTDQFTDMIITQKGFQAGAKTIQTSDTMLDTVLSLKR 463


>gi|157959902|ref|YP_001499936.1| flagellar hook protein FlgE [Shewanella pealeana ATCC 700345]
 gi|157844902|gb|ABV85401.1| flagellar basal body FlaE domain protein [Shewanella pealeana ATCC
           700345]
          Length = 402

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 197/416 (47%), Gaps = 22/416 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  TVG++     FS++      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANSSTVGFRSGRSEFSAIY-----NGGQAGGVNVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S  GSL +T    D+ IQG+GFF++ G+D      RAG F+ + +G++ + AG  L
Sbjct: 57  SQNFSMGGSLTYTGRQLDMGIQGEGFFVLSGQDGSTSYARAGMFNQDADGYITDPAGNRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +  A+  L   +   L+   V+   L+A  T+T  +++NLD    +I P  +P   
Sbjct: 117 QGYSIG-ATGNLQNGNVTDLQ---VQTGALAAQATSTIGLTSNLDARVEVIDPATSPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + Y   S+ AA+D+LG+      YY KT D KW V  +  D +       +V P+  
Sbjct: 173 DDASTYHSSSTIAAFDSLGNEHALTQYYVKTADNKWSVH-YNMDGT-------DVTPVGG 224

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNT---SGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             + FD   G L   +   ++  D        + ++ +   K+TQ A  +       NG+
Sbjct: 225 HTLEFDS-NGMLTTGNDITLNITDAAIIGGASNMELALSFDKSTQYAADYNNSSLNQNGY 283

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+     +  +G +   Y +G      ++ +A   + + L     N +  +  +G   
Sbjct: 284 TSGELNGIRIDDNGMLYGTYTNGQEQIQGQVVLADFSNPNGLVPTSNNAWTASNAAGQPI 343

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           IG P     G + +G LE +NVD  +E+  L+ AQRNY  N+KV  T S     L+
Sbjct: 344 IGTPTTGTLGGLSAGYLEGSNVDQTAEMVNLMTAQRNYQSNAKVLDTNSTMQQALL 399


>gi|221199739|ref|ZP_03572782.1| flagellar basal body protein FlaE [Burkholderia multivorans CGD2M]
 gi|221208656|ref|ZP_03581656.1| flagellar basal body protein FlaE [Burkholderia multivorans CGD2]
 gi|221171467|gb|EEE03914.1| flagellar basal body protein FlaE [Burkholderia multivorans CGD2]
 gi|221179978|gb|EEE12382.1| flagellar basal body protein FlaE [Burkholderia multivorans CGD2M]
          Length = 413

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 196/418 (46%), Gaps = 14/418 (3%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTALAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +     +   TR G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMSNNGTI-TYTRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  I+   + N+    P KTP  
Sbjct: 123 MGYAADKNG----VINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPTKTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN--SFPYNVAP 241
                 Y + +S   YD+LG S   ++Y+ KT    WE     Q  +TN+  +  ++ + 
Sbjct: 176 ATDTTTYNYSTSIQVYDSLGGSQAVNMYFVKTAAGTWEAYAGVQGGTTNDLGTIQFDSSG 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             +   +  P T   A    +    N + S   Q +T+D++ TTQ  G         +G+
Sbjct: 236 AISGTTTGSPATPTAALGQFQFTVPNTDGSATPQTLTLDLTGTTQYGGKDGVNNLAQDGY 295

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G    F++  DG +   Y +G    + ++A+A   + + L    GN Y  T  SG   
Sbjct: 296 ASGTLTTFTIGTDGKLTGNYSNGQTAVLGQIALANFNNPNGLVNIGGNQYAETAASGVPQ 355

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 356 ISVPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|161526186|ref|YP_001581198.1| flagellar hook protein FlgE [Burkholderia multivorans ATCC 17616]
 gi|189349098|ref|YP_001944726.1| flagellar hook protein FlgE [Burkholderia multivorans ATCC 17616]
 gi|160343615|gb|ABX16701.1| flagellar basal body FlaE domain protein [Burkholderia multivorans
           ATCC 17616]
 gi|189333120|dbj|BAG42190.1| flagellar hook protein [Burkholderia multivorans ATCC 17616]
          Length = 414

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 195/420 (46%), Gaps = 17/420 (4%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTALAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +     +   TR G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMSNNGTI-TYTRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  I+   + N+    P KTP  
Sbjct: 123 MGYAADKNG----VINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPTKTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN----SFPYNV 239
                 Y + +S   YD+LG S   ++Y+ K+    WE     Q   TN+     F  + 
Sbjct: 176 ATDTTTYNYSTSIQVYDSLGGSQAVNIYFVKSAAGTWEAYAGVQGGKTNDLGTIQFDSSG 235

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
           A   T +    PVT   A    +    N + S   Q +T+D++ TTQ  G         +
Sbjct: 236 AISGTTKAG-TPVTPTEALGQFQFTVPNTDGSATPQTLTLDLTGTTQYGGKDGVNNLAQD 294

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A G    F++  DG V   Y +G    + ++A+A   + + L    GN Y  T  SG 
Sbjct: 295 GYASGTLATFTIGTDGKVTGNYSNGQTAVLGQIALANFNNPNGLVNIGGNQYAETAASGV 354

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
             I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 355 PQISVPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 414


>gi|332162901|ref|YP_004299478.1| Lateral flagellar hook protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667131|gb|ADZ43775.1| Lateral flagellar hook protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863351|emb|CBX73474.1| flagellar hook protein flgE [Yersinia enterocolitica W22703]
          Length = 397

 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 192/419 (45%), Gaps = 29/419 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS-T 64
           S   A +G+ A + +++ +S+NIAN  T G+K     F+S+   S        G+ +S T
Sbjct: 2   SFSIANTGLSAVTEQLNTISNNIANSGTKGFKSGRTEFASMYAQSQPL-----GVGVSGT 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              I + GS+  T +  DLAI G GFF+VK        TRAG F  +  G L N +G  L
Sbjct: 57  SQSIKKDGSIDRTGNAMDLAISGNGFFVVKNSSGDEAYTRAGMFTTDKNGVLVNASGMKL 116

Query: 125 LGYPLKNASAPLIVNSFQGL-ERINVKHAELSAMPTTT-GFISNNLDKNATIITPDKTPK 182
            GYP   A      N   G+   + +    L A  T+  GF++N     A+   P  T  
Sbjct: 117 QGYPADAAG-----NVQTGIVSDLKISTVGLPAKATSKLGFMAN---LPASAQQPTNTTF 168

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEVSIFRQDQSTNNSFPYNVAP 241
             G    Y   S+   YD+LG   +   Y+ K  G   W+V  +  D + N+        
Sbjct: 169 SVGSKDSYNFMSTSTTYDSLGREHLLTQYFVKQAGAGDWKVH-YAVDGAANSG------- 220

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEING 300
               ++ FD  +G L + + K I+      G D   I I  + TTQ    F+P  S+ +G
Sbjct: 221 --AHDLKFD-TSGVLTSGNSKTITGGYTPVGADNYGIDITYTGTTQFHAEFLPAPSKSDG 277

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +  G      +  DG V   + +G ++   +L +A   + + L   +G T+  T  SG  
Sbjct: 278 YTAGTKNGERIENDGSVYATFSNGKQMLQGKLVLANFANPNGLATQNGTTWSVTSRSGAP 337

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            +G PG    G I +GALE +NVD+ +EL  L+ AQRNY  N+K+  T    M+ L  +
Sbjct: 338 LLGSPGTGLLGNIVAGALEASNVDLTAELVGLMTAQRNYQANTKIISTNDSMMNALFQV 396


>gi|317121822|ref|YP_004101825.1| flagellar hook-basal body protein [Thermaerobacter marianensis DSM
           12885]
 gi|315591802|gb|ADU51098.1| flagellar hook-basal body protein [Thermaerobacter marianensis DSM
           12885]
          Length = 406

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 124/438 (28%), Positives = 201/438 (45%), Gaps = 51/438 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL--------VFPS---- 50
           ++ S+   +SG+     R+  + +NIANV+TVG+K + + F  L          P+    
Sbjct: 1   MMRSLYAGISGLQNHQLRMDVIGNNIANVNTVGFKSSRVTFKELFNQTLRGAAAPAGPTR 60

Query: 51  --TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
             T+   +  G  ++  D+I + G+   T   TDLAIQG GFF+++        TRAGDF
Sbjct: 61  GGTNPIQIGLGTALAGIDVIHQPGNPQVTGVATDLAIQGDGFFVLQDAAGGYAYTRAGDF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKH---AELSAMPTTTGFIS 165
            ++  G+L N  G  +LG+  +    P       G  R+ V     A+ S+  T     S
Sbjct: 121 RLDAAGYLVNADGLRVLGWQAQGGVLPARDAVNLGPIRVPVDMFVPAQASSRVT----WS 176

Query: 166 NNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           +NLD      TP  TP     D           YD+LG++      +T+TG  +W    +
Sbjct: 177 SNLDAT----TPTNTPLTRAVDV----------YDSLGNAHTLIFTFTRTGSNQWS---W 219

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
           + + + N         L    ++F   +G L   +   +SF   T      + +D S  T
Sbjct: 220 QAEDAANPG-----TSLGQGTLTFGN-SGLLTAGNTGTVSFTP-TGAATINLQVDFSGLT 272

Query: 286 QLAGGFIPQKSE--INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
           Q A    P   E   +G+  G+   F++   G +   + +GT  PI ++A+A+  +   L
Sbjct: 273 QYAA---PSTLEGTADGYPAGELTSFAIDTSGTITGTFSNGTTQPIAQVALASFANPAGL 329

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
            L DGN Y  + +SG   IG  G    G +  GALE +NVD++ E  ++I  QR +  NS
Sbjct: 330 -LRDGNLYWESNNSGVARIGVAGTGGRGALTPGALEMSNVDLSREFVDMIVTQRGFQANS 388

Query: 404 KVFQTGSDFMDILISLKR 421
           +V  T  + +  L++LKR
Sbjct: 389 RVITTSDEMLQELVNLKR 406


>gi|94968673|ref|YP_590721.1| flagellar basal body FlaE [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550723|gb|ABF40647.1| flagellar basal body FlaE [Candidatus Koribacter versatilis
           Ellin345]
          Length = 409

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 122/430 (28%), Positives = 196/430 (45%), Gaps = 47/430 (10%)

Query: 11  MSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS------YVSGGLEIST 64
           +SG+ A S  ++ +++N+AN +T+GYK+T   F  L +     +       V  G  I T
Sbjct: 8   LSGLTASSTALATIANNLANQNTIGYKQTRALFRDLFYQQIGQTGSGDPIQVGAGTMIGT 67

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
            D     GS+  T   TD+AI G GFF+ +   N +  TRAG+F +  +G L    G V+
Sbjct: 68  IDTNFTDGSVSPTGVPTDVAIMGDGFFVAQQNGN-DIYTRAGNFKVGADGTLRTQDGAVV 126

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNNLDKNATIITPDKTPKH 183
           LGY   +      V +  GL  +N+   ++S+   TT   ++ NL+ +A +         
Sbjct: 127 LGYQAVDGK----VTTGSGLGALNLGQGQVSSPSATTSLQLTTNLNASAKV--------- 173

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                  ++ +S   YD+LG   V    +TKTG   W+            S P     L 
Sbjct: 174 -----GDSYNTSLKVYDSLGGVHVVTFTFTKTGTNTWDYDASLPTGEGTVSLPSGSHTLT 228

Query: 244 ----------TVEVSFDPVTGYLANSSHKAISFN--DNTSGIDQQITIDISKTTQLAGGF 291
                     +  ++FD        S  K +++   D T G         S  TQ+A   
Sbjct: 229 FDSDGKLTTPSSNINFDLTGLSDGASDMKGVTWKLYDATGG---------SSMTQMAADS 279

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
               +  +G+  G  ++F++  DG ++  + +G    I ++AIA+ P+   L+    N Y
Sbjct: 280 ATPATAQDGYGSGMLQNFNIGADGTIEGTFSNGKTSIIGQIAIASFPNVQGLRKVGQNAY 339

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T  SG  ++G PG    G +  GALE +NVD+A+E + LI AQR Y  N+KV  T  +
Sbjct: 340 VGTLASGQAALGAPGSGGRGTLGGGALELSNVDMATEFSNLIVAQRGYQANAKVITTFDE 399

Query: 412 FMDILISLKR 421
                I+LKR
Sbjct: 400 ITQDTINLKR 409


>gi|119503644|ref|ZP_01625727.1| flagellar hook protein [marine gamma proteobacterium HTCC2080]
 gi|119460706|gb|EAW41798.1| flagellar hook protein [marine gamma proteobacterium HTCC2080]
          Length = 410

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 134/429 (31%), Positives = 200/429 (46%), Gaps = 34/429 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-GLEIST 64
           +  TA+SG+ A    +  +S+NIAN  TVG+K +   F+ +   S S    +G G+E++ 
Sbjct: 2   AFSTAISGIKAAQANLDVISNNIANASTVGFKASRAQFAEIYASSVSGGSNAGQGVELTE 61

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QGSL  T S  DLAI G GFFIV      +  TRAG F ++ +GFL N +G  L
Sbjct: 62  IRAEFSQGSLDFTGSGLDLAISGNGFFIVS-NAGASEYTRAGSFQVDRDGFLTNESGNRL 120

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD-KNATIITPDKTPKH 183
            GY     +   ++    G   I+    +       T  I++NLD + A   T    P  
Sbjct: 121 QGY---QGNTDGVITGELGDLFIDTTLVDPKVTSKVT--ITSNLDSREAVPTTATFAPTD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                 Y   +S   YD+LG+S V  +YY K +    W+V         + S      P 
Sbjct: 176 ---PTSYNSTTSTTIYDSLGNSHVLQLYYVKQSAANTWKV---------HTSVDGGTPPA 223

Query: 243 NTVEVSFDPVTGYLANSSHKAISFND------NTSGIDQ-----QITIDISKTTQLAGGF 291
            T  ++FD   G LA +S  AIS         + SG+         ++DI  TTQL   F
Sbjct: 224 ATT-ITFDS-DGTLATNSANAISITTPANELLSASGVATGAAALAYSVDILATTQLGSDF 281

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
               +  +G+  G+   F     G     Y +G    I ++A+A+  + + L+   G+ Y
Sbjct: 282 SVNSAIQDGYGAGQLISFEFDDSGTAFARYTNGQSRAIGQVALASFRNNNGLQPVGGSNY 341

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + +  SG  +IG PG++  G I S A+E ANVDI  EL  LI AQRN+  N++V  T   
Sbjct: 342 VESFGSGGPNIGVPGNSGRGNIQSSAVEQANVDITQELVNLIVAQRNFQANAQVISTEDQ 401

Query: 412 FMDILISLK 420
               +I+L+
Sbjct: 402 ATQAVINLR 410


>gi|268316347|ref|YP_003290066.1| hypothetical protein Rmar_0780 [Rhodothermus marinus DSM 4252]
 gi|262333881|gb|ACY47678.1| protein of unknown function DUF1078 domain protein [Rhodothermus
           marinus DSM 4252]
          Length = 415

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 119/443 (26%), Positives = 215/443 (48%), Gaps = 52/443 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ S++T +SG+ +   R+  +S+NIANV+T  +KR   AF+ L+  +            
Sbjct: 1   MIRSLRTGVSGLKSHQVRMDVISNNIANVNTTAFKRGRAAFNELLGQTLLGVGRTAGGRG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHI 110
            + SYV  G+ + + D+   QG+L +T   TDL I G GFF+V+G D +  LTRAG+F I
Sbjct: 61  INPSYVGLGVSVGSIDVNFAQGALENTGVATDLGINGDGFFVVRGGDRI-YLTRAGNFTI 119

Query: 111 NNEGFLENVAGGVLLGYP------LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFI 164
           N  G L   +G  + G+       L++A+          LE + V  +  +A P  T  I
Sbjct: 120 NRFGELVTNSGLQVQGWAFDENGELQSAA----------LEDVRVPFSA-TAPPKQTENI 168

Query: 165 SNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVS 223
               + NA +             A  T   S   YD  G +    + +T+T +  +W+ +
Sbjct: 169 YVRGNLNAELA------------AGETVTVSTVVYDPQGKAKTIIIEFTRTSNPNEWQWN 216

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
           +  +D    N     +   + + ++FD         + +   ++ +  G  +  T++++ 
Sbjct: 217 LLDED---GNPLGVTITSGDNL-ITFDTQGNLDPTEALQTFDWDIDNDGTLESFTLNLAG 272

Query: 284 T----TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPS 339
                TQ AG       + +G  PG    FS++++G V++ + +G +  IY+LA+ +V +
Sbjct: 273 ADDALTQYAGSTTATVRDQDGQPPGSLIGFSINQEGIVELNFSNGYQQKIYQLALGSVNN 332

Query: 340 EDNLKLFDGNTYLPTRDSGDISIGFPG-HNQHGEIFSGALETANVDIASELTELIEAQRN 398
            + L+    N +  T  SGD+++G  G       I +G LE +NVD+A+E T++I  QR 
Sbjct: 333 VNGLQQVGDNLWSLTSSSGDLALGRAGVELNRTVIVAGTLEMSNVDLATEFTDMIVTQRG 392

Query: 399 YAVNSKVFQTGSDFMDILISLKR 421
           Y  ++++  T  + +  L+ LKR
Sbjct: 393 YQASARIITTSDEMLQELVQLKR 415


>gi|225181603|ref|ZP_03735044.1| protein of unknown function DUF1078 domain protein [Dethiobacter
           alkaliphilus AHT 1]
 gi|225167711|gb|EEG76521.1| protein of unknown function DUF1078 domain protein [Dethiobacter
           alkaliphilus AHT 1]
          Length = 408

 Score =  142 bits (359), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 122/432 (28%), Positives = 199/432 (46%), Gaps = 43/432 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----------- 54
           S+ T +SG+     ++  + +NIANV+T  +K   + F  ++  +   +           
Sbjct: 4   SLFTGVSGLRNHQTKMDVIGNNIANVNTTAFKAGRVRFQDILSQNIRGASAPQDGRGGIN 63

Query: 55  --YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
              V  G+ +++ D I   GSL  T   TDLAIQG GFF++   D  N   +R G F + 
Sbjct: 64  PAQVGLGMSVASIDTIHTPGSLQSTGRPTDLAIQGSGFFVMS--DGANEFYSRDGAFSLG 121

Query: 112 NEGFLENVAGGVL-LGYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNNLD 169
           ++G L N A G   LG+    A A   +N+   L+ +N+     ++   T     S+NLD
Sbjct: 122 SDGDLVNGANGFKPLGW---QADAFGNINTNGPLQPLNIPLGHNVTTRATENLTFSSNLD 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
             A I T               H +    Y++ G S + ++ +TKTG   WE   +    
Sbjct: 179 SLAEIGTE--------------HMAESLVYNSQGGSHLVEIIFTKTGSNTWE---WEASG 221

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
            T N     V+   T+E  FD     L  +   AIS  D     D  + +D +  +Q+ G
Sbjct: 222 ITGNE---TVSGQGTIE--FDEFGNLLQATGDAAISITDIDGADDISMAVDFNNMSQVVG 276

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               Q    +G   G+  +F++ K G +  IY +G  V + ++A+A+  + + L    GN
Sbjct: 277 HSNAQVRYQDGFPAGELTEFTIGKTGVISGIYTNGLVVELGQIALASFDNPEGLMKAAGN 336

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  + +SG   +G  G    G I +G LE +NVD++ E TE+I   R +  NS+V  T 
Sbjct: 337 MYQVSSNSGQARVGGAGLEGRGVIETGTLEMSNVDLSYEFTEMITTSRGFQANSRVITTS 396

Query: 410 SDFMDILISLKR 421
            D +  +++LKR
Sbjct: 397 DDLLQEVVNLKR 408


>gi|77165838|ref|YP_344363.1| hypothetical protein Noc_2375 [Nitrosococcus oceani ATCC 19707]
 gi|254433154|ref|ZP_05046662.1| conserved domain protein [Nitrosococcus oceani AFC27]
 gi|76884152|gb|ABA58833.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gi|207089487|gb|EDZ66758.1| conserved domain protein [Nitrosococcus oceani AFC27]
          Length = 425

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 119/428 (27%), Positives = 202/428 (47%), Gaps = 17/428 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           +  T++SG++A S+ +   ++NIAN  T G+KR+   F+ +   S+   S + V  G+ +
Sbjct: 2   AFNTSLSGLNAASSDLDITANNIANASTTGFKRSRGEFADIFAVSSFGRSQTAVGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
           +      EQG+L  T ++ DLAI G+G F +    N + L  +RAG F ++ EG++ N +
Sbjct: 62  NKTAQQFEQGNLDFTQNSLDLAISGRGLFALSPSLNSDDLVYSRAGAFSVDKEGYVVNSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P  NA+      S      + +  +  +   T+   I  NL  +A  + P   
Sbjct: 122 GQYLRTFP-TNANGTATAASLSNSHPLRLPTSAGTPQATSQVSIGANLPSDAAALDPASL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TGDKKWEVSIFRQDQSTN-NSFPY 237
              +   + YT  +S   YD+LG+S +  +Y+ K   G  +W V         N N    
Sbjct: 181 DLLDA--STYTASTSETVYDSLGNSHISTLYFLKDTNGINQWAVYHSLDGTLANINGGTA 238

Query: 238 NVAPLNTVEVSFDPVTGYLANSS-----HKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
               +    ++FD  TG L  S         ++ N+  + I  ++    + TTQ+A  F 
Sbjct: 239 GAGGIQYGTLNFD-ATGILTGSVPDPLITDPLALNNGANDIAMRLDFAANNTTQVASPFN 297

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G   G+     +S  G +   Y +G    + ++A+A  P+E  L+    N + 
Sbjct: 298 VAVLNQDGFTSGRLTGLDISNTGIIQANYSNGQNSTLGKIALAQFPNEQGLRQLGNNAWA 357

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T  SG    G  G    G I +GALE++NVD+ +EL  LI AQRN+  N+K  +T S  
Sbjct: 358 ETVSSGTALAGEAGVGSFGLIQTGALESSNVDLTAELVHLITAQRNFQANAKAIETASTV 417

Query: 413 MDILISLK 420
            D +I+++
Sbjct: 418 TDTIINIR 425


>gi|149189836|ref|ZP_01868116.1| flagellar hook protein E [Vibrio shilonii AK1]
 gi|148836322|gb|EDL53279.1| flagellar hook protein E [Vibrio shilonii AK1]
          Length = 398

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 187/420 (44%), Gaps = 34/420 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA + +++ +S NIAN  T G+K     FS++      N   +GG+E+ S 
Sbjct: 2   SFDIALSGLDATNTQLNTISHNIANASTYGFKEARTEFSAVY-----NGMQAGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TRAG F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVSGTGRAMDLAINGNGFFVTKDHMGQTLYTRAGVFGTDKDNYVVGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + +++  L+  S   L+   +  + L+A  T       N D ++ I+     P   
Sbjct: 117 QGYGV-DSNNNLLTGSVGDLK---ISTSSLAAQATDKLDFVANFDASSKIVDQTVNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+S     Y+TKT D  WEV++     ST         P  T
Sbjct: 173 ADPDSFNSSYTSKVYDSLGNSHTVTQYFTKTADNTWEVNVQVDGGST---------PAQT 223

Query: 245 VEVSFDPVTGYLANSSHKAISFN-------DNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
           V V+F+P  G LA+ +    SFN        N   ID    I +  +TQ    F    + 
Sbjct: 224 VPVTFNP-DGTLASPTG---SFNVAFPAAGANAMSID----ISLEGSTQFGAAFGVSTNN 275

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            NG+  G+     V  +G V   Y +G      ++ +A   +   L   +G  +  +  S
Sbjct: 276 PNGYTSGELAGVRVEDNGMVFATYTNGQSQLQGQVVLANFANPQGLAKTNGTAWTQSYGS 335

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G   +G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 336 GAPVMGTPGSGVLGDLTPGALEGSNVDLTSELVNLMTAQRNYQANAKTISTSDKLTQALF 395


>gi|91224199|ref|ZP_01259462.1| flagellar hook protein E [Vibrio alginolyticus 12G01]
 gi|269965644|ref|ZP_06179757.1| Flagellar hook protein flgE [Vibrio alginolyticus 40B]
 gi|91191110|gb|EAS77376.1| flagellar hook protein E [Vibrio alginolyticus 12G01]
 gi|269829712|gb|EEZ83948.1| Flagellar hook protein flgE [Vibrio alginolyticus 40B]
          Length = 398

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 187/416 (44%), Gaps = 26/416 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFSAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F  +   F+   +G  L
Sbjct: 57  SQNFDKDGSITGTGRAMDLAINGGGFFVTKDNMGQMLYTRSGVFSTDKNNFVTANSGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + +++  L+  S   +  I V  + L+A  T +     N D +A++I    TP + 
Sbjct: 117 QGYSV-DSNNNLMTGS---VGNIQVSTSSLNAKATDSLDFVANFDASASVIDKAVTPFNP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + +    +   YD+LG+S     Y+TKT    WEV++     +T         P+ T
Sbjct: 173 KDPSSFNSSYTTKVYDSLGNSHTVTQYFTKTASNSWEVNVQVDGGTT---------PVAT 223

Query: 245 VEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           V V+F       A ++   +SF     N   +D    I++  +TQ    F    +  NG+
Sbjct: 224 VPVTFGKDGSLSAPTAPFNVSFPAAGANAMSVD----INLKGSTQFGAAFGVSTNSPNGY 279

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+     V  +G V   Y +G      ++ +A   +   L    G ++  +  SG   
Sbjct: 280 TSGELAGVRVEGNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTSWTQSFSSGAPI 339

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           +G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 340 MGVPGSGTMGDLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQALF 395


>gi|261821153|ref|YP_003259259.1| flagellar hook protein FlgE [Pectobacterium wasabiae WPP163]
 gi|261605166|gb|ACX87652.1| fagellar hook-basal body protein [Pectobacterium wasabiae WPP163]
          Length = 405

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 105/413 (25%), Positives = 198/413 (47%), Gaps = 15/413 (3%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A SN +  + +NIAN  TVG+K  A+ F+ +     + S V  G+++++     
Sbjct: 6   AVSGLNAASNNLDVIGNNIANSATVGFKSGAVTFADMF----AGSKVGMGVKVASVLQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L GYP+
Sbjct: 62  GNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNGRNIV-NAQGMQLTGYPV 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD--KTPKHNGRD 187
                P +V +      + V   ++ +  TT   +  NL  +  + T     TP   G +
Sbjct: 121 T--GTPPVVQTGADPVPLTVPDGDMLSRATTAATLKANLKSSDAVPTGSWATTP---GAE 175

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEV 247
             Y  K++   YD+ G+   + +Y+ KT +  W+   + +D S   +   +   LN    
Sbjct: 176 GTYNSKTNLTTYDSQGNKHDFTLYFVKTANNTWQT--YARDGSITPAVYQSAGTLNFEAN 233

Query: 248 SFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPK 307
                TG  A++    I+        +   TID++ + Q    +  +    NG+APG   
Sbjct: 234 GALSSTGATAHTPFT-INLTGTNGAANGTFTIDLTGSVQQNTEYSYKSPIQNGYAPGALT 292

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
            F+++ DG ++  Y +G + P+ ++ +A+  + + L     N +  T  SG   +G  G 
Sbjct: 293 GFAINDDGTIEGNYSNGQKQPLGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLAGT 352

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
              G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 353 GSLGKLIGKSTESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 405


>gi|206558968|ref|YP_002229728.1| flagellar hook protein FlgE [Burkholderia cenocepacia J2315]
 gi|198035005|emb|CAR50877.1| flagellar hook protein 1 FlgE1 [Burkholderia cenocepacia J2315]
          Length = 413

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 116/418 (27%), Positives = 195/418 (46%), Gaps = 14/418 (3%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFADMYANSVATSVNTQIGIGTSLNS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +   + V   +R G F  +  GF+ +  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGFIVDSQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+A  ++N+ Q    + ++    +  PT T  I+   + N+    P KTP   
Sbjct: 123 MGYA---ANAGGVINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPTKTPFSA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + +S   YD+LG S   ++Y+ K+    WE     Q  +T +           
Sbjct: 177 TDNTTYNYTTSIQVYDSLGGSQAVNMYFVKSAAGTWEAYAGVQGGATTDLGTITFDTSGA 236

Query: 245 VEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           ++ S    T     +S     F   N + S   Q++T+D++ TTQ  G         +G+
Sbjct: 237 IQ-STTTGTPATPTASLGQFQFTVPNTDGSATPQKLTLDLTGTTQYGGKDGVNNLAQDGY 295

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G    +S+  DG +   Y +G    +  +A+A   + + L    GN Y  +  SG   
Sbjct: 296 ASGTLTTYSIGADGKLTGNYSNGQTAVLGLIALANFNNPNGLVNLGGNQYAESAASGVPQ 355

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           +  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 356 VSAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|149191153|ref|ZP_01869411.1| flagellar hook protein E [Vibrio shilonii AK1]
 gi|148834991|gb|EDL51970.1| flagellar hook protein E [Vibrio shilonii AK1]
          Length = 408

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 111/418 (26%), Positives = 194/418 (46%), Gaps = 16/418 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG++A ++ ++ +S+NIANV T G+K +   F+S+   S +     GG+E+   
Sbjct: 2   SFSIALSGLNASNSELNTISNNIANVSTTGFKESRTEFASVYSGSEA-----GGVEVVGV 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + G++  T  + D+A+ G GFF+++        TR+G F++N +G +   +G  L
Sbjct: 57  SQNFEKSGTVTGTGRSLDMALSGNGFFVLEDSKGQTLYTRSGIFNMNADGVITANSGAAL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L++ S   +  + +  A L A  T +     NLD    +  P     ++
Sbjct: 117 QGYSV-DGNNNLLLGS---VGTVQISTASLQARETDSIEFVANLDAREQV--PAAAFDYS 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN--NSFPYNVAPL 242
              + Y H  +   YD+LG+      Y+ K     W V +    Q+ N  ++     +P 
Sbjct: 171 -DSSTYNHSYTTPVYDSLGNPHTVSQYFVKGASNDWNVHVLVDGQAINAADALVPAGSPT 229

Query: 243 NTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            T   +F     G +A+  + ++SF+         + ID+S  TQ    F+  K+  NG+
Sbjct: 230 TTDSANFTFNADGTIASGGNYSVSFDPANGANGVTVNIDLSSVTQFGSDFVVSKNSPNGY 289

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G      +  DG +   Y +G      ++ +A   +  NL       +L +  SG   
Sbjct: 290 TSGDYASVRMENDGRIFATYTNGQSQLQGQVVLADFAAPQNLIKTSDTAWLQSFSSGTPV 349

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           +G  G    G++ SGALE +NVD+ SEL  L+ AQRNY  N+K   T       L ++
Sbjct: 350 LGTAGSGVFGDLTSGALEGSNVDLTSELVALMTAQRNYQANTKSISTSDQLTQALFNV 407


>gi|152980177|ref|YP_001353111.1| flagellar hook protein FlgE [Janthinobacterium sp. Marseille]
 gi|151280254|gb|ABR88664.1| FlgE flagellar hook protein [Janthinobacterium sp. Marseille]
          Length = 416

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 113/434 (26%), Positives = 208/434 (47%), Gaps = 38/434 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +  +SG++A S  + A+ +N+AN  TVG+K++ + F+ +   + S S    +  G+++
Sbjct: 2   SFQQGLSGLNAASKSLEAIGNNVANSGTVGFKQSQVQFADIYASTLSGSGAAQIGIGVQV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +  QG++  + +  D+AI G GFF +    ++    R G F +  EG+++N +G 
Sbjct: 62  ARVAQLFSQGNIAVSNNPLDMAINGDGFFRMSSGGSI-TYGRNGQFELTKEGYIQNASGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY    A A  +V +   +E + +  A++    TT   +   LD    ++ P     
Sbjct: 121 RLTGY---MADANGVVQNGAPVELV-INKADMGPAATTKYDVKLTLDSRKDVLDP---LL 173

Query: 183 HNGRDAE-YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ-----------S 230
            N  DA  ++  +S   YD+LG+S +   +Y KT   +W  S+F  +            +
Sbjct: 174 FNPDDAATFSDSTSVPVYDSLGNSHILRTFYVKTAGGEW--SVFATNDGVPIGYTLPVTA 231

Query: 231 TNNSFPYNVAPLNT----VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
           TN   P  V    T    V  +  P+   +A ++  A  FN         IT++++ T Q
Sbjct: 232 TNPPVPLGVMDFGTGGALVSTTPSPMVAAMAVTTGAATPFN---------ITLNVAGTQQ 282

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            A  F   K+  +G+ PG    F V+ DG +   Y +G    + ++ +++  + + L+  
Sbjct: 283 FAQAFGVSKNLPDGYRPGTLTGFDVASDGSIMGRYSNGEVNVLGQVILSSFANPNGLQNI 342

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N ++ T +SG      PG +  G + S  +E +NVD+ +EL  +I AQR Y  N++  
Sbjct: 343 GDNQWVETAESGVPLTSTPGSSGLGVVQSARIEESNVDLTAELVNMITAQRVYQANAQTI 402

Query: 407 QTGSDFMDILISLK 420
           +T    M  L++L+
Sbjct: 403 KTQDQIMQTLVNLR 416


>gi|95928662|ref|ZP_01311409.1| protein of unknown function DUF1078-like [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135452|gb|EAT17104.1| protein of unknown function DUF1078-like [Desulfuromonas
           acetoxidans DSM 684]
          Length = 425

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 131/441 (29%), Positives = 215/441 (48%), Gaps = 36/441 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-----TSNSY 55
           MG+  ++ + +SG+   +  +S   +NI+N +T+GYK ++  FS ++  +     TS + 
Sbjct: 1   MGLTSTLYSGISGLQTNAEAMSVTGNNISNSNTIGYKSSSTVFSDMLSATISTTGTSVNQ 60

Query: 56  VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNCLTRAGDFHINNE 113
           V  G E++T      QGS   T+S+TDLA++G GFF++   G D V   TR G FH +  
Sbjct: 61  VGRGSELTTVRSNFSQGSFQSTSSDTDLAVEGAGFFMLSAAGTDEV-VYTRNGAFHFDPG 119

Query: 114 GFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK---HAELSAMPTTTGFISNNLDK 170
           G+L N  G  + G        P       G + +++K    +++ A+ T+   ++ NL+ 
Sbjct: 120 GYLVNADGYRVQGQLFDADGTP------GGGDPVDIKVDLTSQVPALQTSNIVLTTNLNS 173

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWE----VSIFR 226
               I            + Y+  +S   YD LG + +   Y+TKTGD+ WE    V    
Sbjct: 174 GTEEIPGGFDLSDPSESSNYS--TSTPIYDALGETHLATTYFTKTGDQTWEWNTVVDSAD 231

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT----SGID--QQITID 280
            D S  +S    V  + T  ++FD   G L  +S      ++ T    SG D  Q I I+
Sbjct: 232 LDPSVASSEESTV--IGTGTLTFDD-DGQLIGTS--GFDLDETTLMWASGADPTQSIAIE 286

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
              TTQ          + +G+A G+  + S++ DG V + Y +G    I  L +AT  + 
Sbjct: 287 F-DTTQFGRTSTVYSQDQDGYAAGEVVETSINSDGVVSVSYSNGETRDIATLTLATFTNP 345

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
             L     + Y  +R SG+  IG PG +Q G I++ +LE +NVD++ E  ++I  Q  Y+
Sbjct: 346 GGLVKEGNSLYSASRYSGNPQIGTPGASQ-GIIYTNSLELSNVDLSQEFVDMITIQNGYS 404

Query: 401 VNSKVFQTGSDFMDILISLKR 421
            NSKV  T  + +  +I+L R
Sbjct: 405 ANSKVITTTDEMLQEVINLIR 425


>gi|221215571|ref|ZP_03588534.1| flagellar hook protein FlgE [Burkholderia multivorans CGD1]
 gi|221164559|gb|EED97042.1| flagellar hook protein FlgE [Burkholderia multivorans CGD1]
          Length = 413

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 195/418 (46%), Gaps = 14/418 (3%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   SN +  + +NIAN +TVG+K +   FS +      ++ N+ +  G  +++
Sbjct: 4   QQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYANSIATSVNTQIGIGTALAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF +     +   TR G F  +  G++ N  G  L
Sbjct: 64  VQQQFGQGTINTTNSSLDVAINGNGFFQMSNNGTI-TYTRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  I+   + N+    P KTP  
Sbjct: 123 MGYAADKNG----VINTAQ---TVPLQAPTTNIAPTATTKITGQFNLNSQDTVPTKTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN--SFPYNVAP 241
                 Y + +S   YD+LG S   ++Y+ KT    WE     Q  +T +  +  ++ + 
Sbjct: 176 ATDTTTYNYSTSIQVYDSLGGSQAVNMYFVKTAAGTWEAYAGVQGGTTKDLGTIQFDSSG 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             +   +  P T   A    +    N + S   Q +T+D++ TTQ  G         +G+
Sbjct: 236 AISSTTTGSPATPTAALGQFQFTVPNTDGSATPQTLTLDLTGTTQYGGKDGVNNLAQDGY 295

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G    F++  DG +   Y +G    + ++A+A   + + L    GN Y  T  SG   
Sbjct: 296 ASGTLTTFTIGTDGKLTGNYSNGQTAVLGQIALANFNNPNGLVNIGGNQYAETPASGVPQ 355

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T       LI+L
Sbjct: 356 ISVPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|318604252|emb|CBY25750.1| flagellar hook protein FlgE [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 397

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 125/419 (29%), Positives = 191/419 (45%), Gaps = 29/419 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS-T 64
           S   A +G+ A + +++ +S+NIAN  T G+K     F+S+   S        G+ +S T
Sbjct: 2   SFSIANTGLSAVTEQLNTISNNIANSGTKGFKSGRTEFASMYAQSQPL-----GVGVSGT 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              I + GS+  T +  DLAI G GFF+VK        TRAG F  +  G L N +G  L
Sbjct: 57  SQSIKKDGSIDRTGNAMDLAISGNGFFVVKNSSGDEAYTRAGMFTTDKNGVLVNASGMKL 116

Query: 125 LGYPLKNASAPLIVNSFQGL-ERINVKHAELSAMPTTT-GFISNNLDKNATIITPDKTPK 182
            GYP   A      N   G+   + +    L A  T+  GF++N     A+   P     
Sbjct: 117 QGYPADAAG-----NVQTGIVSDLKISTVGLPAKATSKLGFMAN---LPASAKQPTNATF 168

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEVSIFRQDQSTNNSFPYNVAP 241
             G    Y   S+   YD+LG   +   Y+ K  G   W+V  +  D + N+        
Sbjct: 169 SIGSKDSYNFMSTSTTYDSLGREHLLTQYFVKQAGAGDWKVH-YAVDGAANSG------- 220

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEING 300
               ++ FD  +G L + + K I+      G D   I I  + TTQ    F+P  S+ +G
Sbjct: 221 --AHDLKFD-TSGVLTSGNSKTITGGYTPVGADNYGIDITYTGTTQFHAEFLPAPSKSDG 277

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +  G      +  DG V   + +G ++   +L +A   + + L   +G T+  T  SG  
Sbjct: 278 YTAGTKNGERIENDGSVYATFSNGKQMLQGKLVLANFANPNGLATQNGTTWSVTSRSGAP 337

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            +G PG    G I +GALE +NVD+ +EL  L+ AQRNY  N+K+  T    M+ L  +
Sbjct: 338 LLGSPGTGLLGNIVAGALEASNVDLTAELVGLMTAQRNYQANTKIISTNDSMMNALFQV 396


>gi|89902477|ref|YP_524948.1| hypothetical protein Rfer_3717 [Rhodoferax ferrireducens T118]
 gi|89347214|gb|ABD71417.1| protein of unknown function DUF1078-like [Rhodoferax ferrireducens
           T118]
          Length = 404

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 122/437 (27%), Positives = 203/437 (46%), Gaps = 56/437 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S +T +SG++A S  +  + +NIAN +T G K +   F  LV  S      SG       
Sbjct: 2   SFQTGLSGLNASSRSLDVIGNNIANANTTGMKSSRAEFGDLVASSLGAGGSSGAGIGVAV 61

Query: 66  DMISEQ---GSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
             IS+Q   G++  T ++ D+AI G GFF +   D     TR G F ++  G+++  +G 
Sbjct: 62  GSISQQFSQGNINITGNDLDVAINGGGFFQLALPDGSAAYTRDGSFKLDANGYIKTNSGA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN---------NLDKNAT 173
            +LGYP                +  +VK  E+  +PT+    ++         NLD  A 
Sbjct: 122 NVLGYPTDKTG-----------KTTSVKP-EILQLPTSAPIAASATTAISAELNLDARAP 169

Query: 174 I---ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-----TGDKKWEVSIF 225
           I   +TP  TP+        T+ +S  AYD+ G ++  ++Y++K      G  +W V   
Sbjct: 170 IATSVTP-PTPRS-------TYGTSLTAYDSQGVTMPVNLYFSKVTPTTAGTDQWAV--- 218

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ--ITIDISK 283
             D  T  S    V         FD  +G L +S+  +++       I     +T+D+SK
Sbjct: 219 -YDSPTGASVGSLV---------FD-ASGALQSSTMGSLTLTPAPPSIVPAFPVTVDVSK 267

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQ    F       +G+APG+     + ++G +   Y +G      +L++A   +   L
Sbjct: 268 VTQFGAAFAVSNLTQDGYAPGELTGLKIGENGQITARYSNGQTQIAGQLSLADFRNVQGL 327

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               GN+++ +  SGD  +G PG  + G + SGALE +NVD+ +EL  ++ AQR Y  N+
Sbjct: 328 SPIGGNSWVASYTSGDPVLGSPGVGKFGALRSGALEESNVDLTAELVNMMTAQRAYQANA 387

Query: 404 KVFQTGSDFMDILISLK 420
           +  +T    M  L++L+
Sbjct: 388 QTIKTQDQVMSTLVNLR 404


>gi|85706142|ref|ZP_01037237.1| flagellar hook protein FlgE, putative [Roseovarius sp. 217]
 gi|85669306|gb|EAQ24172.1| flagellar hook protein FlgE, putative [Roseovarius sp. 217]
          Length = 448

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 120/437 (27%), Positives = 197/437 (45%), Gaps = 46/437 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+  +++G++A + R++ +SDNIAN  T GY+R    F SLV      SY +GG+
Sbjct: 16  MTISSSLNASVAGLNANATRLATISDNIANSSTFGYRRVEADFESLVISGRGGSYSAGGV 75

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGF--------FIVKGRDNVNCLTRAGDFHINN 112
             ST+ +I + GS++ +++ TDLA++ +GF          V   D    LT  G F  + 
Sbjct: 76  RASTQRLIDQGGSIVSSSNPTDLAVRDRGFLPVARVTDLTVSNGDPQMLLTTTGSFRTDP 135

Query: 113 EGFLENVAGGVLLGYPL-KNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VLLG+P   + + P    ++  GLE + +   +L+  PTT+  +  NL  
Sbjct: 136 QGRLVTESGLVLLGWPANPDGTIPEFSRDTSGGLEPVQINVNQLTGEPTTSIKLGINLPA 195

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-----DKKWEVSIF 225
             T       P+      EY        +D LG+S    + +  T        +W V + 
Sbjct: 196 TDTRFDSIGDPQQ--LSIEY--------FDNLGTSENISLQFVPTVATVGLSNEWTVILT 245

Query: 226 RQDQSTNNSFPYNVAPLNTVEV-------------SFDPVTG-YLANSSHKAISFNDNTS 271
              Q       Y +   +  E              +FDP TG  + + +   I  N    
Sbjct: 246 DSAQGNALIGEYVLTFDDARETGGTLLDVQTVTGGAFDPTTGTIIVDVAGGPIEINIGRP 305

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           G    +       +QL+  F P     +G   G      V  +G+V   +D G    IY+
Sbjct: 306 GTSDGL-------SQLSDSFAPLSIAKDGSPVGNMTSAEVDANGFVRASFDTGVSRIIYQ 358

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +  +P+ + +   D  TY P+ DSG   +   G    G+I + A + +  D+A ELT+
Sbjct: 359 VPLVDLPNPNGMVSMDQQTYQPSPDSGSFFLWDAGDGPTGDIVAFARQESATDVARELTD 418

Query: 392 LIEAQRNYAVNSKVFQT 408
           +I+ QR Y+ N+KV QT
Sbjct: 419 MIQTQRAYSSNAKVIQT 435


>gi|300114799|ref|YP_003761374.1| fagellar hook-basal body protein [Nitrosococcus watsonii C-113]
 gi|299540736|gb|ADJ29053.1| fagellar hook-basal body protein [Nitrosococcus watsonii C-113]
          Length = 425

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 120/430 (27%), Positives = 204/430 (47%), Gaps = 21/430 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           +  T++SG++A S+ +   + NIAN  T G+KR+   F+ +   S+   S + V  G+ +
Sbjct: 2   AFNTSLSGLNAASSDLDVTAHNIANASTTGFKRSRSEFADIFAVSSFGRSQTAVGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
           +      EQG+L  T ++ DLAI G+G F +    N   L  +RAG F ++ EG++ N +
Sbjct: 62  NKTAQQFEQGNLDFTQNSLDLAISGQGLFALSPSLNDKDLVYSRAGAFSVDKEGYVVNSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P  N +      S    + + +  +  +   T+   I  NL  +   + P   
Sbjct: 122 GQYLRTFP-TNENGTATAASLNNSQPLRLPTSAGTPQATSRISIGANLPSDTAALDPVNL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TGDKKWEVSIFRQDQSTNNSFPYN 238
              +   + YT  +S   YD+LG+S +  +Y+ K   G  +W V  +     T  +    
Sbjct: 181 DLLD--TSTYTASTSETVYDSLGNSHISTLYFLKDTNGTNQWAV--YHSLDGTLANINGG 236

Query: 239 VAPLNTVE---VSFDPVTGYLANS-----SHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
            A    V+   ++FD  TG L  S     +  +I+ N+  + I   +    + TTQ+A  
Sbjct: 237 TAGAGGVQYGTLNFD-ATGALTGSTPDPLATDSIALNNGANDIALTLDFAANNTTQVASP 295

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F       +G   G+     +SK G +   Y +G    + ++A+A  P+E  L+    N 
Sbjct: 296 FNVAALNQDGFTSGRLTGLDISKTGVIQANYSNGQNSTLGKVALAQFPNEQGLRQLGNNA 355

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           +  T  SG    G  G    G I +GALE++NVD+ +EL  LI AQRN+  N+K  +T S
Sbjct: 356 WGETVSSGSALAGEAGVGSFGTIQTGALESSNVDLTAELVHLITAQRNFQANAKAIETAS 415

Query: 411 DFMDILISLK 420
              D +I+++
Sbjct: 416 TITDTIINIR 425


>gi|308273521|emb|CBX30123.1| hypothetical protein N47_D29320 [uncultured Desulfobacterium sp.]
          Length = 469

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 133/474 (28%), Positives = 211/474 (44%), Gaps = 68/474 (14%)

Query: 11  MSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSGGLEISTKD 66
           MSG++A  N ++ + DNIANV+TVG+K + + F    S  V  +  ++ V  G  ++   
Sbjct: 1   MSGLNALGNAMTVIGDNIANVNTVGFKESRVTFQDVLSQTVATTAGSAQVGRGTSLADIS 60

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               QGS   T S+TDLAI G GFF+V+  G  N +  TRAG+F  + +G   N +  ++
Sbjct: 61  SSFSQGSFESTDSSTDLAIGGAGFFMVRDPGTSNNDYYTRAGEFRFDKDGNFVNPSDYIV 120

Query: 125 LGYPLKNASAPLIVNSFQG-LERINVKHAELSAMPTTTGFISNNLDKNAT----IITPDK 179
            G+ L  A+        QG +  I +     S   T++  +  NLD ++T          
Sbjct: 121 QGWKLDEATGQD-----QGTITDITLSSFTSSPSETSSLSMIMNLDSSSTNNSIGANTAL 175

Query: 180 TPKHNGRDA--------EYTHKSSFAAYDTLGSSVVYDVYYTK---TGDKKWEVSI---- 224
           +   NG DA        +Y+++++   YD+LGS+    +Y+ K     D  WE  +    
Sbjct: 176 SALWNGSDASGEYIADTDYSYQTTLKVYDSLGSTHDVSIYFDKGETAADPVWEYIVTVNP 235

Query: 225 ----------FRQDQSTNNSFPYN------VAPLNTVEVSF-DPVTGY--LANSSHKA-- 263
                      +Q      +  +N         +N++  S  D   G+  LAN+   A  
Sbjct: 236 SEDLRTITDATQQGLLARGTIEFNGTSGDISGGVNSITCSLSDGAGGWTALANTDATANG 295

Query: 264 ----------------ISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPK 307
                           +  +  T     +   D   TTQ A          +G+  G  +
Sbjct: 296 GYFTFAPEFIAGSPMNVKLDFGTRFNGSEWANDALSTTQYASASTTVFQSADGYGAGDLQ 355

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
             SV+ DG +   Y +G  +P+YR+A+A   +E  L    GN +  TR SG+   G PG 
Sbjct: 356 AISVATDGVITGQYSNGQVLPLYRVALAKFQNEQGLYKVGGNLFSQTRLSGEPITGKPGG 415

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           N  G +   +LE +NVD+A+E   +I  QR Y  NSK+  T    +  LI+LKR
Sbjct: 416 NGLGSLSPNSLEQSNVDLATEFVRMITTQRGYQANSKIITTIDQMLSELINLKR 469


>gi|167835111|ref|ZP_02461994.1| flagellar hook protein FlgE [Burkholderia thailandensis MSMB43]
          Length = 413

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 116/428 (27%), Positives = 195/428 (45%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVLTYSRDGTFQRDKNGYIVNSQGLSL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  IS   + N+    P KTP  
Sbjct: 123 MGYQADKNG----VINTAQ---TVPLQAPTNNMAPTATTRISGQFNLNSQDTVPTKTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                 Y  +++   YD+LG S   ++Y+ K+    WE     ++Q+          P +
Sbjct: 176 YADSTTYNFQTAVQVYDSLGGSQQVNMYFVKSAAGTWEAYAGVKNQT----------PTD 225

Query: 244 TVEVSFDPV----TGYLANSSHKAISF--------NDNTSGIDQQITIDISKTTQLAGGF 291
              V+FD      +  LA S+    +         N + S   Q +T+D++ TTQ  G  
Sbjct: 226 LGTVTFDTSGAIKSTTLAGSTTPTTTLGQFQFSIPNTDGSATPQALTLDLTGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    F++  DG +   Y +G    + ++ +A   + + L     N Y
Sbjct: 286 GVTNLAPDGFASGTLTTFTIGNDGKLTGNYSNGQTATLGQIVLANFNNPNGLVNIGNNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T   
Sbjct: 346 VETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQA 405

Query: 412 FMDILISL 419
               LI+L
Sbjct: 406 VDQTLINL 413


>gi|144900942|emb|CAM77806.1| flagellar hook protein FlgE precursor [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 430

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 199/447 (44%), Gaps = 43/447 (9%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-TSNSYVSGG 59
           M ++G+M +A++ + AQS  +S +SDN++N  T GYK    +F +LV  S +S SY SGG
Sbjct: 1   MSLMGAMNSAVTALKAQSTALSIISDNLSNSSTTGYKANTTSFKTLVTQSYSSTSYASGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNCLTRAGDFHINNEGFLE 117
           +  S +  ++ QG +  T+++TDLA+ G GFF+V           TR G+F I++ GF+ 
Sbjct: 61  VTASVRQNVAAQGVISGTSNSTDLALDGDGFFVVSYGATGEETFFTRDGEFEIDSAGFM- 119

Query: 118 NVAGGVLLGYPLKNASAPLIV---NSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
              G   L     ++S  +I    NS   L  +NV     +A  T+   I  NL  +A  
Sbjct: 120 -CLGNYYLQGWETDSSGNVIAGSTNSSSTLSAVNVNRFTGTAEATSAETIQANLPADAA- 177

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS----IFRQDQS 230
            T D               ++   +D LG S    + Y KT   +WE+S    +   D +
Sbjct: 178 -TGDVVT------------ATMEVFDALGVSHTVTMSYEKTAANEWELSLSDPVLSSDTA 224

Query: 231 TNNS----FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
           T++      P+ +   +    S     G           F+   S I   I ID+ + T 
Sbjct: 225 TDSGDITGGPFTLTFADGALTSITDAGGVATELEFSITGFSTGASDI-ATIAIDVGQGTS 283

Query: 287 LAGGFIPQKSEIN------------GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
             G      S  +            G   G      V K G +   +D+G  + IY+LA+
Sbjct: 284 GTGSLTQFSSNSDDPDISITSITGDGVEYGALSSVEVDKKGVIWAHFDNGQDIAIYKLAV 343

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A   + + L+      Y  T  SGD ++   G +    I   ALE++ VD + E T +I 
Sbjct: 344 ADFTNANGLENQGYGVYQQTSASGDFTLHEAGEDGVATITPSALESSTVDTSDEFTRMIV 403

Query: 395 AQRNYAVNSKVFQTGSDFMDILISLKR 421
           AQ+ Y+  S+V  T SD  D L++  R
Sbjct: 404 AQQAYSAASQVISTASDMFDDLMAAVR 430


>gi|183220587|ref|YP_001838583.1| flagellar hook protein FlgE [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910695|ref|YP_001962250.1| flagellar hook protein FlgE [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775371|gb|ABZ93672.1| Endoflagellar hook protein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779009|gb|ABZ97307.1| Flagellar hook protein FlgE [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 464

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 126/473 (26%), Positives = 213/473 (45%), Gaps = 63/473 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF-----PSTSNSYVS 57
           ++ S+ + +SG+     R+  + +NI+NV+T G+K   + F  ++       S  N  + 
Sbjct: 1   MMRSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQELQGASEPNERIG 60

Query: 58  G--------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
           G        G  I+  D I  QG+L  T  NTDLA+ G+GFF+VK  D     TRAG F+
Sbjct: 61  GTNPKQVGLGSLIAAIDKIMTQGALQTTGKNTDLAVSGEGFFVVKDGDK-QFYTRAGAFN 119

Query: 110 INNEGFLENVAGGV-LLGYPLK-NASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISN 166
           ++  GF  N A G+ + G+  + + S    +NS   LE I +  +++  A  T      +
Sbjct: 120 VDKNGFYVNPANGLKVQGWNSRLDESGNKYINSAGSLEDIVIPLYSKEPARATQNVDFQS 179

Query: 167 NLDKNATIITPDKTPKHNGR-------DAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK 219
           NL+ +   + PD T +   R            H +S   YD LG++    V + K  +  
Sbjct: 180 NLNASVAAVPPDATEEDIQRYINDPDPRQRRGHVTSINVYDELGNTRQMGVEFYKMRENV 239

Query: 220 WEVSIFRQDQSTNNSFPYN--------VAPLNTVEVSFDP--------------VTGYL- 256
           W++  F+ + ++  S   N        V+    +EVSF P               TG L 
Sbjct: 240 WKMR-FKLEDASQVSVDVNGTGGENTSVSGNTELEVSFTPDGKIISVSDGVDSQTTGKLK 298

Query: 257 --------ANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKD 308
                    N S +  S N   +G+       +   TQ +  F  +  + +G+  G  + 
Sbjct: 299 ADISFRIPGNPSAQKFSLNLGEAGL-------VGGITQFSSDFTTKAVKQDGYPMGYMES 351

Query: 309 FSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHN 368
           FS+   G V  ++ +G R P+ R+A+A   +   L       Y  + +SG+ +IG  G  
Sbjct: 352 FSIDNTGTVTGVFSNGVRQPLARVALANFTNPAGLNKEGDTMYSFSLNSGEANIGEAGSQ 411

Query: 369 QHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
             G+I +G LE +NVD++ + T++I  QR +  NS+   T    +  ++ LKR
Sbjct: 412 GRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTIVTSDQMIQEVLGLKR 464


>gi|206889889|ref|YP_002248123.1| flagellar hook protein FlgE [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741827|gb|ACI20884.1| flagellar hook protein FlgE [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 434

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 125/453 (27%), Positives = 207/453 (45%), Gaps = 53/453 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGG 59
           +L S+ T +SG++A    +S + DNIAN +TVG+K +   F+ ++       S   V  G
Sbjct: 1   MLTSLFTGISGLNANGLALSVIGDNIANANTVGFKASRANFADILSQTLGGASAMQVGRG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
             I     +  QG+L  T++  DLAI+G GFF+V+  +     TRAG F +N +G++ + 
Sbjct: 61  TMIIDIQKLFTQGTLETTSNPLDLAIEGDGFFVVQQPNGPTYYTRAGQFRVNKDGYIVDP 120

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN--NLDKNATIITP 177
            G +L  Y +        VN        NV  A L + P+ T  I+   NLD      T 
Sbjct: 121 NGYLLQAYQMD-------VNGNVTGAIGNVYLAGLMSDPSATDLITTQVNLDSREDTTTW 173

Query: 178 DKTPKHNGRDA-EYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
             T       A  Y + ++   YD+ G+  +   Y+ KT    WE  +   + +T  ++ 
Sbjct: 174 SFTSGSTLPVAGTYNYSTAITIYDSQGNPHLVYTYFCKTAANTWEAHVVYNNSATGTNY- 232

Query: 237 YNVAPLNTVEVSFD-----PVTGYLANSSHKAIS--------------FNDNTSGID--- 274
                   VEV FD     PVT  +A  S+ A+S              F   T+ +D   
Sbjct: 233 --------VEVDFDSGTTQPVT--IAFDSNGALSDVYVTTPHTPPDPTFRP-TAALDFSS 281

Query: 275 ------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVP 328
                 Q + ID++ +TQ            NG++ G     +V +DG +  ++ +G    
Sbjct: 282 WGVTSPQNVDIDLNNSTQYGSSNAVVFQNQNGYSAGNLIAVTVDQDGVISGVFTNGQVKK 341

Query: 329 IYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASE 388
           + ++ +A   +  NL     N YL +  SG  + G PG    G++++ +LE +NVD+A E
Sbjct: 342 VAQVVLAKFVAAHNLTKVGNNLYLESYASGGPTYGAPGTVGVGKVYANSLEASNVDLAEE 401

Query: 389 LTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
              +I AQR Y  N +V  T  + ++ L+++ R
Sbjct: 402 FIRMIAAQRAYQANVRVITTTDNMLNELMNIVR 434


>gi|307718606|ref|YP_003874138.1| flagellar hook protein [Spirochaeta thermophila DSM 6192]
 gi|306532331|gb|ADN01865.1| flagellar hook protein [Spirochaeta thermophila DSM 6192]
          Length = 462

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 120/470 (25%), Positives = 214/470 (45%), Gaps = 59/470 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  + +NI+NV+T G+K+  + F  ++  + S +        
Sbjct: 1   MMRSLYAGVSGLQNHQIRMDVIGNNISNVNTTGFKKGRVNFHDMISQTLSGAARPTEEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ I++ D I  QGSL  T   TD+AIQG+GFFI++  D  +  TRAG F 
Sbjct: 61  GVNPKQVGLGMTIASIDTIHTQGSLQTTGVMTDVAIQGEGFFILRKGDR-SFYTRAGVFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNN 167
           ++ EG+L N A G+ + G+  +  +    +N+   L+ + +   ++  A  TT  F++ N
Sbjct: 120 LDEEGYLVNPANGLRVQGWRAETVNGQTFINTTGSLQDLIIPVGSKDPASATTEVFLACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK--KWEVSI- 224
           LDK    I P   P+      E T  +++  YD+ G+     + +TK   +  +W  ++ 
Sbjct: 180 LDKRLPEIPPGAGPET---VREGTWVATYDIYDSFGNPHTLRIEFTKVVGEPNRWRATVT 236

Query: 225 --------------FRQDQSTNNSFPYNVAPLNT------------------VEVSFD-P 251
                           +  +  N+F      L T                  V+V FD P
Sbjct: 237 VDPDAETPTNTLVDVGETNNATNTFIIQFDNLGTIQSVEDEAGDVLDAGALQVQVGFDVP 296

Query: 252 VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSV 311
                   +    +FN N      Q+   +   TQ A     +    NG+  G  + F +
Sbjct: 297 EATIPPGEAAVRQTFNLNLG----QVGSVVDAVTQFAERSSTKVFRQNGYTMGYLEGFKI 352

Query: 312 SKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHG 371
            ++G +  +Y +G   P+ ++A+AT  +   L+      +  + +SGD ++G P     G
Sbjct: 353 DQNGVITGVYSNGNNRPLGQIALATFVNPGGLEKEGETMFRVSLNSGDPNVGPPNFAGKG 412

Query: 372 EIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ++ +GALE +NVD+A   T++I  QR +  NS+   T    +  L++LKR
Sbjct: 413 KLIAGALEMSNVDLAEAFTDMIVTQRGFQANSRTITTSDQMLQELLTLKR 462


>gi|301168104|emb|CBW27690.1| putative flagellar hook protein [Bacteriovorax marinus SJ]
          Length = 426

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 122/452 (26%), Positives = 196/452 (43%), Gaps = 57/452 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGIL S    ++G++A    +  + DNIAN  T G+K +   F  ++  +TS   + GG 
Sbjct: 1   MGILRSFNIGVTGLNAVGQGMGVIGDNIANAGTNGFKSSRAEFQDVL--ATSLKGIDGGD 58

Query: 61  EISTKDMISE------QGSLMHTASNTDLAIQGKGFFIVK---GRDNVNCLTRAGDFHIN 111
           +      ++       QG +  T + TDLA+ G GFF V    G+      TR G FH N
Sbjct: 59  QFGAGTKLAHIKTLMTQGDVARTDNITDLAVNGDGFFKVNAPFGK----GFTRDGSFHFN 114

Query: 112 NEGFLENVAGGVLLGYP------LKNASAPLIVNS----FQGLERINVKHAELSAMPTTT 161
            EG L N  G  ++G+       + N  AP+ + S     +  E++N             
Sbjct: 115 KEGELVNSDGYQVIGFEADETGKITNKEAPVKLGSTTIPAKASEKVNFNL---------- 164

Query: 162 GFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWE 221
                NLD  A I    K       DA     +S   YD +G++ +  +YY KTGD +W 
Sbjct: 165 -----NLDSRAEI----KEFNIADPDATSNFSNSVTVYDNVGTARLVTMYYNKTGDNQWT 215

Query: 222 VSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI-DQQITID 280
                               +    + F+   G L      + SFN N     DQ+IT +
Sbjct: 216 YRALVDGADVEGGESGQFVEMAQGNIIFNN-KGQLQEEVEGSNSFNFNKGAAPDQKITFN 274

Query: 281 -----------ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
                      I  +TQ   G    +   +G +       S +  G +  +YD+G    I
Sbjct: 275 FGESISEGGEGIGASTQYGSGSAIARHSQDGFSAATLASMSFNDAGILTAVYDNGESRDI 334

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASEL 389
            ++A+A   + + L     N    +R+SG+ ++G PG +  GE+ S ++E +NVDIA+E 
Sbjct: 335 SQIAVAKFENNEGLFKVGKNLMKESRNSGEAAMGKPGESGRGEVLSKSIELSNVDIANEF 394

Query: 390 TELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
             L+ AQRN+  N+K   T  + +  ++++KR
Sbjct: 395 VGLMTAQRNFQANAKTLTTADEMLQQVLNIKR 426


>gi|126730121|ref|ZP_01745933.1| flagellar hook protein FlgE, putative [Sagittula stellata E-37]
 gi|126709501|gb|EBA08555.1| flagellar hook protein FlgE, putative [Sagittula stellata E-37]
          Length = 435

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 120/453 (26%), Positives = 202/453 (44%), Gaps = 50/453 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A + R++ +SDNIAN  T GYKR    FS++V    S +Y +GG+
Sbjct: 1   MTISSSLNAGVAGLSANATRLATISDNIANSATQGYKRVETEFSAMVTSGNSGTYTAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFF-------IVKGRDNVNC-LTRAGDFHINN 112
              T  +++E G+L+ T + TDLA++G GF        ++ G  N    +T    F ++ 
Sbjct: 61  RTQTNRLVAEHGALVTTNNATDLAVRGTGFLPVAQATEVLAGNGNPQMFMTTTASFRLDA 120

Query: 113 EGFLENVAGGVLLGYPL-KNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           EG+L   +G +LLG+    + S P L  ++   LE I +   +  + PTT   I+  ++ 
Sbjct: 121 EGYLRTESGLMLLGWRANADGSIPNLARDTSASLEPIQIALNQYLSEPTTA--ITMGVNL 178

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIF 225
            AT  T            EY        +D LG S   +V +T T        +W + I 
Sbjct: 179 PATETTAGAAGDALELPIEY--------FDNLGRSESLNVTFTPTVPATGSSNEWTMVI- 229

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFD--PVTGYLANSSHKAISFNDNTSGIDQQITIDIS- 282
             D ++  +       +    V+FD  P  G    S    IS      G+   + ++ + 
Sbjct: 230 -TDSASGGAI------IGDYTVTFDNTPSAGGTLASVSAPISAGGAYDGVAGSVVVNAAG 282

Query: 283 --------------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVP 328
                           TQ +  F P     +G   G      V + G V   +D G    
Sbjct: 283 GPIELSIGQLFTNNGLTQRSDSFAPLNIAKDGSPAGNMTSVEVDESGRVYAYFDTGASAV 342

Query: 329 IYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASE 388
           I+++ +  VP+ + +   +   + P+ +SG   +   G    GEI   A E +  D+A+E
Sbjct: 343 IFQIPLVDVPNPNGMIALNNQLFQPSAESGSFFLWDAGDGPTGEIVPYAREESTTDVAAE 402

Query: 389 LTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           LT++I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 403 LTDMIQTQRAYSSNAKVIQTVDEMLQETTNIKR 435


>gi|226944492|ref|YP_002799565.1| flagellar basal body rod protein [Azotobacter vinelandii DJ]
 gi|226719419|gb|ACO78590.1| Flagellar basal body rod protein [Azotobacter vinelandii DJ]
          Length = 383

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 115/414 (27%), Positives = 197/414 (47%), Gaps = 38/414 (9%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A S+ ++ VS+NIAN  TVG+K +   F+ +     ++S V  G++++      
Sbjct: 6   ALSGLNAASSNLNVVSNNIANSQTVGFKSSTTQFADVY----ASSRVGLGVQVAGVVQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G+L  T  + DLAI G GFF  +    V   +R G   +  EG+L+N  G  LLG   
Sbjct: 62  TSGNLETTDRSLDLAISGSGFFRFEQAGQV-VYSRNGQLTLTPEGYLQNAQGARLLG--- 117

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP--DKTPKHNGRD 187
            N +             I +    L A PTT    + NLD  + +IT   D T ++    
Sbjct: 118 SNGA-------------IQIPADGLQAQPTTEFDATLNLDSGSDVITAAFDATDENT--- 161

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEV 247
             Y++ ++   +D+LG+S    +Y+TKTG  +W V         N +    V+      +
Sbjct: 162 --YSYANTATVFDSLGNSHELTLYFTKTGTNEWAV---------NAALDGAVSASAAQAL 210

Query: 248 SFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPK 307
            F   +G L   +  +  F       D    +D++ +TQ    F     + +G+  G   
Sbjct: 211 EF-TTSGLLDGYTPTSFDFAMTNGAADISFELDLTGSTQFGNDFEVSSLDQDGYTAGSLV 269

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
            F++ ++G V   Y +   + + ++ +AT  S + L+    N ++ T  SG   +G  G+
Sbjct: 270 GFTIEENGNVVGNYSNEQSLVVGQIQLATFRSPEGLQPVGDNAWVETAASGQPLVGTAGN 329

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            Q G + SG +E +NVD+  EL  LI AQRN+  N++   T S+ ++  ++L R
Sbjct: 330 GQFGSLESGVVEASNVDLTKELVNLIIAQRNFQANAQSVSTQSEVLEQAVNLGR 383


>gi|254227983|ref|ZP_04921413.1| Flagellar hook protein FlgE [Vibrio sp. Ex25]
 gi|262396035|ref|YP_003287888.1| flagellar hook protein FlgE [Vibrio sp. Ex25]
 gi|151939479|gb|EDN58307.1| Flagellar hook protein FlgE [Vibrio sp. Ex25]
 gi|262339629|gb|ACY53423.1| flagellar hook protein FlgE [Vibrio sp. Ex25]
          Length = 398

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 188/420 (44%), Gaps = 34/420 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFSAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F  + + F+   +G  L
Sbjct: 57  SQNFDKDGSISGTGRAMDLAINGGGFFVTKDNMGQTLYTRSGVFATDKDNFVTANSGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH- 183
            GY + +++  L+  S   +  I V  + L+A  T       N D +A+ I    TP + 
Sbjct: 117 QGYSV-DSNNNLMTGS---VGNIQVSTSSLNAKATDGLDFVANFDASASAIDKTVTPFNP 172

Query: 184 ---NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N  ++ YT K     YD+LG+S     Y+TKT    WEV++     +T         
Sbjct: 173 DDPNSFNSSYTTK----VYDSLGNSHTVTQYFTKTASNSWEVNVQVDGGAT--------- 219

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
           P+ TV V+FD      + ++   +SF     N   +D    I++  +TQ    F    + 
Sbjct: 220 PVTTVPVTFDKDGSLSSPTAPFNVSFPAAGANAMSVD----INLKGSTQFGAKFGVSTNS 275

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            NG+  G+     V  +G V   Y +G      ++ +A   +   L    G  +  +  S
Sbjct: 276 PNGYTSGELAGVRVEGNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTAWTQSFSS 335

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G    G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 336 GAPITGVPGSGTLGDLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQALF 395


>gi|315186381|gb|EFU20141.1| fagellar hook-basal body protein [Spirochaeta thermophila DSM 6578]
          Length = 462

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 119/470 (25%), Positives = 214/470 (45%), Gaps = 59/470 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  + +NI+NV+T G+K+  + F  ++  + S +        
Sbjct: 1   MMRSLYAGVSGLQNHQIRMDVIGNNISNVNTTGFKKGRVNFHDMISQTLSGAARPTEEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ I++ D I  QGSL  T   TD+A+QG+GFFI++  D  +  TRAG F 
Sbjct: 61  GVNPKQVGLGMTIASIDTIHTQGSLQTTGVMTDVAVQGEGFFILRKGDR-SFYTRAGVFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNN 167
           ++ EG+L N A G+ + G+  +  +    +N+   L+ + +   ++  A  TT  F++ N
Sbjct: 120 LDEEGYLVNPANGLRVQGWRAETVNGQTFINTTGSLQDLIIPVGSKDPASATTEVFLACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK--KWEVSI- 224
           LDK    I P   P+      E T  +++  YD+ G+     + +TK   +  +W  ++ 
Sbjct: 180 LDKRLPEIPPGAGPET---VREGTWVATYDIYDSFGNPHTLRIEFTKVVGEPNRWRATVT 236

Query: 225 --------------FRQDQSTNNSFPYNVAPLNT------------------VEVSFD-P 251
                           +  +  N+F      L T                  V+V FD P
Sbjct: 237 VDPDAETPTNTLVDVGETNNATNTFIIQFDNLGTIQSVEDEAGDVLDAGALQVQVGFDVP 296

Query: 252 VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSV 311
                   +    +FN N      Q+   +   TQ A     +    NG+  G  + F +
Sbjct: 297 EATIPPGEAAVRQTFNLNLG----QVGSVVDAVTQFAERSSTKVFRQNGYTMGYLEGFKI 352

Query: 312 SKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHG 371
            ++G +  +Y +G   P+ ++A+AT  +   L+      +  + +SGD ++G P     G
Sbjct: 353 DQNGVITGVYSNGNNRPLGQIALATFVNPGGLEKEGETMFRVSLNSGDPNVGPPNFAGKG 412

Query: 372 EIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ++ +GALE +NVD+A   T++I  QR +  NS+   T    +  L++LKR
Sbjct: 413 KLIAGALEMSNVDLAEAFTDMIVTQRGFQANSRTITTSDQMLQELLTLKR 462


>gi|307546968|ref|YP_003899447.1| flagellar hook protein FlgE [Halomonas elongata DSM 2581]
 gi|307218992|emb|CBV44262.1| flagellar hook protein FlgE [Halomonas elongata DSM 2581]
          Length = 422

 Score =  139 bits (350), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 123/434 (28%), Positives = 211/434 (48%), Gaps = 40/434 (9%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A S+ +  + +NIAN  TVG+K +   F+ +     +NS V  G ++S      
Sbjct: 6   ALSGLNAASSSLDVLGNNIANSQTVGFKGSDTLFADVY----ANSKVGLGTKVSRVLQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
            +G+L  T  N DL I G+GF   +    V   +R G   +  +G+LEN  G  L+G+ +
Sbjct: 62  GEGNLESTGRNLDLGISGEGFLRFQQNGEV-VYSRNGQLSMTADGYLENAQGARLMGFGV 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--------ITPDKT- 180
            +A     V +      + V   E++A  TT    + NLD    +        +T D + 
Sbjct: 121 NDAGQ---VQTGGQPSVLQVSAEEMAASATTDVATTLNLDSREAVGEQLDQVDVTTDMSD 177

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ---DQSTNNSFPY 237
           P +N +  +Y + ++F AYD+LG+     VYY KTG   W   +      D S + +  +
Sbjct: 178 PANNQQTLDYHYANNFTAYDSLGNPRNATVYYQKTGANSWTGRVTMDGHYDASNDFTLTF 237

Query: 238 N----VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI-----DQQITIDISKTTQLA 288
           N    +A +N  +   DP     AN    +++ +DNT+ +     +   T+DI+ +TQ  
Sbjct: 238 NNSGQLATINGNDAG-DP-----ANMPTVSVA-SDNTTPLGGEPAELSFTLDIAGSTQF- 289

Query: 289 GGFIPQKSEI--NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            G   + S++  +G+  G     S+  DG +   Y +    P  ++++A+  + + L   
Sbjct: 290 -GNTSRASDLIQDGYTSGSLVGISIEDDGTIVRNYTNEQSRPAGQVSLASFRNPEGLDPV 348

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N +  T  SG   +G PG  Q G I SG +E++NVD+A EL ++I  QR Y  NS+  
Sbjct: 349 GDNAWAATAASGQELVGAPGTGQLGGIQSGVVESSNVDMAQELVDMIVTQRAYQANSQTI 408

Query: 407 QTGSDFMDILISLK 420
           +T  + +   I+L+
Sbjct: 409 KTQDEVLQTAINLR 422


>gi|42524754|ref|NP_970134.1| hypothetical protein Bd3395 [Bdellovibrio bacteriovorus HD100]
 gi|39576964|emb|CAE78193.1| flgE [Bdellovibrio bacteriovorus HD100]
          Length = 427

 Score =  139 bits (350), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 116/439 (26%), Positives = 199/439 (45%), Gaps = 30/439 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS----TSNSYV 56
           MGIL S+ T +SGM AQ   +  + DNIAN +T+G+K +   F  ++  +       + +
Sbjct: 1   MGILSSLYTGVSGMTAQGEALGVIGDNIANANTIGFKASRAEFQDIISKNLKGIVGGNQI 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
             G++I   + I  QG++  T   TDLAI G G+F VKG D     TR G FH + EG+L
Sbjct: 61  GRGVKIGAVNPILSQGNIDATEKVTDLAISGDGYFKVKGSDG-ESYTRDGSFHFDREGYL 119

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
                  + G+         IVN    +  I    A + A  T    +  NLD   + + 
Sbjct: 120 VTNDNQRVQGFSTDEKGN--IVNK---MTDIKFPRALIPAKATKELKLDLNLD---SRME 171

Query: 177 PDKTPKHNGRDAEYT--HKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
           P  T K +  D   T  + +    YD+ G+  +   ++ K  D++WE       +     
Sbjct: 172 P--TKKFDPADPYSTSHYSTGVEMYDSQGNKHLVSFFFNKVNDREWEFKGLVDGKEITGG 229

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI-DQQITIDISKTTQLAGGFIP 293
               ++ +   ++ F  V G L +    + +FN     + DQQ+ ++     +  G  + 
Sbjct: 230 EEGKMSEVAAGKLMF-TVDGKLDSQETTSTNFNFKGGALQDQQVKLNFGDAIKDGGKGLD 288

Query: 294 QKSEI-----------NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
              +            +G A G     S + +G +  +Y +G    + ++A+A   + + 
Sbjct: 289 GTKQYGKNSDLISWHQDGAAAGTITGLSFNDEGTLTAVYSNGQANDLAQIALAKFENPEA 348

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L     N    +RDSG  S+G PG    G++F+ +LE + VD+A+E   +I+ QR +  N
Sbjct: 349 LFKVGNNRLKESRDSGTASVGAPGAAGRGKLFAKSLERSTVDLATEFVNMIQNQRGFQAN 408

Query: 403 SKVFQTGSDFMDILISLKR 421
           +K   T  + ++ +I LKR
Sbjct: 409 AKTITTTDELLNEVIQLKR 427


>gi|119385423|ref|YP_916479.1| hypothetical protein Pden_2696 [Paracoccus denitrificans PD1222]
 gi|119375190|gb|ABL70783.1| protein of unknown function DUF1078 domain protein [Paracoccus
           denitrificans PD1222]
          Length = 446

 Score =  139 bits (350), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 123/458 (26%), Positives = 207/458 (45%), Gaps = 49/458 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS--YVSG 58
           M I  ++   +SG+ A S R++ +SDNIAN  T GYKR   +F S+V         Y + 
Sbjct: 1   MSISSALSAGVSGLAANSTRLATISDNIANSGTYGYKRVDTSFESMVINQGRGGGLYTAN 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN---------CLTRAGDFH 109
           G+  +T  ++ E+G+L+ T+   D+AI G+G   V    +++          +TR G F 
Sbjct: 61  GVRAATSRIVDERGNLVPTSHPLDIAISGRGMLPVIYSASLDSGTATSSDLVMTRTGSFR 120

Query: 110 INNEGFLENVAGGVLLGYPLKN----ASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS 165
            +++G+L   +G VL+G+P  +     S P   +S  GL+ I +  ++ +A PTT   + 
Sbjct: 121 TDDQGYLRTDSGLVLMGWPANSDGTIPSQPR--DSTTGLQPIMISPSQTAADPTTRINLR 178

Query: 166 NNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TG-----DK 218
            NL     +     T +    + EY        +  LG+S    V +    TG       
Sbjct: 179 VNLPAGEAVGGATGTERE--MEVEY--------FGNLGNSERMTVTFRPDITGAAGAQTN 228

Query: 219 KWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVT---GYLAN------SSHKAISFNDN 269
           +W + I       + + P + + +    + FD      G LAN       ++ A +    
Sbjct: 229 RWTMEIRDSAIINDPATPADESLIGIYTLEFDNSQAGGGTLANVTTAAGGAYSAATGLLT 288

Query: 270 TSGIDQQITIDISK------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDD 323
             G +  +TI++ +       TQL+  F P     NG   G      + ++GY+   YD 
Sbjct: 289 VPGANGPMTINLGRYGDNQGITQLSASFSPTNVSKNGSPVGNLTALEIDENGYLQATYDT 348

Query: 324 GTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANV 383
           G    +Y++ +  VP+ + L   D  TY  +  SG   +   G    G +   A E +  
Sbjct: 349 GFTRTLYQVPLVDVPNPNGLIAMDNQTYKISPRSGAFYLWNAGDGPTGAVAGYAREASTT 408

Query: 384 DIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           D+A+ELT+LI+ QR Y  N+KV QT  + +    +LKR
Sbjct: 409 DVAAELTDLIQTQRAYTSNAKVIQTVDEMLQETANLKR 446


>gi|158320521|ref|YP_001513028.1| hypothetical protein Clos_1488 [Alkaliphilus oremlandii OhILAs]
 gi|158140720|gb|ABW19032.1| protein of unknown function DUF1078 domain protein [Alkaliphilus
           oremlandii OhILAs]
          Length = 448

 Score =  139 bits (350), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 125/470 (26%), Positives = 214/470 (45%), Gaps = 73/470 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM +A+S + A   ++  + +NIANV+TVG+K T + F  +   +            
Sbjct: 1   MMRSMYSAVSSLKAHQLKMDVIGNNIANVNTVGFKGTRVTFQEVFSQTLRGAGRAQEGGR 60

Query: 51  --TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL----TR 104
             T+   V  G+ +++ D    +GS+  T  NTDL I G+GFF+V   D    L    TR
Sbjct: 61  GGTNPQQVGLGINVNSMDTFHTRGSVESTGYNTDLMINGEGFFVVS--DTQGGLQKSYTR 118

Query: 105 AGDFHINNEGFLENVAGGVLLGY-PLKNASA---------PLIVNSFQGLE--RINVKHA 152
           AG F ++  G L    G  +LGY  +++A           P+   +  GL   R      
Sbjct: 119 AGAFGLDANGNLITPDGYYVLGYTAVRDADGQVQKNEKGQPIFEENLTGLRISRDETAPP 178

Query: 153 ELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY 212
             +   T TG I +NL  ++T    D             H++    +D+LG++    V +
Sbjct: 179 AATTKATFTGNIDSNLSADSTGTAGDGG----------IHETVMKVHDSLGNAHTVKVQF 228

Query: 213 TKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVE----VSFDPVT-------GYLANSS- 260
            +T           Q   T  +F   +  L+ V+    +  +P T       G L  ++ 
Sbjct: 229 QRT----------DQGNDTKRTFAVTITELDNVKLGAPIPLEPATPLTFDSAGILDKTAL 278

Query: 261 -HKAISFNDNTSGID--QQITI--DISKTTQLAGGFIPQKS----EINGHAPGKPKDFSV 311
               +     T G+D  +Q++I  D +K T  A     +      EING+A GK  DF++
Sbjct: 279 TKGTLKLGHATDGLDGAKQLSIELDFTKLTSYAADKGAKSDAAALEINGYASGKIDDFTI 338

Query: 312 SKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHG 371
           S  G ++  + +G+R  + R+ +A   +   L    GN Y  T +SG++  G+ G    G
Sbjct: 339 STTGEIEANFTNGSRQILGRVGLANFKNPAGLLKTGGNMYRETSNSGEVMFGYAGTGGFG 398

Query: 372 EIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            +  GA+E +NVDI+ E T++I  QR +  NS++  T  + +  ++++KR
Sbjct: 399 ALNPGAIEMSNVDISREFTDMITTQRGFQANSRIITTSDEMLQEIVNMKR 448


>gi|261856360|ref|YP_003263643.1| flagellar hook-basal body protein [Halothiobacillus neapolitanus
           c2]
 gi|261836829|gb|ACX96596.1| flagellar hook-basal body protein [Halothiobacillus neapolitanus
           c2]
          Length = 418

 Score =  139 bits (350), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 124/435 (28%), Positives = 197/435 (45%), Gaps = 38/435 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGGLEIST 64
           S  T+++G++A    +   S+NIAN ++ G+K +   F  +   S   NS  + G  + T
Sbjct: 2   SFNTSITGLNAAQKDLDVTSNNIANANSTGFKSSRAQFGDIYAVSAYGNSKTATGQGVLT 61

Query: 65  KDMISE--QGSLMHTASNTDLAIQGKGFFIVKGR-DNVNCL-TRAGDFHINNEGFLENVA 120
           + +  +  QGSL  T ++ DLAI G+GFF  +   D++  + +RAG    N +GF+ N  
Sbjct: 62  EAVQQQFTQGSLQFTNNSLDLAISGQGFFTFQPTLDSLQSVYSRAGALGANKDGFIVNTN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--ITPD 178
           G  L   P+  A+  L   S    + I +  A  +   TT    S NL  +AT+  +TP 
Sbjct: 122 GQYLKALPVS-ANGTLQSTSLASAKPIQLPVAAGAPKATTLVTQSFNLPASATVPTVTPF 180

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQST------ 231
            T +     A YT  +S   YD+LG++     YY KT +  +W V  ++ D  T      
Sbjct: 181 DTTQATPDPASYTQANSQQVYDSLGNTHTLTSYYVKTANPNEWNV-YYQVDTQTPIQGPS 239

Query: 232 ------NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
                 N   P   AP      +    TG         ++ N  T G           +T
Sbjct: 240 TLTFDANGQLPTTPAPFAVTATAASLGTG------AAPLNINVQTQG----------DST 283

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q    F       +G+  G+    SV  +G +   Y +G  +P+  +A+A   +   LK 
Sbjct: 284 QYNAPFNMAAQSQDGNTTGQLTGVSVGSNGLIQASYSNGQNIPLGMVALANFSNPQGLKQ 343

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N++  + DSG  + G PG    G I  GALE +NVD+  +L  LI AQRN+  N++ 
Sbjct: 344 VGNNSWAESVDSGAPTAGQPGTGTFGLIQGGALEQSNVDLTQQLVNLITAQRNFQANAQA 403

Query: 406 FQTGSDFMDILISLK 420
            QT     D +I+++
Sbjct: 404 IQTDKTATDSVINIR 418


>gi|317047691|ref|YP_004115339.1| flagellar hook-basal body protein [Pantoea sp. At-9b]
 gi|316949308|gb|ADU68783.1| flagellar hook-basal body protein [Pantoea sp. At-9b]
          Length = 406

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 114/425 (26%), Positives = 199/425 (46%), Gaps = 30/425 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+ A S+ +  + +NIAN  T G+K + IAF+ L     + S V  G +++  
Sbjct: 2   SFSQAVSGLSAASSNLDVIGNNIANSATAGFKSSTIAFADLF----AGSDVGLGTKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T+   D+A+ G GFF +         +R G F ++    L N  G  + 
Sbjct: 58  IQNFNDGTTTTTSRGLDVALSGNGFFRMTDSSGAVYYSRNGQFTLDENRNLVNTQGLYVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   + +P  + +      +++   ++SA  TTT     NL+  + I  P  T   + 
Sbjct: 118 GYPA--SGSPATIQTGANPVALSIPTTQMSAKATTTATQVANLNSTSDI--PSVTTFDSS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  KS+   YD+ G+    D+YY KTGD  W V     D +T        A     
Sbjct: 174 NVDSYNAKSTMTVYDSQGNDHTLDMYYVKTGDNAWTVHAV--DSTTG-------ASAGDF 224

Query: 246 EVSFDPV-----TGYLANSSHKAISFN-DNTSGIDQQITIDISKTTQLAGGFI----PQK 295
           +++FD        G +  ++  A+S +  N +   Q IT+++  + Q   G      P +
Sbjct: 225 DLTFDSSGNLTSVGGVTGATTVALSIDGTNGAAAGQSITLNMQGSLQQNTGTTTFGNPTQ 284

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              +G+APG    ++++ DG +   Y +     + ++ +A+  + + L+    N +  T 
Sbjct: 285 ---DGYAPGDLTTYTINDDGTITGTYSNQQTQLLGQIVLASFSNPEGLQSEGDNVWSATS 341

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG  +IG  G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ 
Sbjct: 342 SSGQAAIGTAGTGTFGSLTAGALEASNVDLSQELVNMIVAQRNYQANAQTIKTQDQILNT 401

Query: 416 LISLK 420
           L++L+
Sbjct: 402 LVNLR 406


>gi|284801027|ref|YP_003412892.1| flagellar hook protein FlgE [Listeria monocytogenes 08-5578]
 gi|284994169|ref|YP_003415937.1| flagellar hook protein FlgE [Listeria monocytogenes 08-5923]
 gi|284056589|gb|ADB67530.1| flagellar hook protein FlgE [Listeria monocytogenes 08-5578]
 gi|284059636|gb|ADB70575.1| flagellar hook protein FlgE [Listeria monocytogenes 08-5923]
          Length = 411

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 197/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              +++++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMSLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|313624712|gb|EFR94667.1| flagellar hook protein FlgE [Listeria innocua FSL J1-023]
          Length = 411

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 129/448 (28%), Positives = 196/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V+I     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNIKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|330445348|ref|ZP_08309000.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489539|dbj|GAA03497.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 467

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 134/480 (27%), Positives = 203/480 (42%), Gaps = 79/480 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSGGLE 61
           SM  A+SG+ A    ++  S+NIAN +T G+K +   F    SS +F S + +   GG++
Sbjct: 2   SMNIALSGLGAAQKDLNTTSNNIANANTFGFKESRAEFGDVYSSSIF-SNAKTTTGGGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV---NCLTRAGDFHINNEGFLEN 118
            ST      +GS ++T +  DL + G GFF V    N    N LTR G FH+NNE  L N
Sbjct: 61  TSTVAQQFHEGSSIYTNNPLDLRVSGSGFFAVADNKNEPANNNLTRNGAFHLNNENELVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  LLGYP+   S     N+    E  ++K  ++   PT     SNN+  +  +   +
Sbjct: 121 SEGKFLLGYPVNKES-----NTVASYEAKSMKIDDIFGQPTK----SNNIKVSLNLPNKE 171

Query: 179 KTPKHNGRD----AEYTHKSSFAAYDTLGSSVVYDVYY--------TKTGDKKWEVSIFR 226
             PK+   D      ++  +S   YD+LG       YY        T T    WEV    
Sbjct: 172 TAPKNGTFDFNDPDSFSRSTSSTIYDSLGKPYKMTTYYVAKYDPNATPTNANTWEV---- 227

Query: 227 QDQSTNNSF--------PYNVAPLNTVEVSFDP----VTGYLANSSHKAISFNDN----- 269
               TNNS         P +V P   V  + DP    VTGY          +  +     
Sbjct: 228 HQTITNNSGEERLLKPDPASVPPAYRVIDNTDPTAPVVTGYRMRFDQNGQPYPGDAGDPT 287

Query: 270 ---------------------TSGID-------QQITIDISKTTQLAGGFIPQKSE-ING 300
                                ++GID       Q + ++    TQ A  F  +K E ++G
Sbjct: 288 ATPPVPATPPTPLNIQMETFASAGIDVGGADPTQTLNMNYDDPTQYASAFEVRKFEDVDG 347

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G      +  +G +   Y +G  V + R+A+A V +E  L    G  +  T++SG  
Sbjct: 348 ATTGYLSKVDIDPEGNILASYSNGKDVVVGRVALARVSNEQGLAQLGGTLWNTTQESGQA 407

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G       G I SG LE +N+D+  EL +LI AQRN+  +S+     +     ++ ++
Sbjct: 408 IWGDASQGSFGAIKSGTLEQSNIDMTQELVDLITAQRNFQASSRALDVNNQLQQNILQIR 467


>gi|20807880|ref|NP_623051.1| flagellar basal body and hook proteins [Thermoanaerobacter
           tengcongensis MB4]
 gi|254478868|ref|ZP_05092232.1| Flagellar basal body protein FlgE [Carboxydibrachium pacificum DSM
           12653]
 gi|20516445|gb|AAM24655.1| Flagellar basal body and hook proteins [Thermoanaerobacter
           tengcongensis MB4]
 gi|214035181|gb|EEB75891.1| Flagellar basal body protein FlgE [Carboxydibrachium pacificum DSM
           12653]
          Length = 415

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 126/441 (28%), Positives = 211/441 (47%), Gaps = 48/441 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAISGLQAHQARLDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV   +++   TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVSNGESI-LYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKHAELSAMPTTTGF-ISNN 167
            ++ G L    G  +LG+   +      VN+  G L  I++K+       TTT   I  N
Sbjct: 120 FDSNGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISLKNWFGMEPSTTTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+ +  I          G+   Y    +   YDT G S V  + +T+     W  S+  Q
Sbjct: 177 LNASTGI----------GQSISY----NIIVYDTQGGSHVATITFTRQDPNTWNWSVSSQ 222

Query: 228 DQSTNNSFPY--NVAPLNTVEVSFDPVTGYLANSSHKA--ISFNDNTSGIDQQI---TID 280
           D       PY  +V+   +  ++F    G +A ++     ++FN NT+  + QI    ID
Sbjct: 223 D-------PYISSVSVAGSTAITFG-ADGKIAPNTQATGTLTFNMNTAVTNAQIGPVNID 274

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
           +SK T  +     ++   NG+  G  +  ++ K G V  IY +G R  I ++A+A   + 
Sbjct: 275 LSKLTMFSTETDLRELSKNGNEAGSLQSINIDKYGVVSGIYSNGRRQVIGQIALADFQNP 334

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
             L+      ++ T +SG+  IG  G    G I  G LE +NV++A+E  ++I  QR + 
Sbjct: 335 MGLEKVGNTMFINTVNSGEPMIGAAGSGTRGSINPGTLEMSNVNLANEFVDMITTQRGFQ 394

Query: 401 VNSKVFQTGSDFMDILISLKR 421
            N+KV     + +  L+++KR
Sbjct: 395 ANAKVITVSDEMLQDLVNMKR 415


>gi|258625234|ref|ZP_05720146.1| Flagellar hook protein flgE [Vibrio mimicus VM603]
 gi|258582481|gb|EEW07318.1| Flagellar hook protein flgE [Vibrio mimicus VM603]
          Length = 398

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 117/415 (28%), Positives = 184/415 (44%), Gaps = 24/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S+NIAN  T G+K +   F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNKELNTISNNIANASTFGFKGSRTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    D+AI G GFF+ K        TR+G F+ +   F+    G  L
Sbjct: 57  SQNFDKNGSITGTGRAMDMAINGSGFFVTKDSMGQLLYTRSGVFNTDKNNFITGNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L+  S   +  I V  + L A  T       N D +A ++   + P   
Sbjct: 117 QGYSV-DTNGELLSGS---VGDIKVSTSSLEAKATNKIDFVANFDASAKVVDQTQYPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG++     Y+TKT D  W+VS+ + D S          P++T
Sbjct: 173 NNSNSFNSSYTTKVYDSLGNAHNVTQYFTKTADNTWKVSV-QVDGSKK--------PVST 223

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS--KTTQLAGGFIPQKSEINGHA 302
           V V F       +      +SF    +   + + IDIS   +TQ    F    +  NG+ 
Sbjct: 224 VPVKFKSDGTLESPKGSYKVSF---PAAGAEPLNIDISLKGSTQFGAAFGVSTNNANGYT 280

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+     V  +G V   YD+G      ++ +A       L   +   +  +  SG   +
Sbjct: 281 SGELTGVRVEDNGMVYATYDNGESQRQGQVVLANFADPQGLSKVNDTAWTQSFSSGAPIM 340

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    GE+  G+LE +NVD+ SEL  L+ AQRNY  N+K   TG      L 
Sbjct: 341 GIPGTGSLGELAPGSLEGSNVDLTSELVSLMTAQRNYQANAKTISTGDKLTQALF 395


>gi|315281358|ref|ZP_07869998.1| flagellar hook protein FlgE [Listeria marthii FSL S4-120]
 gi|313614997|gb|EFR88501.1| flagellar hook protein FlgE [Listeria marthii FSL S4-120]
          Length = 411

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 129/448 (28%), Positives = 196/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDAGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       YLP   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYLPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|258622488|ref|ZP_05717510.1| Flagellar hook protein flgE [Vibrio mimicus VM573]
 gi|262173354|ref|ZP_06041031.1| flagellar hook protein FlgE [Vibrio mimicus MB-451]
 gi|258585188|gb|EEW09915.1| Flagellar hook protein flgE [Vibrio mimicus VM573]
 gi|261890712|gb|EEY36699.1| flagellar hook protein FlgE [Vibrio mimicus MB-451]
          Length = 398

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 117/415 (28%), Positives = 184/415 (44%), Gaps = 24/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S+NIAN  T G+K +   F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNKELNTISNNIANASTFGFKGSRTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    D+AI G GFF+ K        TR+G F+ +   F+    G  L
Sbjct: 57  SQNFDKNGSITGTGRAMDMAINGSGFFVTKDSMGQLLYTRSGVFNTDKNNFITGNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L+  S   +  I V  + L A  T       N D +A ++   + P   
Sbjct: 117 QGYSV-DTNGELLSGS---VGDIKVSTSSLEAKATNKIDFVANFDASAKVVDQTQYPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG++     Y+TKT D  W+VS+ + D S          P++T
Sbjct: 173 NNSNSFNSSYTTKVYDSLGNAHNVTQYFTKTADNTWKVSV-QVDGSKK--------PVST 223

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS--KTTQLAGGFIPQKSEINGHA 302
           V V F       +      +SF    +   + + IDIS   +TQ    F    +  NG+ 
Sbjct: 224 VPVKFKTDGTLESPKGSYKVSF---PAAGAEPLNIDISLKGSTQFGAAFGVSTNNANGYT 280

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+     V  +G V   YD+G      ++ +A       L   +   +  +  SG   +
Sbjct: 281 SGELTGVRVEDNGMVYATYDNGESQRQGQVVLANFADPQGLSKVNDTAWTQSFSSGAPIM 340

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    GE+  G+LE +NVD+ SEL  L+ AQRNY  N+K   TG      L 
Sbjct: 341 GIPGTGSLGELAPGSLEGSNVDLTSELVSLMTAQRNYQANAKTISTGDKLTQALF 395


>gi|170737038|ref|YP_001778298.1| flagellar basal body FlaE domain-containing protein [Burkholderia
           cenocepacia MC0-3]
 gi|169819226|gb|ACA93808.1| flagellar basal body FlaE domain protein [Burkholderia cenocepacia
           MC0-3]
          Length = 389

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 112/412 (27%), Positives = 188/412 (45%), Gaps = 27/412 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A++G++A + +++ +S+NIAN  T+G+K     F+S    S  N+  SG    ST 
Sbjct: 2   SFNIALAGINAINGQLNQISNNIANSGTLGFKSGRANFAS----SYINAMPSGVSIGSTS 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             +   G+   T    D AI GKGFFI +  D     +RAG F+I+  G + +    V+ 
Sbjct: 58  QSMDVTGNFSATGRGLDAAIAGKGFFISRDTDGSMVFSRAGVFNIDKNGNVTDFMSRVVQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY +  A           L  + +    + A  +++     N+  + T   P  +P    
Sbjct: 118 GYGVDGA-----------LGSLTIPTGSIPAQASSSLEYVGNMSADWT--KPTVSPFDKD 164

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y   S+    D+LG       Y+ K    K +V      Q+  N           V
Sbjct: 165 DPKSYNGISAATVMDSLGREHTVTQYFVKDAGNKMQVYYAMDGQNVGNP----------V 214

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           E+SFD     +  ++   +     T      I I  + TT   G     K+ ++G+  G 
Sbjct: 215 ELSFDNTGKLVTPTATVQLDLGTPTDAAPMSIAISYAGTTMFGGKQTTDKNRVDGYKAGT 274

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
               S+++DG +++ Y +G ++   +LAIAT  +E+ L   DG+ +  +  +G+  IG P
Sbjct: 275 VTGVSLAEDGSIEVQYSNGKKLSAGQLAIATFQNENGLVPVDGSGWQASSATGEPLIGKP 334

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G    G++   A+E +NVD+ +EL  L+ AQ+NY  NSKV  T ++ M  L+
Sbjct: 335 GTGMAGKLAVRAVEQSNVDMTAELVSLMGAQQNYQANSKVLSTENEMMRALM 386


>gi|167568107|ref|ZP_02361023.1| flagellar hook protein FlgE [Burkholderia oklahomensis EO147]
 gi|167574225|ref|ZP_02367099.1| flagellar hook protein FlgE [Burkholderia oklahomensis C6786]
          Length = 413

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 115/419 (27%), Positives = 194/419 (46%), Gaps = 16/419 (3%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   F+ +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFADMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVVTYSRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A A  ++NS      + ++    +  PT T  I+   + N+    P  TP + 
Sbjct: 123 MGYA---ADANGVINS---AATVPLQAPTTNIAPTATSKITGQFNLNSQDAVPATTPFNY 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIFRQDQSTNN--SFPYNVAP 241
                Y + +S  A+D+LG S   ++Y+ K+    +WE       Q+  +  S  +N A 
Sbjct: 177 SDPTSYNYTTSVQAFDSLGGSQNVNLYFVKSSTTGQWEAYAGPSGQTPTDLGSVKFNTA- 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGID-QQITIDISKTTQLAGGFIPQKSEING 300
             T+  +  P      N    + S    T   + Q +T+D++ TTQ  G         NG
Sbjct: 236 -GTITSTSTPAGAPTTNVGQFSFSIPTTTGAANPQNLTLDLTGTTQYGGKNGINNLTQNG 294

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            A G    FS+  DG +   Y +G    + ++ +A   + + L     N Y+ T  SG  
Sbjct: 295 FASGVLTTFSIGADGKLTGNYSNGQTSTLGQIVLANFNNPNGLVSVGNNQYVETAASGVP 354

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N++  +T       LI+L
Sbjct: 355 QISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQANAQTIKTQQTVDQTLINL 413


>gi|28900122|ref|NP_799777.1| flagellar hook protein FlgE [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837072|ref|ZP_01989739.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ3810]
 gi|260365772|ref|ZP_05778268.1| flagellar hook protein FlgE [Vibrio parahaemolyticus K5030]
 gi|260880694|ref|ZP_05893049.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AN-5034]
 gi|260897700|ref|ZP_05906196.1| flagellar hook protein FlgE [Vibrio parahaemolyticus Peru-466]
 gi|260899389|ref|ZP_05907784.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ4037]
 gi|28808405|dbj|BAC61610.1| LfgE [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749660|gb|EDM60405.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ3810]
 gi|308086228|gb|EFO35923.1| flagellar hook protein FlgE [Vibrio parahaemolyticus Peru-466]
 gi|308092098|gb|EFO41793.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AN-5034]
 gi|308109176|gb|EFO46716.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ4037]
 gi|308114990|gb|EFO52530.1| flagellar hook protein FlgE [Vibrio parahaemolyticus K5030]
 gi|328470101|gb|EGF41012.1| flagellar hook protein FlgE [Vibrio parahaemolyticus 10329]
          Length = 398

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 117/416 (28%), Positives = 181/416 (43%), Gaps = 26/416 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T  + DLAI G GFF+ K        TR+G F  +   F+    G  L
Sbjct: 57  SQNFDKNGSITGTGRSMDLAINGSGFFVTKDHMGQTLYTRSGVFGTDKSNFVTANNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + +++  L+  S   +  I V  + L+A  T       N D +A  I    TP   
Sbjct: 117 QGYSV-DSNNNLMTGS---VGNIQVSTSSLNAKATDKLDFVANFDASAKAIDKAVTPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+S     Y+TKT D  WEV++      T         P++T
Sbjct: 173 ADPTSFNSSYTTQVYDSLGNSHTVTQYFTKTADNAWEVNVQVDGGKT---------PVST 223

Query: 245 VEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           + V+F+      A +    ++F     N   +D    I++  +TQ    F    +  NG+
Sbjct: 224 IPVTFNKDGTLAAPTGSFNVAFPAAGANAMSVD----INLKGSTQFGAAFGVSTNSPNGY 279

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG   
Sbjct: 280 TSGELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTAWTQSFSSGAPI 339

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           +G PG    G +  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 340 MGVPGSGTLGNLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQALF 395


>gi|42528268|ref|NP_973366.1| flagellar hook protein FlgE [Treponema denticola ATCC 35405]
 gi|4426943|gb|AAD20617.1| flagellar hook protein FlgE [Treponema denticola]
 gi|41819538|gb|AAS13285.1| flagellar hook protein FlgE [Treponema denticola ATCC 35405]
          Length = 463

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 123/474 (25%), Positives = 211/474 (44%), Gaps = 66/474 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY------- 55
           ++ S+ + ++GM     R+  + +N+ANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVTGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGAARPTEELG 60

Query: 56  ------VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+L  T  NTDLAIQG GFFI+K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGMMVASIDTIFTQGALQTTGVNTDLAIQGNGFFILKDGEKT-FYTRAGAFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           I+ EG L N A G+ + G+  + A    I+N+    E +N+   + L A  TT+   + N
Sbjct: 120 IDKEGTLVNPANGMRVQGWMAEEAEGFRIINTSGQTEDLNIPIGQKLDAKATTSVNYACN 179

Query: 168 LDKNATIITPDKTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           LDK      P+     N  +  E T  + F  YD+ G +    + + +      EV+ +R
Sbjct: 180 LDKRL----PELPEGANRAQILESTWSTEFKVYDSFGEAHELQIDFARV---PGEVNAWR 232

Query: 227 QDQSTNNSFPYNV-------------APLNTVEVSFD-----------------PVTGYL 256
              +T N  P N                 N+  V FD                 P    L
Sbjct: 233 ---ATVNVDPTNADATATRVGIGTTDGVQNSFIVRFDNNGHLASVTDTAGNVTSPAGQVL 289

Query: 257 ANSSHKAISFNDNTSGIDQQITIDI---------SKTTQLAGGFIPQKSEINGHAPGKPK 307
              S+  +  N + +G   + T D+         +  TQ +     +  E +G+  G  +
Sbjct: 290 VQISYNVVGANPDEAGAPTRHTFDVNLGEIGTSKNTITQFSDKSTTKAYEQDGYTLGYLE 349

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
           +F + + G +  +Y +G R  I ++A+A   ++  L+    NTY+ + +SG  ++   G 
Sbjct: 350 NFRIDQSGIITGVYSNGVRQEIGQIAMAGFANQGGLEKAGQNTYVQSNNSGIANVSTSGT 409

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
              G    G LE +NVD+  +  ++I  Q+ +   +K  QT    ++ +++LKR
Sbjct: 410 VGKGYFIGGTLEMSNVDLTDQFVDMIVTQKGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|269103190|ref|ZP_06155887.1| flagellar hook protein FlgE [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163088|gb|EEZ41584.1| flagellar hook protein FlgE [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 449

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 128/455 (28%), Positives = 204/455 (44%), Gaps = 47/455 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSGGLE 61
           S+  A+SG+ A    ++  S+NIAN +T G+K +   F    S+ +F S + +   GG++
Sbjct: 2   SVNIALSGLGAAQKDLNTTSNNIANANTYGFKESRAEFGDVYSNSIF-SNAKTSTGGGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIV---KGRDNVNCLTRAGDFHINNEGFLEN 118
            ST      +GS ++T +  DL I G GFF V   K     N LTR G FH+NN+  L N
Sbjct: 61  TSTVAQQFHEGSSLYTNNPLDLRISGAGFFAVADNKAEPANNSLTRNGAFHLNNQNELVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  LLGY + + +     N+    E  ++K  ++   PT +  +  +L+      TP 
Sbjct: 121 SEGKFLLGYEVNSDT-----NTVSSYEPKSMKIDDVFGKPTPSKTMDISLNLPNKETTPK 175

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-------TGDKKWEVSIFRQDQST 231
             P +      Y+  +S   YD+LG     + YY         T    WEV        +
Sbjct: 176 NHPFNFDDKDSYSRSTSSTIYDSLGKPYKMNTYYVAKYNPADPTTANTWEV-YHTVTNPS 234

Query: 232 NNSFPYNV--APLNTVEVSFDPVTGYLANSSH----------KAIS------FNDNTSGI 273
               P +V  A LN   V+   + G  A+  +          +A S       N  T+GI
Sbjct: 235 GKELPLDVDTAKLNPAFVANGAIHGTAAHKGYIMKFDTSGQQQAGSPSVINMVNFKTAGI 294

Query: 274 D-------QQITIDISKTTQLAGGF-IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
           D       Q +T++  + TQ A  F + Q  +++G   G      +  DG V   Y +G 
Sbjct: 295 DVGGADDSQALTMNYKEPTQYASPFEVRQFKDVDGATTGYLSKVDIDPDGNVLASYSNGK 354

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
              + R+A+A V +E  L    G  +  T++SGD   G       G I SG LE +N+D+
Sbjct: 355 DRIVGRVAMARVSNEQGLSQLGGTLWNVTQESGDAVWGDASQGSFGAIKSGTLEQSNIDM 414

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             EL +LI AQRN+  +S+  +  +     ++ ++
Sbjct: 415 TQELVDLITAQRNFQASSRALEVNNQLQQNILQIR 449


>gi|255521910|ref|ZP_05389147.1| flagellar hook protein FlgE [Listeria monocytogenes FSL J1-175]
          Length = 411

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 197/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S+ + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSALSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|330447903|ref|ZP_08311551.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492094|dbj|GAA06048.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 398

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 120/412 (29%), Positives = 190/412 (46%), Gaps = 36/412 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIST- 64
           S   A+SG+DA + +++ +S+NIANV T G+K +   FS++      N   +GG+E++  
Sbjct: 2   SFDIALSGLDATNVQLNTISNNIANVSTSGFKESRTEFSAVY-----NGMQAGGVEVAAI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F  + +  + +  G  L
Sbjct: 57  SQNFDKTGSITGTGRPLDLAISGSGFFVTKDHTGQTLYTRSGVFGSDKDNNIVSNNGAKL 116

Query: 125 LGYPL---KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
            GY +    N  A  + N       + +  A L A  T       NLD  +++I P   P
Sbjct: 117 QGYTVDANNNLQAGAVGN-------LKITTASLPAKATDELAFVANLDARSSVIDPAINP 169

Query: 182 ----KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
                 +  ++ YT K     YD+LG+      Y+TKT   +W+V++     +T      
Sbjct: 170 FDPNSTDSFNSSYTSK----VYDSLGNPHTVTQYFTKTNANEWQVNVVVDGAAT------ 219

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKS 296
              P  T  V+F+        ++  A++FN   +G D   I IDI+ TTQ    F    +
Sbjct: 220 ---PSQTQNVAFNTDGTLQLPTAPFAVNFNP--AGADAANINIDIAGTTQFGADFGVSTN 274

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+  G+     V  +G V   Y +G      ++ +A   +   L   +G +++ +  
Sbjct: 275 APNGYTSGELAGVRVEDNGMVFATYTNGQSQLQGQVMLADFANPQGLVKTNGTSWIQSFS 334

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           SG    G P     G + +GALE +NVD+ SEL  L+ AQRNY  N+K   T
Sbjct: 335 SGAPVNGAPSTGTLGGLVAGALEGSNVDLTSELVSLMTAQRNYQANAKTIST 386


>gi|148980302|ref|ZP_01815989.1| flagellar hook protein E [Vibrionales bacterium SWAT-3]
 gi|145961321|gb|EDK26631.1| flagellar hook protein E [Vibrionales bacterium SWAT-3]
          Length = 408

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/418 (26%), Positives = 194/418 (46%), Gaps = 16/418 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG++A ++ ++ +S+NIANV T G+K +   F+S+   S +     GG+E+   
Sbjct: 2   SFSIALSGLNASNSELNTISNNIANVSTTGFKESRTEFASVYSGSEA-----GGVEVVGV 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + G++  T  + D+A+ G GFF+++        TR+G F++N +G +   +G  L
Sbjct: 57  SQNFEKSGTVTGTGRSLDMALSGNGFFVLEDSKGQTLYTRSGIFNMNADGVITANSGAAL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L++ S   +  + +  A L A  T +     NLD    +  P     ++
Sbjct: 117 QGYSV-DGNNNLLLGS---VGTVQISTASLQARETDSIEFVANLDAREQV--PASAFDYS 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN--NSFPYNVAPL 242
              + Y H  +   YD+LG+      Y+ K     W+V I    ++ +  ++     +P 
Sbjct: 171 -DSSTYNHSYTTPVYDSLGNPHTVSQYFVKGASNDWDVHILVDGKAIDGADALVPAASPT 229

Query: 243 NTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            T   +F     G +++  + ++SF+         + ID+S  TQ    F+  K+  NG 
Sbjct: 230 ATDTANFTFNADGTISSGGNYSVSFDPANGANSVTVNIDLSAVTQFGSDFVVSKNSPNGS 289

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G      +  DG +   Y +G      ++ +A   S  N+       +L +  SG   
Sbjct: 290 TSGDYASVRMENDGRIFATYTNGQSQLQGQVVLADFASPQNMIKTSDTAWLQSFSSGTPV 349

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           +G  G    G++ SGALE +NVD+ SEL  L+ AQRNY  N+K   T       L ++
Sbjct: 350 LGTAGSGVFGDLTSGALEGSNVDLTSELVALMTAQRNYQANTKSISTSDQLTQALFNV 407


>gi|229132566|ref|ZP_04261415.1| Flagellar hook protein flgE [Bacillus cereus BDRD-ST196]
 gi|228650912|gb|EEL06898.1| Flagellar hook protein flgE [Bacillus cereus BDRD-ST196]
          Length = 407

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 198/432 (45%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGSKGDDKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNTEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANAATGEVDLSGIPGPLQIPMGSA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  IT +                   AYD  G++    V +T+T +  ++ ++  ++ 
Sbjct: 180 ADAKQITQE-----------------LPAYDDAGNTWTMRVEFTQTSEHNYKYTVHMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +    V      +V+FD V          +I FN  T      + +D SK T    
Sbjct: 223 SKKETEFKEVQGAGG-DVTFDAVGKPNQQKPGASIPFNGGT------VNLDFSKLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 EKTLAVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKNGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++   A E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILAMGVSGQNGAGKVRGSAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKIS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|260574380|ref|ZP_05842384.1| protein of unknown function DUF1078 domain protein [Rhodobacter sp.
           SW2]
 gi|259023276|gb|EEW26568.1| protein of unknown function DUF1078 domain protein [Rhodobacter sp.
           SW2]
          Length = 435

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 120/448 (26%), Positives = 203/448 (45%), Gaps = 40/448 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--PSTSNSYVSG 58
           M I  ++   ++G++A + R++++SDNIAN  T GYKR +  F S+V    + + +Y +G
Sbjct: 1   MTISSALSAGVAGLNANATRLASISDNIANSGTYGYKRASTDFESMVITQAAGAGTYSAG 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHI 110
           G+  ST  +I E+G+L+ T++  DLA+ G+G   V     +          +T  G F  
Sbjct: 61  GVRASTTRLIDERGALVSTSNALDLAVSGRGMLPVSATAGLGTDLAGTNLMMTTTGSFRP 120

Query: 111 NNEGFLENVAGGVLLGYPLKNASAPLIV---NSFQGLERINVKHAELSAMPTTTGFISNN 167
           +  G L   +G VLLG+P  NA   + V   ++  GL  + +   + +  PTT   +  N
Sbjct: 121 DANGVLRTQSGLVLLGWP-ANADGTIPVLPRDTIAGLTPVVINSNQQAGDPTTEMKLGVN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEV 222
           L    T              A  T   S   +  LG+S   DV +T T        +W++
Sbjct: 180 LPATQT----------TAGAAGTTLPLSIEYFGNLGTSETLDVTFTPTVPATGSSNEWKM 229

Query: 223 SIFRQDQSTNNSFPYNVAPLNT-----VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQI 277
            I    Q       Y +   ++        S   V+G   N++   ++     +G    +
Sbjct: 230 EIRDSAQGGALVGEYTIVFDDSRGNGGTIASVTTVSGGAYNAADGTLALT--VAGGPLTM 287

Query: 278 TI----DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLA 333
           TI    D +  TQL+  F P     NG   G   +  V ++GY+   YD G    +Y++ 
Sbjct: 288 TIGKVGDPNGLTQLSDSFAPTSITKNGSPVGNLMEVEVDENGYLTASYDTGFTRRLYQIP 347

Query: 334 IATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELI 393
           +   P+ + L   +  TY  + +SG   +   G    G +   + E +  D+A+ELT LI
Sbjct: 348 LVDTPNLNGLIALNNQTYQISPNSGSFFLWDAGDGPTGAVVGYSREGSTTDVAAELTNLI 407

Query: 394 EAQRNYAVNSKVFQTGSDFMDILISLKR 421
           + QR Y+ N+KV QT  + +    ++KR
Sbjct: 408 QTQRAYSSNAKVIQTVDEMLQETTNIKR 435


>gi|16799780|ref|NP_470048.1| flagellar hook protein FlgE [Listeria innocua Clip11262]
 gi|16802739|ref|NP_464224.1| flagellar hook protein FlgE [Listeria monocytogenes EGD-e]
 gi|47095263|ref|ZP_00232874.1| flagellar hook protein FlgE, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|116872086|ref|YP_848867.1| flagellar hook protein FlgE [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|224498779|ref|ZP_03667128.1| flagellar hook protein FlgE [Listeria monocytogenes Finland 1988]
 gi|224501998|ref|ZP_03670305.1| flagellar hook protein FlgE [Listeria monocytogenes FSL R2-561]
 gi|254829354|ref|ZP_05234041.1| flagellar hook protein FlgE [Listeria monocytogenes FSL N3-165]
 gi|254900067|ref|ZP_05259991.1| flagellar hook protein FlgE [Listeria monocytogenes J0161]
 gi|254911380|ref|ZP_05261392.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254935707|ref|ZP_05267404.1| flagellar hook protein FlgE [Listeria monocytogenes F6900]
 gi|255027496|ref|ZP_05299482.1| flagellar hook protein FlgE [Listeria monocytogenes FSL J2-003]
 gi|16410086|emb|CAC98775.1| lmo0697 [Listeria monocytogenes EGD-e]
 gi|16413157|emb|CAC95937.1| lin0705 [Listeria innocua Clip11262]
 gi|47016334|gb|EAL07256.1| flagellar hook protein FlgE, putative [Listeria monocytogenes str.
           1/2a F6854]
 gi|116740964|emb|CAK20084.1| flagellar hook protein FlgE, putative [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|258601767|gb|EEW15092.1| flagellar hook protein FlgE [Listeria monocytogenes FSL N3-165]
 gi|258608290|gb|EEW20898.1| flagellar hook protein FlgE [Listeria monocytogenes F6900]
 gi|293589317|gb|EFF97651.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|313620066|gb|EFR91579.1| flagellar hook protein FlgE [Listeria innocua FSL S4-378]
          Length = 411

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 196/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|260767923|ref|ZP_05876857.1| flagellar hook protein FlgE [Vibrio furnissii CIP 102972]
 gi|260615953|gb|EEX41138.1| flagellar hook protein FlgE [Vibrio furnissii CIP 102972]
          Length = 398

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 126/412 (30%), Positives = 192/412 (46%), Gaps = 36/412 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFSAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDSMGQTLYTRSGVFGTDKDNYVVGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPT-TTGFISN---NLDKNATIITPDKT 180
            GY + + S  L+  S   +  I +  + LSA  T +  F++N   + D     + P   
Sbjct: 117 QGYSV-DGSNNLLSGS---VGDIKISTSSLSAKATDSLEFVANFNASADAIDQTVYPFDP 172

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N  ++ YT K    AYD+LG+S     Y+TKT D  WEV++     +T ++      
Sbjct: 173 ADPNSFNSSYTSK----AYDSLGNSHTVTQYFTKTADNTWEVNVQVDGAATASA------ 222

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDN--TSGIDQQITIDISKT--TQLAGGFIPQKS 296
              TV V+F+   G L   S    SFN     +G +  ++ID+S T  TQ    F    +
Sbjct: 223 ---TVPVTFN-TDGTL---SSPTGSFNVAFPAAGANA-MSIDVSLTGSTQFGADFGVSTN 274

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+  G+     V  +G V   Y +G      ++ +A   +   L    G  +  +  
Sbjct: 275 NPNGYTSGELAGVRVEGNGMVYATYTNGESQLQGQVVLANFANPQGLAKVSGTAWTQSFS 334

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           SG  ++G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T
Sbjct: 335 SGSPTVGVPGTGTLGDLTPGALEGSNVDLTSELVSLMTAQRNYQANAKTIST 386


>gi|78224295|ref|YP_386042.1| hypothetical protein Gmet_3103 [Geobacter metallireducens GS-15]
 gi|78195550|gb|ABB33317.1| conserved hypothetical protein [Geobacter metallireducens GS-15]
          Length = 419

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 121/433 (27%), Positives = 203/433 (46%), Gaps = 26/433 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-SYVSGG 59
           M +  ++ T +SG++A    +S + +NI+NV+T+G+K+  + FS ++  + S  S +  G
Sbjct: 1   MSVTSALYTGISGLNANGEAMSVIGNNISNVNTIGFKQGRMLFSDVLSSTISGGSQIGRG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
           ++I T +    QGS   T S TDLA+QG  FF+V+  DN    TRAG F  + +  L N 
Sbjct: 61  VQIQTVENQFTQGSFESTESGTDLAVQGDSFFVVQ-NDNGRYYTRAGAFTFDKDKTLVNP 119

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTT----TGFISNNLDKNATII 175
            G  + GY +  +S         GL    +K  +L+   TT    T  +   L+ ++T  
Sbjct: 120 EGYQVQGYGIIPSS---------GLADGVMKPIDLTTFATTPPKQTSAVDMVLNLDSTQS 170

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
           TP          A     +S + YD+ G++    VY+ KT    W+      D       
Sbjct: 171 TPALPWNPANPVATSNFSTSLSVYDSQGNAHTATVYFRKTAANAWDWHAILPDAQAGTP- 229

Query: 236 PYNVAPLNTVEVSFDPVTGYLAN-----SSHKAISFNDNTSGIDQQIT--IDISKTTQLA 288
             +  PL+   ++FD  TG L       S+ + I+F    +   Q I   + +  TTQ A
Sbjct: 230 GSSTTPLDGT-LTFD-ATGALTGQTPLASAAQNITFTGGVTA-PQPILFGMGVGATTQYA 286

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
              I      +G+  G     ++   GYV+ +Y +G    +Y++A+A   S   L    G
Sbjct: 287 SPSIVSSQTQDGYYQGTLTKVTIDDKGYVNGVYSNGELKKLYQVALAKFASTTGLSKAGG 346

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             +  T DSG            G++ + +LE +NVD+A++  ++I  QR Y+ NSK   T
Sbjct: 347 TLFEETLDSGQPLFSNASTPGVGKVLANSLEQSNVDMAAQFVKMITTQRGYSANSKTITT 406

Query: 409 GSDFMDILISLKR 421
             + +  +++LKR
Sbjct: 407 ADEMLQEVLNLKR 419


>gi|325474542|gb|EGC77728.1| flagellar hook protein FlgE [Treponema denticola F0402]
          Length = 463

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 123/474 (25%), Positives = 211/474 (44%), Gaps = 66/474 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY------- 55
           ++ S+ + ++GM     R+  + +N+ANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVTGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGAARPTEELG 60

Query: 56  ------VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+L  T  NTDLAIQG GFFI+K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGMMVASIDTIFTQGALQTTGVNTDLAIQGNGFFILKDGEKT-FYTRAGAFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           I+ EG L N A G+ + G+  + A    I+N+    E +N+   + L A  TT+   + N
Sbjct: 120 IDKEGTLVNPANGMRVQGWMAEEADGFRIINTSGQTEDLNIPIGQKLDAKATTSVNYACN 179

Query: 168 LDKNATIITPDKTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           LDK      P+     N  +  E T  + F  YD+ G +    + + +      EV+ + 
Sbjct: 180 LDKRL----PELPEGANRAQILESTWSTEFKVYDSFGEAHELQIDFARV---PGEVNAW- 231

Query: 227 QDQSTNNSFPYNV-------------APLNTVEVSFD-----------------PVTGYL 256
             Q+T N  P N                 N+  V FD                 P    L
Sbjct: 232 --QATVNVDPTNADATATRVGIGTTDGVQNSFIVRFDNNGHLASVTDTAGNVTSPAGQVL 289

Query: 257 ANSSHKAISFNDNTSGIDQQITIDI---------SKTTQLAGGFIPQKSEINGHAPGKPK 307
              S+  +  N + +G   + T D+         +  TQ +     +  E +G+  G  +
Sbjct: 290 VQISYNVVGANPDEAGAPTRHTFDVNLGEIGTSKNTITQFSDKSTTKAYEQDGYTLGYLE 349

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
           +F + + G +  +Y +G R  I ++A+A   ++  L+    NTY+ + +SG  ++   G 
Sbjct: 350 NFRIDQSGIITGVYSNGVRQEIGQIAMAGFANQGGLEKAGQNTYVQSNNSGIANVSTSGT 409

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
              G    G LE +NVD+  +  ++I  Q+ +   +K  QT    ++ +++LKR
Sbjct: 410 VGKGYFIGGTLEMSNVDLTDQFVDMIVTQKGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|46906948|ref|YP_013337.1| flagellar hook protein FlgE [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47091659|ref|ZP_00229455.1| flagellar hook protein FlgE, putative [Listeria monocytogenes str.
           4b H7858]
 gi|217965205|ref|YP_002350883.1| flagellar hook protein [Listeria monocytogenes HCC23]
 gi|226223328|ref|YP_002757435.1| flagellar hook protein FlgE [Listeria monocytogenes Clip81459]
 gi|254824023|ref|ZP_05229024.1| flagellar hook protein FlgE [Listeria monocytogenes FSL J1-194]
 gi|254853099|ref|ZP_05242447.1| flagellar hook protein FlgE [Listeria monocytogenes FSL R2-503]
 gi|254932023|ref|ZP_05265382.1| flagellar hook protein FlgE [Listeria monocytogenes HPB2262]
 gi|300764509|ref|ZP_07074502.1| flagellar hook protein FlgE [Listeria monocytogenes FSL N1-017]
 gi|46880214|gb|AAT03514.1| putative flagellar hook protein FlgE [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47019978|gb|EAL10715.1| flagellar hook protein FlgE, putative [Listeria monocytogenes str.
           4b H7858]
 gi|217334475|gb|ACK40269.1| flagellar hook protein [Listeria monocytogenes HCC23]
 gi|225875790|emb|CAS04493.1| Putative flagellar hook protein FlgE [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258606448|gb|EEW19056.1| flagellar hook protein FlgE [Listeria monocytogenes FSL R2-503]
 gi|293583575|gb|EFF95607.1| flagellar hook protein FlgE [Listeria monocytogenes HPB2262]
 gi|293593251|gb|EFG01012.1| flagellar hook protein FlgE [Listeria monocytogenes FSL J1-194]
 gi|300514863|gb|EFK41917.1| flagellar hook protein FlgE [Listeria monocytogenes FSL N1-017]
 gi|307570236|emb|CAR83415.1| flagellar hook protein [Listeria monocytogenes L99]
 gi|332311122|gb|EGJ24217.1| Flagellar hook protein FlgE [Listeria monocytogenes str. Scott A]
          Length = 411

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 196/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|119947177|ref|YP_944857.1| flagellar hook protein FlgE [Psychromonas ingrahamii 37]
 gi|119865781|gb|ABM05258.1| flagellar hook protein FlgE [Psychromonas ingrahamii 37]
          Length = 398

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 119/415 (28%), Positives = 195/415 (46%), Gaps = 24/415 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS-T 64
           S   A+SG++A + +++ +S+NIANV T G+K +   F+S+      N   +GG+E+S  
Sbjct: 2   SFNIAISGLNATNKQLNTISNNIANVSTYGFKESRAEFASIY-----NGGQAGGVEVSGI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                  GSL  T    DLAI G GFF           TR+G F  + + F+ + AG  L
Sbjct: 57  TQNFDRNGSLEATGRALDLAISGNGFFATVDNKGQQIYTRSGAFSTDKDNFIVSSAGNKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + +A A L   +   ++ + +  A LSA  T +   + N D  AT   P  +   +
Sbjct: 117 QGYTV-DAKANLQKGN---IDDLAISTASLSAKATDSIEFTANFDARAT---PVASAAFD 169

Query: 185 GRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
             D   +T   +  A+D+LG++     Y+  TG  +W + +   D    N    + AP+ 
Sbjct: 170 PADPTSFTSSYTAQAFDSLGNAHTVSQYFINTGSNQWNIKVIADD----NDVTPDPAPV- 224

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGHA 302
            +E + +   G LA++S   I  +    G +   + ID++ +TQ    F    +  NG+ 
Sbjct: 225 -IEFTTE---GLLADTSTIPILVSIPALGANLIAVEIDLTGSTQYGADFGVSTNNPNGYT 280

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+     V  +G +   + +G      +L +A  P+   L+  +  +++ T  SG    
Sbjct: 281 AGELTGIRVEDNGMIFAQFTNGQSQLQGQLVLADFPNPTALEQSNNTSWMQTFGSGTPVK 340

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G++ S  LET+NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 341 GAPGSGVLGKLTSNMLETSNVDLTSELVSLMTAQRNYQANTKTISTADQLTKALF 395


>gi|2494530|sp|Q56326|FLGE_TREPH RecName: Full=Flagellar hook protein flgE
 gi|439981|gb|AAA73467.1| flagellar hook polypeptide [Treponema phagedenis]
          Length = 463

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 122/468 (26%), Positives = 215/468 (45%), Gaps = 54/468 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-----NSYVS 57
           ++ S+ + +SGM     R+  + +N+ANV+T G+KR  + F  L+    S     N  V 
Sbjct: 1   MMRSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGASRPNEEVG 60

Query: 58  G--------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
           G        G+ +++ D +  QG+L  T  NTD+AIQG GFFI+K  +  +  T AG F 
Sbjct: 61  GVNPKEVGLGVMVASIDTVHTQGALQTTGINTDIAIQGNGFFILKDGEK-SFYTTAGAFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           ++ +G L N A G+ + G+  ++     I+N+    E + +   + + A  TT    + N
Sbjct: 120 VDRDGTLVNPANGMRVQGWMAEDIEGQQIINTSDQTEDLIIPIGQKIDAKATTDVAYACN 179

Query: 168 LDKNATIITPDKTPKHNGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKW--EV 222
           LDK      P+     N  D    T  + F  YDT G      + +++    + +W   V
Sbjct: 180 LDKRL----PELPEGANQADILRSTWATDFNVYDTFGEQHKLQMVFSRVPGTNNQWLATV 235

Query: 223 SIFRQDQS---TNNSFPYNVAPLNTVEVSFD-----------------PVTGYLANSSHK 262
           ++  ++Q+   T           NT  VSFD                 P    L  +S+ 
Sbjct: 236 NVDPENQAGTETRVGIGTTDGTENTFIVSFDNYGHLASVTDTAGNVTAPAGQVLVQASYN 295

Query: 263 AISFNDNTSGIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSK 313
            +  N +  G   + T +I+           TQ A     +  + +G+A G  ++F + +
Sbjct: 296 VVGANPDEGGAPTRHTFNINLGEIGTSRNTITQFAERSTTKAYQQDGYAMGYLENFKIDQ 355

Query: 314 DGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEI 373
            G +  +Y +G    I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++
Sbjct: 356 SGIITGVYSNGASREIGQLALAGFANQGGLEKAGENTYIQSNNSGIANITVSGVMGKGKL 415

Query: 374 FSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            +G LE +NVD+  + T++I  QR +   +K  QT    ++ +++LKR
Sbjct: 416 IAGTLEMSNVDLTDQFTDMIITQRGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|206974982|ref|ZP_03235897.1| flagellar hook protein FlgE [Bacillus cereus H3081.97]
 gi|206747001|gb|EDZ58393.1| flagellar hook protein FlgE [Bacillus cereus H3081.97]
          Length = 407

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/432 (25%), Positives = 196/432 (45%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDDRYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYTDGTITLTGGKTQAAMEGNGFFVVGDSKAGNMEFTRKGTFT 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   ++  + +    G  ++ +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPADPSTGNVDLTGIPGPLQVPMGSA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  IT +                    YD  G++    V + + G+  ++  ++ ++ 
Sbjct: 180 ADAKQITQE-----------------LPVYDNAGNTWTMRVEFKQDGEHNYKYKVYMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +  +N       EV FD V      +    I FN  T      + ID SK T    
Sbjct: 223 SKKET-AFNEVDGAGGEVKFDAVGKPNPVNPEANIPFNGGT------VKIDFSKLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 EKTLAVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKTGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILAMGVSGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKIS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|34498340|ref|NP_902555.1| flagellar hook protein flgE [Chromobacterium violaceum ATCC 12472]
 gi|34104194|gb|AAQ60553.1| flagellar hook protein flgE [Chromobacterium violaceum ATCC 12472]
          Length = 416

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/424 (25%), Positives = 201/424 (47%), Gaps = 21/424 (4%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL----VFPSTSNSYVSGGLEI 62
            +  +SG++A S ++ ++ +N+AN +TVG+K +   F  L    +F + +NS  +G   +
Sbjct: 3   FQQGLSGINAASVQLDSIGNNVANANTVGFKSSRTEFGDLYAQSIFGTAANSPGNGVSVL 62

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +S  G+  +T  + DLAI   GFFI+   +     +R G F +N++G+L N  G 
Sbjct: 63  AVTANMSA-GNTENTGRSLDLAINNNGFFIMNQPNGTQTYSRDGQFQVNSQGYLVNSYGA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY +  +  P +      L+ + + +  +S   T+       L+ NAT+  P  +P 
Sbjct: 122 YLQGYGVNTSGQPQV----GPLQNLQITNTTISPQATSQISWPVQLNSNATV--PVNSPV 175

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYY----TKTGDKKWEVSIFRQDQSTNNSFPYN 238
           +      Y   S    YD+LG+S    +YY    T      W V+ +        + P  
Sbjct: 176 NPTDPTTYNWPSPTVVYDSLGNSHQVTLYYSLASTSATGNTWTVTPYVDGAPA--TIPGG 233

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNT---SGIDQQITIDISKTTQLAGGFIPQK 295
            +      V F+   G LAN++   ++   NT   S   Q + I+++ + Q+A  +    
Sbjct: 234 GSGNTNFSVKFNN-NGSLANTTPANVNLTFNTTNGSSTPQTVAINLTGSNQIAQNYGTGT 292

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              NG APG     S++ +G V   + +     + ++A+AT  +   L    GN +  + 
Sbjct: 293 ITQNGSAPGLLTGVSIASNGVVQATFSNSQTKTLGQVALATFVNPQGLLNLGGNQWQQSG 352

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG  ++  PG    G + +G++E +NV++ +EL  +I AQR Y  N++  +T    +  
Sbjct: 353 NSGPATVNQPGTGNAGTLTAGSVEDSNVNLTNELVNMITAQRYYQANAQTIKTQDTLIQT 412

Query: 416 LISL 419
           L+++
Sbjct: 413 LLNI 416


>gi|227328338|ref|ZP_03832362.1| flagellar hook protein FlgE [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 400

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 106/415 (25%), Positives = 197/415 (47%), Gaps = 24/415 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A SN +  + +NIAN  TVG+K   + F+ +     + S V  G+++++     
Sbjct: 6   AVSGLNAASNNLDVIGNNIANSATVGFKSGTVTFADMF----AGSKVGMGVKVASVLQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L GYP+
Sbjct: 62  GNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNGRNIV-NAQGMQLTGYPV 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
             A  P  V +      + V   ++ A  TT   I  NL K++  +  +      G +  
Sbjct: 121 --AGTPPTVQTGADPVPLTVPDGDMLASATTIASIKANL-KSSDAVPTNAWATTPGAEGT 177

Query: 190 YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSF 249
           Y  K++   YD+ G+   + +Y+ KT +  W+   + +D S   +   N   LN    S 
Sbjct: 178 YNSKTALTTYDSQGNVHNFTLYFVKTANNTWQT--YAKDDSITPAVYQNAGALNFA--SN 233

Query: 250 DPVTGYLANSSHKAISFNDNTSGIDQQ----ITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             +TG+          FN N  G +       T++++ + Q    +  +    NG APG 
Sbjct: 234 GALTGH--------TPFNINLVGTNGAATGTFTLNLTGSVQQNTEYSYKSPTQNGFAPGS 285

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              F+++ DG ++  Y +G +  + ++ +A+  + + L     N +  T  SG   +G  
Sbjct: 286 LTGFAINDDGTIEGNYSNGQKQALGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLA 345

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 346 GTGSLGKLIGKSTESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 400


>gi|254830312|ref|ZP_05234967.1| flagellar hook protein FlgE [Listeria monocytogenes 10403S]
          Length = 411

 Score =  137 bits (345), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 196/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDAGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|290893994|ref|ZP_06556969.1| flagellar hook protein FlgE [Listeria monocytogenes FSL J2-071]
 gi|290556440|gb|EFD89979.1| flagellar hook protein FlgE [Listeria monocytogenes FSL J2-071]
          Length = 411

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 196/448 (43%), Gaps = 76/448 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMISEQGSLM-------------HTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M    GS +              T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T  G +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLNGN----LQPIQIPLNSAIPGEATKNGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTISSELSVYDNAG------------GKHKLQVNMKAATPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFD------PVTGYLANSSH---------KAISFNDNTSGI 273
            S N S+ Y        E+  D      PVTG L  ++          K I  N   +G 
Sbjct: 213 ASGNVSYEY--------EIQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGK 264

Query: 274 DQQITIDISKTTQLAGG--FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
              + +++S  T       F P     +G      KD++V+  GY+ + Y DGT +P+ +
Sbjct: 265 QVNMGLNLSGLTNYGTNQVFSPTS---DGKGAATVKDYAVTDAGYIAVSYSDGTVIPVAQ 321

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   
Sbjct: 322 LAVATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVN 381

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L+  Q  +  N+KV +   D M  +++L
Sbjct: 382 LMTYQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|50120639|ref|YP_049806.1| flagellar hook protein FlgE [Pectobacterium atrosepticum SCRI1043]
 gi|49611165|emb|CAG74611.1| flagellar hook protein [Pectobacterium atrosepticum SCRI1043]
          Length = 405

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 198/413 (47%), Gaps = 15/413 (3%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A SN +  + +NIAN  TVG+K   + F+ +     + S V  G+++++     
Sbjct: 6   AVSGLNAASNNLDVIGNNIANSATVGFKSGNVTFADMF----AGSKVGMGVKVASVLQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L GYP+
Sbjct: 62  GNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNGRNIV-NAQGMQLTGYPV 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
             A  P  V +      + V   ++ A  T+   I  NL  + ++ T +      G +  
Sbjct: 121 --AGTPPTVQTGADPVPLTVPDGDMLASQTSVASIKANLKSSDSVPT-NAWATTPGAEGT 177

Query: 190 YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSF 249
           Y  K++   YD+ G+   + +Y+ KT +  W+   + +D S N +   N   LN      
Sbjct: 178 YNSKTALTTYDSQGNVHNFTLYFVKTANNTWQT--YAKDDSINPATYQNAGTLNFEANGA 235

Query: 250 DPVTGYLANSSHKAISFN-DNTSGI-DQQITIDISKTTQLAGGFIPQKSEINGHAPGKPK 307
              TG  A   H   + N   T+G  +   T++++ + Q    +  +    NG APG   
Sbjct: 236 LSSTGATA---HTPFTLNLTGTNGAANGTFTLNLTGSVQQNTEYSYKSPTQNGFAPGSLT 292

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
            F+++ DG ++  Y +G +  + ++ +A+  + + L     N +  T  SG   +G  G 
Sbjct: 293 GFAINDDGTIEGSYSNGQKQALGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLAGT 352

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
              G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 353 GSLGKLIGKSTESSNVDLSKELVSMIVAQRNYQSNAQTIKTQDSILQTLVSLR 405


>gi|163803169|ref|ZP_02197052.1| flagellar hook protein [Vibrio sp. AND4]
 gi|159173069|gb|EDP57902.1| flagellar hook protein [Vibrio sp. AND4]
          Length = 399

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 187/424 (44%), Gaps = 41/424 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TRAG F  +   F+    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDNMGQMLYTRAGVFGTDKNNFVTANNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT----IITPDKT 180
            GY + N +A L   S   +  I V  + L+A  T       N D +AT     + P  +
Sbjct: 117 QGYSVDN-NANLQTGS---VGDIKVSTSSLNAKATDNLDFVANFDASATAVDQTVYPFDS 172

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N  ++ YT K     YD+LG+S     Y+TKT D +W+V++        N  P   A
Sbjct: 173 SDPNSFNSSYTTK----VYDSLGNSHTVTQYFTKTSDNEWQVNVEV------NGAPTTPA 222

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFN-------DNTSGIDQQITIDISKTTQLAGGFIP 293
              TV+ + D   G LA+ +    SFN        N   ID    I ++ +TQ    F  
Sbjct: 223 TAQTVQFNTD---GTLASPTG---SFNIAFPAAGANAMSID----ISLNGSTQFGASFGV 272

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
             +  NG+  G+     V  +G V   Y +G      ++ +A   +   L    G ++  
Sbjct: 273 STNNPNGYTSGELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANTQGLSKVSGTSWTQ 332

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           +  SG   +G PG    G +  GALE +NVD+ SEL  L+ AQRNY  N+K   T     
Sbjct: 333 SFSSGAPIMGVPGTGTLGNLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTNDKLT 392

Query: 414 DILI 417
             L 
Sbjct: 393 QALF 396


>gi|90579909|ref|ZP_01235717.1| flagellar hook protein [Vibrio angustum S14]
 gi|90438794|gb|EAS63977.1| flagellar hook protein [Vibrio angustum S14]
          Length = 467

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 130/480 (27%), Positives = 203/480 (42%), Gaps = 79/480 (16%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSGGLE 61
           SM  A+SG+ A    ++  S+NIAN +T G+K +   F    S+ +F S + +   GG++
Sbjct: 2   SMNIALSGLGAAQKDLNTTSNNIANANTFGFKESRAEFGDVYSNSIF-SNAKTTTGGGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV---NCLTRAGDFHINNEGFLEN 118
            ST      +GS ++T +  DL + G GFF V    N    N LTR G FH+NNE  L N
Sbjct: 61  TSTVAQQFHEGSSIYTNNPLDLRVSGSGFFAVADNKNEPANNNLTRNGAFHLNNENELVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  LLGYP+   S     N+    E  ++K  ++   PT +G I  +L+    +   +
Sbjct: 121 SEGKFLLGYPVNKDS-----NTVASYEAKSMKIDDVFGQPTKSGTIKVSLN----LPNKE 171

Query: 179 KTPKHNGRDAE----YTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--------WEVSIFR 226
             PK N  D +    +   +S   YD+LG       YY    D          WEV    
Sbjct: 172 TAPKSNSFDFKDPDSFNKSTSSTIYDSLGKPYKMTTYYVAKYDPNAVPTNANTWEV---- 227

Query: 227 QDQSTNNSF--------PYNVAPLNTVEVSFDP----VTGYLANSSHKAISFNDN----- 269
               TNNS         P  + P   V  + DP    VTGY          +  +     
Sbjct: 228 HQTVTNNSGEERLLKPDPTKIPPAYQVIDNTDPTAPVVTGYRMRFDQNGQPYPGDPGDPT 287

Query: 270 ---------------------TSGID-------QQITIDISKTTQLAGGFIPQK-SEING 300
                                ++GID       Q +T++    TQ A  F  +K  +++G
Sbjct: 288 ATPAIPPTPASPLNIQMETFASAGIDVGGADPTQSLTMNYDDPTQYASAFEVRKFQDVDG 347

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G      +  +G +   Y +G  + + R+A+A V +E  L    G  +  T++SG  
Sbjct: 348 ATTGYLSKVDIDPEGNILASYSNGKDIVVGRVALARVSNEQGLAQLGGTLWNTTQESGQA 407

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G       G + SG LE +N+D+  EL +LI AQRN+  +S+     +     ++ ++
Sbjct: 408 IWGDASQGSFGSVKSGTLEQSNIDMTQELVDLITAQRNFQASSRALDVNNQLQQNILQIR 467


>gi|160896079|ref|YP_001561661.1| flagellar basal body FlaE domain-containing protein [Delftia
           acidovorans SPH-1]
 gi|160361663|gb|ABX33276.1| flagellar basal body FlaE domain protein [Delftia acidovorans
           SPH-1]
          Length = 423

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 121/436 (27%), Positives = 197/436 (45%), Gaps = 37/436 (8%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIS 63
            +  +SG++A S  +  +  NIAN +T G+K +   F+  V     S S      G+ ++
Sbjct: 3   FQQGLSGLNAASKNLDVIGHNIANANTTGFKSSRAEFAEAVASAVGSASGQNSGIGVNVA 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG +  T +N D+AI G GFF+V+  D     TRAG+F ++ +G L+ V G  
Sbjct: 63  AVTQQFRQGPITTTGNNLDVAINGNGFFVVRQPDGSTAYTRAGNFGLDKQGNLKTVQGDN 122

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT------IITP 177
           ++GYP+ +A+   ++   Q +  +      ++A  TT   +S NLD  AT        TP
Sbjct: 123 VMGYPV-DATTGKVLAGGQPVPMVFPSGQPIAAKTTTKIDVSLNLDARATPAAGNSTATP 181

Query: 178 D--KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEVSIFRQDQSTNNS 234
               TP+        T+ +S   YD+ G      +Y+ K      W+V     D + +  
Sbjct: 182 PVPATPRA-------TYGTSINVYDSQGVPTPVQMYFEKDAASNTWKVYDGLDDPTAS-- 232

Query: 235 FPYNVAPLNTVEV--------SFDPVTGYLANSSHKAISFN--DNTSGIDQQITIDISKT 284
            P  VA L T  V        S  PVT  + +S+  A +    + T+G+    T+D S  
Sbjct: 233 -PPKVATLLTTLVFDASGKITSGSPVTAQIKSSNPNAPTPGTINGTAGV----TLDFSNV 287

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           +Q    F     + +G+  G     +V  DG +   Y +G      +LA+A   +   L 
Sbjct: 288 SQFGSKFAVSSLKQDGYTAGALTGINVGNDGSIVATYSNGVTRTEGQLALAAFTNTQGLG 347

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
               N ++ T DSG    G       G + SGALE +NVD+ +EL  ++ AQR Y  N++
Sbjct: 348 AVGDNKWVETSDSGPALNGTAESGTFGSLRSGALEDSNVDLTAELVNMMTAQRAYQANAQ 407

Query: 405 VFQTGSDFMDILISLK 420
             +T       L++L+
Sbjct: 408 TIKTQDQVFSTLVNLR 423


>gi|254294563|ref|YP_003060586.1| hypothetical protein Hbal_2209 [Hirschia baltica ATCC 49814]
 gi|254043094|gb|ACT59889.1| protein of unknown function DUF1078 domain protein [Hirschia
           baltica ATCC 49814]
          Length = 458

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 127/464 (27%), Positives = 219/464 (47%), Gaps = 49/464 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF-PSTSNSYVSGG 59
           M I  ++    +G+ A ++ ++A S+NIANV+TVG+KR    F++++   +  +SY +G 
Sbjct: 1   MSIGSALLAGTAGLRANASAMAATSENIANVNTVGFKRIRNDFTAMLNNQNYQSSYSAGA 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD------NVNCLTRAGDFHINNE 113
           +  +   ++ EQG+L  ++ +T +AI G+G+F+ + R       +    TRAG F  +  
Sbjct: 61  VRATATTLMREQGTLQSSSVSTHMAISGEGYFVTRARGGDATSFDEYSYTRAGQFAPDEG 120

Query: 114 GFLENVAGGVLLGYPLKNASAPLIVNS----FQGLERINVKH----AELSAMPTTTGFIS 165
           G+L+N AG  L G+P+ N     +VN+       L  + V      AE SA  + T  ++
Sbjct: 121 GYLKNTAGQYLYGWPIVNDQ---VVNASPTDLTALSAVRVSGYGGVAEASANLSITANLN 177

Query: 166 NNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSI 224
            + + N    T       N    ++T  +    YD+ G     +  + KT +  +WEV  
Sbjct: 178 ADQEVNPATYTAGDMAAGN-ITPDFT--TPLEVYDSKGGRHTVNFSFLKTANANEWEVEA 234

Query: 225 FRQD----QSTNNSFPYNVAPLNTVEVSFDPV-TGYLAN----SSHKAISFNDNTS---- 271
           +       +   +    N   + T     DPV T  LA+        +I  +D  S    
Sbjct: 235 YVTPSTDIEGVTDGLLANGKMIFTASGLIDPVATNALADGFDPEGSISIGASDPASVGTT 294

Query: 272 -------GIDQQ-ITIDI------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYV 317
                  GI+ Q I +D+      +  TQ +   I   S ++G   G      V +DG V
Sbjct: 295 PRWADGLGIEAQDIQLDLGNGNSTTGLTQYSSDSILDTSTVDGVPFGSLASVDVDEDGVV 354

Query: 318 DIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGA 377
              Y +G    I+++ +AT  +E  L    G +Y    ++GD+++  P   + GE+ S A
Sbjct: 355 IAQYTNGFSRKIFQVPVATFGNEGGLIAQAGGSYRSGPETGDMNLRAPKSGEAGEVISSA 414

Query: 378 LETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           LE++ VD+A E + LI  QR Y+  SK+  T  + ++ LIS+KR
Sbjct: 415 LESSTVDLAEEFSNLIVTQRAYSAASKIITTADEMLNELISIKR 458


>gi|312884834|ref|ZP_07744526.1| flagellar hook protein FlgE [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367486|gb|EFP95046.1| flagellar hook protein FlgE [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 398

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 115/413 (27%), Positives = 180/413 (43%), Gaps = 20/413 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTDLNTISHNIANASTTGFKGARTEFSAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TRAG F+ + + FL +  G  L
Sbjct: 57  SQNFDKNGSISGTGRPMDLAINGTGFFVTKDSTGQTQYTRAGVFNRDKDNFLVSNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L   S      I +  + L+A  TT+     N D +A  +     P   
Sbjct: 117 QGYSVDGNNNLLTGAS----GDIKLSTSSLAAKATTSMDFVANFDASAEQVDQTVNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    S   YD+LG+    + Y+TKTG   W+V++     +T         P  T
Sbjct: 173 NNTNSFNSSYSTKVYDSLGNEHNVNQYFTKTGPNTWQVNVQVDGAAT---------PSAT 223

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
           + ++F+        ++  +++F          I +D+S +TQ    F    +  NG+  G
Sbjct: 224 IAMNFNSDGSLQTPTAPYSVAF-PAAGAQPMNIQVDLSGSTQFGAAFGVSTNSHNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V   G V   Y +G      ++ +A   +   L   +G  +  +  SG   +G 
Sbjct: 283 ELVGARVEDSGRVYATYTNGQSQLQGQVVLADFANPQGLVKVNGTAWTQSFSSGAPIVGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 343 PGTGTLGDLSPGALEGSNVDLTSELVNLMTAQRNYQANAKTISTNDKLTQALF 395


>gi|289433975|ref|YP_003463847.1| flagellar hook protein FlgE, putative [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289170219|emb|CBH26759.1| flagellar hook protein FlgE, putative [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|313634374|gb|EFS00969.1| flagellar hook protein FlgE [Listeria seeligeri FSL N1-067]
 gi|313639059|gb|EFS04046.1| flagellar hook protein FlgE [Listeria seeligeri FSL S4-171]
          Length = 411

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 127/445 (28%), Positives = 203/445 (45%), Gaps = 70/445 (15%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +M TA+SGM+A    +S  S+NIAN +T GYK+ ++ F+ L++ +T  S V+GGL   T 
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLLYQNTMGS-VAGGLYAGTN 62

Query: 66  DMI-------------SEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN 111
            M                 GS   T  N D A+QG+GFFI       N + TR G F ++
Sbjct: 63  PMSFGSGAKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAGDNAGGNIVYTRDGSFAVS 122

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
           +  +L    G  ++GY        L  N    L+ I +  ++ +    T TG +S N+  
Sbjct: 123 DNNYLTTQQGKYVMGYATDKNGNVLSGN----LQPIQIPLNSAIPGEATKTGSLSGNI-- 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--FRQD 228
                     P   G   + T  S  + YD  G            G  K +V++     D
Sbjct: 177 ----------PLDWGE--KDTINSELSVYDNAG------------GKHKLQVNMKAGTPD 212

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAIS-------FNDNTSGIDQQITIDI 281
            + N S+ Y +  ++  E++  PVTG L  ++   ++          NT+   +QI +D+
Sbjct: 213 ANGNVSYDYEI-QMDGKELT-PPVTGTLNYNAQGELTNAAALRNIQINTTVNGKQIDMDL 270

Query: 282 S-------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
           +        T Q+   F P     +G      KD++++  GY+ + Y DGT +P+ +LA+
Sbjct: 271 NLSGLTNYGTNQV---FSPTS---DGKGAATVKDYAITDSGYIAVSYSDGTVIPVAQLAV 324

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           AT  +ED L       Y+P   SGD   G  G N  G I   +LE +NVD++ E   L+ 
Sbjct: 325 ATFSNEDGLVKMGNGEYVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMT 384

Query: 395 AQRNYAVNSKVFQTGSDFMDILISL 419
            Q  +  N+KV +   D M  +++L
Sbjct: 385 YQSGFQGNTKVIRVADDVMKQIVNL 409


>gi|255022066|ref|ZP_05294072.1| Flagellar hook protein flgE [Acidithiobacillus caldus ATCC 51756]
 gi|254968552|gb|EET26108.1| Flagellar hook protein flgE [Acidithiobacillus caldus ATCC 51756]
          Length = 416

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 120/428 (28%), Positives = 199/428 (46%), Gaps = 31/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL---VFPSTSNSYVSGGLEIST 64
            TA+SG+DA    ++ + +NIANV+TVG+K +   F  L       ++ +  + G+ +ST
Sbjct: 4   NTAISGLDAAQTDLNTIGNNIANVNTVGFKESNAQFGDLYAASLAGSAGASTTPGIGVST 63

Query: 65  KDMISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
            D+     QG++  T +  D+AI G GFFIV     ++  TR G FH+++ G LEN    
Sbjct: 64  VDLSQNFTQGNIQTTGNPLDMAINGPGFFIVNNNGTMD-YTRNGQFHVSSNGVLENNGDL 122

Query: 123 VLLGY---PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            + G+   P  N     I      L  + +  + +    T+   +  NL  NA  + P  
Sbjct: 123 PVQGFQPVPGSNGRFSTI------LSNLTISESAMPPQATSQAALVANL--NANDVPPSV 174

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSS---VVYDVYYTKTGD----KKWEVSIFRQDQSTN 232
           TP        Y   ++F  YD+LG++    +Y V  + TG      +W+V       S  
Sbjct: 175 TPFSASNPNSYNDSTTFQVYDSLGNAQDITLYFVQASGTGSANQPNQWDVYY-----SAG 229

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG-IDQQITIDISKTTQLAGGF 291
           NS    VA  +   + F   TG L +    + + +    G     I++++S +T     F
Sbjct: 230 NSSGTTVATGSLTTLQFSN-TGQLVSGGTASFTVSGWGDGSASSTISVNLSGSTLTNSPF 288

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                 +NG+APG     SV   G +D  Y +G +  I ++A+A   +   L    GN +
Sbjct: 289 AVTSENVNGYAPGTYSSISVQSTGEIDANYTNGQKKAIGKVALANFANLQGLAPISGNLW 348

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T  +G+  +  PG    G I SGA+E++NV ++S+L ++I AQ+ Y  N+   +T   
Sbjct: 349 SATATAGNPLVNSPGTAGLGVIQSGAVESSNVSLSSQLVDMIVAQQAYQANTSTIKTEQQ 408

Query: 412 FMDILISL 419
               L+ L
Sbjct: 409 DTQSLLQL 416


>gi|156976141|ref|YP_001447047.1| flagellar hook protein FlgE [Vibrio harveyi ATCC BAA-1116]
 gi|156527735|gb|ABU72820.1| hypothetical protein VIBHAR_04912 [Vibrio harveyi ATCC BAA-1116]
          Length = 399

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 129/424 (30%), Positives = 188/424 (44%), Gaps = 41/424 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TRAG F  +   F+    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDHMGQMLYTRAGVFGTDKNNFVTANNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI----ITPDKT 180
            GY + N +A L   S   +  I V  + L+A  T       N D +AT     I P  +
Sbjct: 117 QGYSVDN-NANLQTGS---VGDIKVSTSSLNAKATDNLDFVANFDASATAVDQAIYPFDS 172

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N  ++ YT K     YD+LG+S     Y+TKT D +W+V++   D +     P   A
Sbjct: 173 SDPNSFNSSYTTK----VYDSLGNSHTVTQYFTKTSDNEWQVNV-EVDGA-----PTTPA 222

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFN-------DNTSGIDQQITIDISKTTQLAGGFIP 293
              TV+ + D   G LA+ +    SFN        N   ID    I ++ +TQ    F  
Sbjct: 223 TAQTVQFNTD---GTLASPTG---SFNVAFPAAGANAMSID----ISLNGSTQFGAAFGV 272

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
             +  NG+  G+     V  +G V   Y +G      ++ +A   +   L    G  +  
Sbjct: 273 STNNPNGYTSGELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANTQGLSKVSGTAWTQ 332

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           +  SG   +G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T     
Sbjct: 333 SFSSGAPIMGVPGTGTLGDLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTNDKLT 392

Query: 414 DILI 417
             L 
Sbjct: 393 QALF 396


>gi|300716218|ref|YP_003741021.1| flagellar biosynthesis, hook protein [Erwinia billingiae Eb661]
 gi|299062054|emb|CAX59170.1| Flagellar biosynthesis, hook protein [Erwinia billingiae Eb661]
          Length = 414

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 118/435 (27%), Positives = 196/435 (45%), Gaps = 50/435 (11%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A S+ +  + +NIAN  TVG+K   ++F+ +     ++S V  G++++      
Sbjct: 6   AVSGLNAASSNLDVIGNNIANSATVGFKSATVSFADMF----ADSKVGLGVKVAAVTQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G+   T+   D+AI   GFF +         +R G F ++    + N  G  L GYP 
Sbjct: 62  NDGTTTSTSRGLDVAISQSGFFRMTDTSGAVYYSRNGQFTLDANRNIVNADGLQLTGYPA 121

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
                P  V +      +NV    +SA  T+   +  NL  N+T  TP K       D  
Sbjct: 122 T--GTPPTVQTGANPVALNVPTTAMSAKATSAAALVANL--NSTDSTPTKDWATTNTDLS 177

Query: 190 ------YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP------- 236
                 Y  K++   YD+LG+    ++YY KTGD  W+  ++  D +T  S         
Sbjct: 178 SIDVDTYNSKATMTTYDSLGNEHNINLYYVKTGDNSWK--MYPVDGTTGQSAAGAGANTD 235

Query: 237 --YNV---------APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
             YNV         +P  TV+++   + G        A +FN N +G  QQ T       
Sbjct: 236 GSYNVTFNSSGQMTSPTATVQLATATLNG------SAAGTFNLNLAGSQQQNT------- 282

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
              G         +G+ PG    + ++ DG V   Y +     + ++A+A   + + LK 
Sbjct: 283 ---GTSTFGNPTQDGYKPGDLTSYQINNDGTVVGTYSNEQTQTLGQIALANFANPEGLKS 339

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N +  T  SG   +G  G    G + +GALE++NVD++ EL  +I AQRNY  N++ 
Sbjct: 340 EGNNVWSATNSSGQALVGLAGTGNLGTLTAGALESSNVDLSKELVNMIVAQRNYQSNAQT 399

Query: 406 FQTGSDFMDILISLK 420
            +T    ++ L++L+
Sbjct: 400 IKTQDQILNTLVNLR 414


>gi|299822273|ref|ZP_07054159.1| flagellar hook protein FlgE [Listeria grayi DSM 20601]
 gi|299815802|gb|EFI83040.1| flagellar hook protein FlgE [Listeria grayi DSM 20601]
          Length = 411

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 125/438 (28%), Positives = 194/438 (44%), Gaps = 56/438 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG------- 58
           +M TA+SGM+A    +S  S+NIAN +T GYKR ++ F+ L++ +T  S  SG       
Sbjct: 4   TMYTAISGMNAFQQALSVTSNNIANANTTGYKRQSVVFNDLLYQNTLGSVTSGLYAGTNP 63

Query: 59  -----GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHINN 112
                G +I         GS   T  N D A+QG GFFI   R   N + TR G F +++
Sbjct: 64  MSFGSGTKIGAVITDYTAGSPTATGRNKDAALQGNGFFIAGDRSGGNAVYTRDGSFAVSS 123

Query: 113 EGFLENVAGGVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           + FL   +G  ++GY   KN       N   G    N++  ++       G  + N   +
Sbjct: 124 DNFLTTQSGKYVMGYATDKNG------NVIDG----NLRPIQIPLNSAIPGEATKNAKLS 173

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
             I T  K     G+D   T  S  + YD  G            G  K +V +    ++ 
Sbjct: 174 GNIPTDWK-----GKD---TLTSEISVYDDAG------------GSHKLQVELKDGTRAA 213

Query: 232 NNSFPYN---------VAPLNTVEVSFDPVTGYLANSSH-KAISFNDNTSGIDQQITIDI 281
           + S  Y+         + P  T  ++++   G L N++  + I+ N    G +     D+
Sbjct: 214 DGSISYSYELKIDGNALTPARTGTLNYN-AQGELTNAAALENINVNQTIQGKNVSFDFDL 272

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           SK T      +   S  +G      KDF+V+  GY+ + Y DGT +P+ +L +AT  + D
Sbjct: 273 SKMTNYETEQVFSPSS-DGKGAATVKDFAVTDAGYIAVSYSDGTIIPVAQLGVATFSNVD 331

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L       Y P   SGD   G  G N  G I   +LE +NVD++ E   L+  Q  +  
Sbjct: 332 GLVKNGNGEYTPGLSSGDPVFGVAGQNGAGGISGASLEGSNVDLSQEFVNLMTYQSGFQG 391

Query: 402 NSKVFQTGSDFMDILISL 419
           N+KV +   D M  +++L
Sbjct: 392 NTKVIRVADDVMKQIVNL 409


>gi|153831673|ref|ZP_01984340.1| flagellar hook protein FlgE [Vibrio harveyi HY01]
 gi|269960116|ref|ZP_06174492.1| Flagellar hook protein flgE [Vibrio harveyi 1DA3]
 gi|148872183|gb|EDL71000.1| flagellar hook protein FlgE [Vibrio harveyi HY01]
 gi|269835087|gb|EEZ89170.1| Flagellar hook protein flgE [Vibrio harveyi 1DA3]
          Length = 399

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 188/424 (44%), Gaps = 41/424 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TRAG F  +   F+    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDHMGQMLYTRAGVFGTDKNNFVTANNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT----PDKT 180
            GY + N +A L   S   +  I V  + L+A  T       N D +AT +     P  +
Sbjct: 117 QGYSVDN-NANLQTGS---VGDIKVSTSSLNAKATDNLDFVANFDASATAVDQAVYPFDS 172

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N  ++ YT K     YD+LG+S     Y+TKT D +W+V++   D +     P   A
Sbjct: 173 SDPNSFNSSYTTK----VYDSLGNSHTVTQYFTKTSDNEWQVNV-EVDGA-----PTTPA 222

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFN-------DNTSGIDQQITIDISKTTQLAGGFIP 293
              TV+ + D   G LA+ +    SFN        N   ID    I ++ +TQ    F  
Sbjct: 223 TAQTVQFNTD---GTLASPTG---SFNVAFPAAGANAMSID----ISLNGSTQFGAAFGV 272

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
             +  NG+  G+     V  +G V   Y +G      ++ +A   +   L    G  +  
Sbjct: 273 STNNPNGYTSGELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANTQGLSKVSGTAWTQ 332

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           +  SG   +G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T     
Sbjct: 333 SFSSGAPIMGVPGTGTLGDLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTNDKLT 392

Query: 414 DILI 417
             L 
Sbjct: 393 QALF 396


>gi|302037613|ref|YP_003797935.1| flagellar hook protein FlgE [Candidatus Nitrospira defluvii]
 gi|300605677|emb|CBK42010.1| Flagellar hook protein FlgE [Candidatus Nitrospira defluvii]
          Length = 407

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 121/427 (28%), Positives = 197/427 (46%), Gaps = 26/427 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-- 58
           MGIL SM TA++G+ +  N +  + +NIANV T G+K +   FS L+  S      S   
Sbjct: 1   MGILTSMFTAVTGLSSYGNAMGVIGNNIANVGTAGFKSSRATFSDLISSSLGGGSGSDQI 60

Query: 59  GLEISTKDMIS--EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
           GL +   D+ +   QGS+  T +  DLAI G GF++V+     N  +RAG F +++ G +
Sbjct: 61  GLGVFLNDVQTNFSQGSMTTTGNTFDLAIDGNGFYLVRNTSGANFYSRAGQFKVDSLGQV 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
            + +G +L GY         I ++  G   I +  + +  + TT+  I  NL+ NAT  T
Sbjct: 121 VDSSGALLQGYQADTNGN--ITSTIGG---ITLTSSAVPPVATTSAEILGNLNANATAPT 175

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
              +         Y   +    YD+LG+S    +Y+ KT    W V  + Q         
Sbjct: 176 AAFSITDT---TSYNFSTGMTFYDSLGNSHQMQLYFRKTAANAWGV--YSQIDGG----- 225

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL--AGGFIPQ 294
              A      ++F+      A  +    +   N +   Q +T+D+S  TQ   A G   Q
Sbjct: 226 ---AAAAQTNMTFNASGAVTAGGTQTVTATLTNGATTPQAMTVDLSSLTQFGAASGVASQ 282

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
             +  G++ G     SV K+G V   + +G    + ++ ++   + D L     N +L T
Sbjct: 283 TQD--GYSSGTLDRISVDKEGRVMAQFTNGETRALAQVVLSRFTNPDGLVNVGDNHFLET 340

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SG    G P  N  G + SG +E +NVD+  E  ++I  QR +  NS+   T  + + 
Sbjct: 341 VESGAALAGAPTINGLGRVLSGTVEQSNVDLGKEFVDMIITQRAFQANSRAITTSDEMLQ 400

Query: 415 ILISLKR 421
            L++LKR
Sbjct: 401 ELVNLKR 407


>gi|167579488|ref|ZP_02372362.1| flagellar hook protein FlgE [Burkholderia thailandensis TXDOH]
          Length = 413

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 115/428 (26%), Positives = 194/428 (45%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVLTYSRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N+ Q    + ++    +  PT T  IS   + N+    P  TP +
Sbjct: 123 MGYQADKNG----VINTAQ---TVPLQAPTNNIAPTATTKISGQFNLNSQDTVPTNTPFN 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                 Y  +++   YD+LG S   ++Y+ K+    WE     ++Q+          P +
Sbjct: 176 YADSTTYNFQTAVQVYDSLGGSQQVNMYFVKSAAGTWEAYAGVKNQT----------PTD 225

Query: 244 TVEVSFDPV----TGYLANSSHKAISF--------NDNTSGIDQQITIDISKTTQLAGGF 291
              V+FD      +  L  S+    +         N + S   Q + +D++ TTQ  G  
Sbjct: 226 LGTVTFDTSGAIKSTTLPGSTTPTTTLGQFQFTIPNTDGSATPQALKLDLTGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    FS+  DG V   Y +G    + ++ +A   + + L     N Y
Sbjct: 286 GVTNLAQDGFASGTLTTFSIGNDGKVTGNYSNGQTATLGQIVLANFNNPNGLVNVGNNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T  SG   I  PG   HG +   ALE +NVD+ S+L  LI AQRNY  N++  +T   
Sbjct: 346 VETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQTIKTQQT 405

Query: 412 FMDILISL 419
               LI+L
Sbjct: 406 VDQTLINL 413


>gi|146294550|ref|YP_001184974.1| flagellar hook protein FlgE [Shewanella putrefaciens CN-32]
 gi|145566240|gb|ABP77175.1| flagellar basal body FlaE domain protein [Shewanella putrefaciens
           CN-32]
          Length = 395

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 117/417 (28%), Positives = 190/417 (45%), Gaps = 31/417 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  T G++     F+S+      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANASTNGFRGGRSEFASIY-----NGGQAGGVSVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S+ GSL +T    D+ IQG+GFF++KG D      RAG FH +++GF+ +  G  L
Sbjct: 57  TQNFSKGGSLTYTGRQLDMGIQGEGFFVLKGTDGGAMYARAGMFHKDSQGFITDPVGSRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + NA+  +   +   L+   V+ A L+A  TT   + +NLD     IT    PK  
Sbjct: 117 QGYSV-NATGKIQQGNVGDLQ---VQTASLAAKATTQVGLVSNLDARVDPITVAFDPK-- 170

Query: 185 GRDAEYTHK-SSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
             D    H   + + YD+LG+  V   YY KT   +W V+             Y +  + 
Sbjct: 171 --DINSYHSIGTTSVYDSLGAEHVVTQYYVKTAPNEWTVN-------------YTLDGVQ 215

Query: 244 TVE---VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
             E   ++FD        ++ +A          + Q  I+  K+TQ A  +       +G
Sbjct: 216 LTEQTTLTFDAKGVLDPTTTKQAFDLTLPNGASNLQFEINFDKSTQYAAKYNNSSLSQDG 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +  G+ K   +  +G +   Y +G      ++ +A   + + L     N ++ T  +G  
Sbjct: 276 YTSGELKGVRLDDNGMLYGTYTNGQEQLQGQVILANFSNPNGLSAVSNNAWVATNTAGQA 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
             G P     G +  G LE +NVD  +E+  L+ AQRNY  N+KV    S     L+
Sbjct: 336 ITGAPSTGTMGTVTGGYLEGSNVDTTAEMVNLMSAQRNYQSNAKVLDVNSTMQQALL 392


>gi|315179626|gb|ADT86540.1| flagellar hook protein E [Vibrio furnissii NCTC 11218]
          Length = 398

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 192/412 (46%), Gaps = 36/412 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFSAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDSMGQTLYTRSGVFGTDKDNYVVGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPT-TTGFISN---NLDKNATIITPDKT 180
            GY + + +  L+  S   +  I +  + LSA  T +  F++N   + D     + P   
Sbjct: 117 QGYSV-DGNNNLLSGS---VGDIKISTSSLSAKATDSLEFVANFNASADAIDQTVYPFDP 172

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N  ++ YT K    AYD+LG+S     Y+TKT D  WEV++     +T ++      
Sbjct: 173 ADPNSFNSSYTSK----AYDSLGNSHTVTQYFTKTADNTWEVNVQVDGAATASA------ 222

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDN--TSGIDQQITIDISKT--TQLAGGFIPQKS 296
              TV V+F+   G L   S    SFN     +G +  ++ID+S T  TQ    F    +
Sbjct: 223 ---TVPVTFN-TDGTL---SSPTGSFNVAFPAAGANA-MSIDVSLTGSTQFGADFGVSTN 274

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+  G+     V  +G V   Y +G      ++ +A   +   L    G  +  +  
Sbjct: 275 NPNGYTSGELAGVRVEGNGMVYATYTNGESQLQGQVVLANFANPQGLAKVSGTAWTQSFS 334

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           SG  ++G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T
Sbjct: 335 SGSPTVGVPGTGTLGDLTPGALEGSNVDLTSELVSLMTAQRNYQANAKTIST 386


>gi|221636048|ref|YP_002523924.1| flagellar hook protein FlgE [Thermomicrobium roseum DSM 5159]
 gi|221157294|gb|ACM06412.1| flagellar hook protein FlgE [Thermomicrobium roseum DSM 5159]
          Length = 423

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 136/443 (30%), Positives = 208/443 (46%), Gaps = 44/443 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSG 58
           ++ SM +A+SG+ A    +  + +NIANV+T G+K   + F    S LV  ++  +   G
Sbjct: 1   MMRSMFSAISGLRAHQTWMDVIGNNIANVNTTGFKVGRVRFTDILSQLVRGASGPTETRG 60

Query: 59  GLE---------ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDF 108
           G+          +   D I  QG+L  T   +DLAIQG GFF+V   D    L TR G F
Sbjct: 61  GINPLQIGLGAVVGAVDTIHTQGALQLTGKPSDLAIQGDGFFVVS--DGSQTLYTRDGAF 118

Query: 109 HINNEGFLENVAGGV-LLGYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISN 166
            I ++  L N + G  +LG+    A A   V++   +  I +    +L A+PTT   +  
Sbjct: 119 DIGSDLRLVNPSNGFYVLGW---QADANGNVDTAGPVGPITIPIGQQLDAVPTTQITVQG 175

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           NL+ N     P  TP        +  K S    D+LG    + + + K G   W  ++  
Sbjct: 176 NLNANQD---PAATP-------HFVTKVSIT--DSLGKRHEFYILFDKVGTNTWNYTLQE 223

Query: 227 QDQSTNNS------FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI- 279
            D  T ++      F     P  T+    D     LA S+  A+   D+T+G    IT+ 
Sbjct: 224 DDPRTTSTTEDDPDFALGGTPSGTLVFDADGNLD-LAASNISAVDL-DSTAGGASSITVT 281

Query: 280 -DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
            D S+ TQLA  +    +     A      F+VS+ G V  IY +G    + ++A+A   
Sbjct: 282 PDFSRLTQLAAPYSANAAANGAPAG-SLTTFTVSQSGQVLGIYSNGVTKVVGQIALALFT 340

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           +   L    GN YLPT +SG+  +G       G+I SG LE +NVD+A E T +I AQR 
Sbjct: 341 NPGGLMKVGGNAYLPTVNSGEPIVGPADSGGRGKIASGYLEMSNVDLAQEFTSMIMAQRG 400

Query: 399 YAVNSKVFQTGSDFMDILISLKR 421
           +  NS+V  T  + +  L++L+R
Sbjct: 401 FQANSRVITTSDEVLQELVNLRR 423


>gi|310659037|ref|YP_003936758.1| flagellar hook protein [Clostridium sticklandii DSM 519]
 gi|308825815|emb|CBH21853.1| flagellar hook protein [Clostridium sticklandii]
          Length = 418

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 121/437 (27%), Positives = 203/437 (46%), Gaps = 37/437 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPS-------- 50
           ++ SM +A+S +     R+  + +NIANV+T+GYK + + F    S ++  +        
Sbjct: 1   MMRSMNSAVSALRNHQLRMDVIGNNIANVNTIGYKSSRVTFKDSLSQMLRGASGPDASRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNCLTRAGD 107
            T+   V  G+++S+ D +   G    T    D+ + G+GFF+V   G DN    TRAG+
Sbjct: 61  GTNPQQVGLGMDLSSIDTLFTTGVPDRTDRGLDVMVNGEGFFMVSADGTDNGMYYTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISN 166
           F I+ +G L N  G  +LGY  K   A  + N   G   I V  A+ +  + TT   +  
Sbjct: 121 FDIDEDGNLVNADGLRVLGY--KTDDAGNVGNEVGG---IVVPLADSIPPIATTNVVMEG 175

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           NLD  A ++T   TP    R  E T        D+LG+S    + +TKT    W V+   
Sbjct: 176 NLDARA-VLTGSTTPPTIERQTEIT------VNDSLGTSHKIRLEFTKTAANTWNVTPTP 228

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT--IDISKT 284
                + +          V ++F+P TG L  +S K ++     +     +T  +D+S  
Sbjct: 229 ITTPPSPAG-------TPVSIAFEPSTGKLTAASVKTLNMTLTPTNGASPVTFDVDLSAL 281

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           TQ            +G   G    +++ + G V+ ++ +G    + ++A +   +   L 
Sbjct: 282 TQYGTDSSALMRSQDGSPVGVLTSYAIGQKGEVEGVFSNGRTKILGQVATSIFANPAGLV 341

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
              GN Y  + +SGD  +  PG   +G +  GALE +NVD+  E T +I  QR +  NS+
Sbjct: 342 KMGGNLYRSSANSGDPQVNKPGTGGNGGLQPGALEMSNVDLGKEFTNMIVTQRGFQANSR 401

Query: 405 VFQTGSDFMDILISLKR 421
           +  T    ++ L++LKR
Sbjct: 402 IISTTDQMLEELVNLKR 418


>gi|217959237|ref|YP_002337785.1| flagellar hook protein FlgE [Bacillus cereus AH187]
 gi|229138454|ref|ZP_04267043.1| Flagellar hook protein flgE [Bacillus cereus BDRD-ST26]
 gi|217065278|gb|ACJ79528.1| flagellar hook protein [Bacillus cereus AH187]
 gi|228644991|gb|EEL01234.1| Flagellar hook protein flgE [Bacillus cereus BDRD-ST26]
          Length = 407

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 107/432 (24%), Positives = 197/432 (45%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDDRYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYTDGTITLTGGKTQAAMEGNGFFVVGDSKAGNMEFTRKGTFT 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP  +++  + ++   G  ++ +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPADSSTGNVDLSGIPGPLQVPMGSA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  IT +                    YD  G++    V + + G+  ++  ++ ++ 
Sbjct: 180 ADAKQITQE-----------------LPVYDNAGNTWTMRVEFKQDGEHNYKYKVYMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +  +N       EV FD V      +    I FN  T      + ID SK T    
Sbjct: 223 SKKET-AFNEVDGAGGEVKFDAVGKPNPVNPEANIPFNGGT------VKIDFSKLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 EKTLAVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKTGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++   A E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILAMGVSGQNGAGKVRGSAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKIS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|126441055|ref|YP_001057322.1| flagellar hook protein FlgE [Burkholderia pseudomallei 668]
 gi|126220548|gb|ABN84054.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 668]
          Length = 413

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 120/437 (27%), Positives = 195/437 (44%), Gaps = 52/437 (11%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+A  ++N+      + ++    +  PT T  I+   + N+    P  TP + 
Sbjct: 123 MGYA---ANANGVINT---AATVPLQAPTTNIAPTATTKITGQFNLNSQDAVPATTPFNY 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIFRQDQS------------- 230
                Y + +S   +DTLG S   ++Y+ K+    +WE       Q+             
Sbjct: 177 TDPTSYNYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGQTPTDLGSVKFSTAG 236

Query: 231 --TNNSFPYNVAPLNTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
             T  S P  V   N  + SF  P T   AN                Q +T+D++ TTQ 
Sbjct: 237 TITGTSTPAGVPTTNVGQFSFSIPTTTGAAN---------------PQNLTLDLTGTTQY 281

Query: 288 AGGFIPQKSEIN-----GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
            G     K+ IN     G A G    FS+  DG V   Y +G    + ++ +A   + + 
Sbjct: 282 GG-----KNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNG 336

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L     N Y+ +  SG   I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N
Sbjct: 337 LVNVGNNQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQAN 396

Query: 403 SKVFQTGSDFMDILISL 419
           ++  +T       LI+L
Sbjct: 397 AQTIKTQQTVDQTLINL 413


>gi|149927798|ref|ZP_01916049.1| flagellar hook protein E [Limnobacter sp. MED105]
 gi|149823420|gb|EDM82651.1| flagellar hook protein E [Limnobacter sp. MED105]
          Length = 437

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 118/440 (26%), Positives = 190/440 (43%), Gaps = 33/440 (7%)

Query: 5   GSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIST 64
           GS +  +SG++A    +  +++N++N   VG+K +   FS +   + + +  + G+ + T
Sbjct: 7   GSFQQGLSGLNAAQRGLEVIANNVSNASVVGFKGSEAEFSDVFARAFNGARSTNGIGLGT 66

Query: 65  KDMIS----EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
                    +QG++  T +  DLAI G GFF V+  +  N  TR G F +NNEG + N  
Sbjct: 67  SLAAVTQNFKQGNINVTGNPLDLAISGTGFFKVQAGNGDNIYTRNGQFTLNNEGVIVNSR 126

Query: 121 GGVLLGYPLKNASA-PLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L G+P+  A+  P  V      + I V    +    T +  +  NLD  AT I P  
Sbjct: 127 GDKLQGFPVDAATGRPSDV-----AQDILVPRGSIPPAATRSANLELNLDARATAIDPAL 181

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ------------ 227
                  +  + + +S   YD LG + +  +Y  K     W  S+F              
Sbjct: 182 AFDPANLNT-FNNSTSMTVYDELGGAHIMAIYMRKEASNDW--SVFATVDGTQVDVGTAP 238

Query: 228 -------DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID 280
                   QST+ +  Y V  L T   S +         +   + F+ +T     Q T D
Sbjct: 239 VAVTTAPAQSTSANLQYGVDGLLTTPNSGNLTVDMSRFVTASGVPFS-STGTAPNQFTFD 297

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
           +S TTQ    F+ Q    +G        F V  DG + I Y +G  V   ++ +   P+ 
Sbjct: 298 MSNTTQYGSSFVVQNLGQDGFESSPFAGFDVGADGMLTISYANGQLVNHAQIGLYRFPNP 357

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
           + L+    N +L T  SG   +        G I SGALE +N+D+ +EL  +I AQR Y 
Sbjct: 358 EGLQPVGSNGWLATNSSGPELVSLSEDTAFGIIQSGALEESNIDLTAELVAMISAQRVYQ 417

Query: 401 VNSKVFQTGSDFMDILISLK 420
            NS+  +T       + +L+
Sbjct: 418 ANSQTIKTQDSIFQTITNLR 437


>gi|42780846|ref|NP_978093.1| flagellar hook protein FlgE [Bacillus cereus ATCC 10987]
 gi|42736766|gb|AAS40701.1| flagellar hook protein FlgE, putative [Bacillus cereus ATCC 10987]
          Length = 407

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 107/432 (24%), Positives = 197/432 (45%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDDRYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYTDGTITLTGGKTQAAMEGNGFFVVGDSKAGNMEFTRKGTFT 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   ++  + ++   G  ++ +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPADPSTGNVDLSGIPGPLQVPMGSA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  IT +                    YD  G++    V + + G+  ++  ++ +++
Sbjct: 180 ADAKQITQE-----------------LPVYDNAGNTWTMRVEFKQDGEHNYKYKVYMRNE 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +  +N       EV FD V      +    I FN  T      + ID SK T    
Sbjct: 223 SKKET-AFNEVNGAGGEVKFDAVGKPDPVNPEANIPFNGGT------VKIDFSKLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 EKTLAVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKTGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++   A E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILAMGVSGQNGAGKVRGSAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKIS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|238752866|ref|ZP_04614331.1| Lateral flagellar hook protein (FlgE-like) [Yersinia rohdei ATCC
           43380]
 gi|238708905|gb|EEQ01158.1| Lateral flagellar hook protein (FlgE-like) [Yersinia rohdei ATCC
           43380]
          Length = 411

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 193/425 (45%), Gaps = 27/425 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A +G+ A + ++S +S+NIAN  T G+K +   F+S+   S        G+  S  
Sbjct: 2   SFSIANTGLSAVTEQLSTISNNIANSATKGFKASRTEFASMYAQSQPLGVAVSGVSQS-- 59

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             I++ GS+  T +  DLAI G GFF+VK  +     TRAG F  +  G L N +G  L 
Sbjct: 60  --INKDGSIDRTGNAMDLAIAGNGFFVVKNSNGDEAYTRAGMFTSDKSGMLVNGSGMKLQ 117

Query: 126 GYPLKNASAPLIVNSFQGL-ERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP+  A      N   G+   + V  A L A  +T      NL   A +  P      +
Sbjct: 118 GYPVDAAG-----NIQTGIISDLKVSTAGLPAKASTQIDFMANLPAGAAV--PLAAFDKS 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWE---------VSIFRQDQSTNNSF 235
             D+ Y + S    YD+LG       Y+ K                VS +    + +   
Sbjct: 171 NPDS-YNNMSMSTVYDSLGREHAVAQYFVKNAPPPPPGPLAPPAPIVSEWTVYTAIDGVI 229

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQ 294
           P N  P +T+   FD V+G L   ++ AIS    + G     I +D + TTQ    F+P 
Sbjct: 230 PAN-NPSHTLV--FD-VSGVLTLGNNMAISGGYGSPGAAPYSIDVDYAGTTQFDSNFLPT 285

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
            ++ +G+  G      +  DG V   + +G R+   RL +A   + + L   +G T+  T
Sbjct: 286 TNKSDGYTSGSKNGERIENDGSVYATFSNGERMLQGRLVLANFANPNGLAAQNGTTWSAT 345

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   +G  G    G I +GALE +NVD+ +EL  L+ AQRNY  N+K+  T    M+
Sbjct: 346 SKSGAALLGEAGSGMLGSIEAGALEASNVDLTAELVGLMTAQRNYQANTKIISTNDSMMN 405

Query: 415 ILISL 419
            L  +
Sbjct: 406 ALFQV 410


>gi|219684598|ref|ZP_03539541.1| flagellar hook protein FlgE [Borrelia garinii PBr]
 gi|219671960|gb|EED29014.1| flagellar hook protein FlgE [Borrelia garinii PBr]
          Length = 442

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 113/449 (25%), Positives = 208/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDSRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   II    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPIIEEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTIGFDNEGAL----ASLNGQPGQKGDVLQIPITFNVVGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  +Y +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGVYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|34497159|ref|NP_901374.1| flagellar hook protein flgE [Chromobacterium violaceum ATCC 12472]
 gi|34103016|gb|AAQ59379.1| flagellar hook protein flgE [Chromobacterium violaceum ATCC 12472]
          Length = 393

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 182/412 (44%), Gaps = 23/412 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A+SG++A +N++ +VSDNIAN  T G+K   + F+S    + + S   G       
Sbjct: 2   SFEIALSGINAVNNQLGSVSDNIANSGTYGFKSGRVTFAS----AYAGSQAMGVNANPNS 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             I   G L++T    D AI G+GF++ +        +R G F  + +G+L +  GG + 
Sbjct: 58  QNIGRNGGLVNTGRALDAAIDGRGFYVSRSVAGAVSYSRVGIFDTDKDGYLVDNYGGRVQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY      A         L  I +    ++A P+     S N+     + T    P   G
Sbjct: 118 GYAQSEGGA------LGALGDIQIPTGNIAAKPSDQLKYSGNMSAGWAVQT---VPFDKG 168

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               + H +    YD+LG+      Y+ K+ D    V     D+         + P  T 
Sbjct: 169 VSQSFNHSTVSPVYDSLGNKHNLTQYFCKSADSTITVHYQLDDK---------MLPA-TT 218

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ FD        ++   +           ++ +D S TTQ AG     ++  NG+ PG 
Sbjct: 219 DLKFDTAGKMTQPTAAVDLDLGTPAGANALKVAVDYSGTTQFAGEPSTVRNAANGYPPGA 278

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
               S+ ++G V + Y +  +  + RLAIA   ++  L      ++  +  SG   +   
Sbjct: 279 RTGVSLGENGEVIVSYSNDQKQVVARLAIANFANQGALTAASQTSWQESSASGPALLSPA 338

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G N  G++ + +LE +NVD+ SEL  L+ AQRNY  N+KV  T +  M  L+
Sbjct: 339 GSNMAGKLVTSSLEQSNVDVTSELVSLMTAQRNYQANTKVISTENQVMQALM 390


>gi|146281771|ref|YP_001171924.1| flagellar hook protein FlgE [Pseudomonas stutzeri A1501]
 gi|145569976|gb|ABP79082.1| flagellar hook protein FlgE [Pseudomonas stutzeri A1501]
          Length = 438

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 125/445 (28%), Positives = 210/445 (47%), Gaps = 46/445 (10%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL----VFPSTSNSYVSGGLEISTK 65
           A+SG++A S  ++   +NIANV T G+K +   F+ L    +  S  N+  SG   ++T 
Sbjct: 6   ALSGLNAASTDLNVTGNNIANVGTTGFKASRAEFADLYATSMLGSGGNAVGSG---VTTA 62

Query: 66  DMISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
           D+  +  QG++ +T ++ DLAI G G+F+V    ++   TRAG F  ++EG++ N  G  
Sbjct: 63  DIAQQFTQGNITNTGNSLDLAISGNGYFMVSNNGSM-LYTRAGAFKTDDEGYVINSEGYN 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY + NA+  ++     G+   N+K    +  P  T  +   L  N+    P+ TP  
Sbjct: 122 LQGYGV-NANGDIV----SGV-TTNLKVDSSNQAPNATSSVVETLALNSNSSVPNNTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW--------------------EVS 223
               + Y   +S   YDT G+S     Y+ K    +W                    EVS
Sbjct: 176 ASDSSTYNWSTSVPLYDTQGNSHTMTQYFVKDDSNQWTMYTLIDGRNPADPTSTEAYEVS 235

Query: 224 I-FRQ----DQSTNNSFPYNVAPLNTVEV-SFDPVTGYLANSSHKAISFNDNTSGIDQQ- 276
           I F      D ++  S  ++V    T+ + ++ P T  + +S+   +++  N +      
Sbjct: 236 IGFTASGALDLTSLASTDFDVNADGTLTLNTWVPAT--VTDSTTSPVTWGSNGAAASASG 293

Query: 277 ITIDISKTTQLAGGFIPQKSEI-NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
           I+ID+   +Q    F    S + +G+  G+    S+   G +   Y +G    I ++ +A
Sbjct: 294 ISIDLRNISQTNTSFAVLSSPVQDGYTTGQLSGLSIDDTGMMFATYTNGQSKVIGQVVLA 353

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
              +   L    G  +  T  SG+ +IG PG    G + SGALE +NVD+ ++L  LI A
Sbjct: 354 NFTNSQGLASVGGTAWAQTLASGEPAIGTPGSGTLGSLQSGALEDSNVDLTAQLVNLIVA 413

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QRNY  N+K  +T S     +I+L+
Sbjct: 414 QRNYQANAKTVETESAIAQTIINLR 438


>gi|125972995|ref|YP_001036905.1| protein of unknown function DUF1078-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|256004792|ref|ZP_05429767.1| protein of unknown function DUF1078 domain protein [Clostridium
           thermocellum DSM 2360]
 gi|281417206|ref|ZP_06248226.1| fagellar hook-basal body protein [Clostridium thermocellum JW20]
 gi|125713220|gb|ABN51712.1| protein of unknown function DUF1078-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|255991242|gb|EEU01349.1| protein of unknown function DUF1078 domain protein [Clostridium
           thermocellum DSM 2360]
 gi|281408608|gb|EFB38866.1| fagellar hook-basal body protein [Clostridium thermocellum JW20]
 gi|316940769|gb|ADU74803.1| flagellar hook-basal body protein [Clostridium thermocellum DSM
           1313]
          Length = 440

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 125/451 (27%), Positives = 212/451 (47%), Gaps = 43/451 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF-----------PST 51
           ++ SM + +SG+ A   ++  + +N+ANV+TVG+K + + F   VF           P+T
Sbjct: 1   MMRSMFSGVSGLQAHQTKMDVIGNNVANVNTVGFKSSRVTFQE-VFSQTLKGASSPDPTT 59

Query: 52  SNS-----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRA 105
                    V  GL ++T D +  +GS+  T + TDLAI+G GFFIVKG   +    TRA
Sbjct: 60  GRGGTNPMQVGLGLGVATIDTLMTRGSVQRTDNPTDLAIEGDGFFIVKGGSSDTFKFTRA 119

Query: 106 GDFHINNEGFLENVAGGVLLG-----------YPLKNASAPLIVNSFQGLERINVKHAEL 154
           G+F I+  G L   +G  + G           Y     S    +N +   + +N     +
Sbjct: 120 GNFGIDRLGNLVTGSGLNVYGWQSYTKLPDGTYKFDTESQIEPINLYS--DDVNKNKRMI 177

Query: 155 SAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK 214
           +A  TT      NLD + +I     +   +G  +          YD+LG+S   ++ + K
Sbjct: 178 AAKATTYAIFEGNLDASYSI----YSSAASGTSSNNRFTMPVTVYDSLGNSYKINISFWK 233

Query: 215 TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSS-HKAISFNDNTSGI 273
           T D    V+ +     + N    + A   T  + FD     + +S+   +I+   ++S  
Sbjct: 234 T-DVTGGVTTWTWQVDSGNGVTASGA---TGTILFDDQGQVIESSAVTPSITIIPDSSVG 289

Query: 274 DQQITI--DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
            Q I +  D S+ T  A     + + ++G+  G    FS+  DG +  IY +G + P+  
Sbjct: 290 SQNINVKLDFSRLTMYAADSSAKATNVDGYPAGSLVTFSIGSDGMIMGIYSNGQQQPLGL 349

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF-PGHNQHGEIFSGALETANVDIASELT 390
           +A+A+  +   L+    N Y+PT +SG+   G   G    G +  G LE +NVD++ E T
Sbjct: 350 IALASFDNPAGLEKVGENMYIPTSNSGEFKKGVKAGTEGVGTLSPGTLEMSNVDLSKEFT 409

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E+I  QR +  NS++  T  + +  L++LKR
Sbjct: 410 EMIITQRGFQANSRIITTSDEMLQELVNLKR 440


>gi|323492338|ref|ZP_08097491.1| flagellar hook protein FlgE [Vibrio brasiliensis LMG 20546]
 gi|323313385|gb|EGA66496.1| flagellar hook protein FlgE [Vibrio brasiliensis LMG 20546]
          Length = 398

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 181/419 (43%), Gaps = 32/419 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+ S 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFAAVY-----NGMQPGGVEVASI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFFI K        TR+G F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVSGTGRAMDLAINGSGFFITKDTSGQLLYTRSGVFGTDKDNYVTGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L   S      I +  + L+A  T +     NLD +A+++     P   
Sbjct: 117 QGYSVDGNNNLLTGAS----GDIKISTSSLAAKATDSMEFVANLDASASVVDQTVNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   +D+LG+S     Y+TKT    WEV++     ST         P +T
Sbjct: 173 NNTDSFNSSYTTKVFDSLGNSHTVTQYFTKTAANSWEVNVQVDGGST---------PAST 223

Query: 245 VEVSFDPVTGYLA------NSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
           V ++F+   G LA      N +  A   N         I I+++ +TQ    F    +  
Sbjct: 224 VAMTFN-ADGTLATPTGSYNVAFPAAGANP------MSIDINLAGSTQFGASFGVSTNNP 276

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+  G+     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG
Sbjct: 277 NGYTSGELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANPQGLAKVSGTAWTQSFSSG 336

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
              +G PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L 
Sbjct: 337 APIMGVPGSGTLGDLTPGALEGSNVDLTSELVNLMTAQRNYQANAKTISTNDKLTQALF 395


>gi|254440385|ref|ZP_05053879.1| conserved domain protein [Octadecabacter antarcticus 307]
 gi|198255831|gb|EDY80145.1| conserved domain protein [Octadecabacter antarcticus 307]
          Length = 432

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 125/450 (27%), Positives = 208/450 (46%), Gaps = 47/450 (10%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S   +++G+ + ++R++ +SDNIAN  T GYKR    F S+V       Y +GG+
Sbjct: 1   MTISSSFNASVAGLASNASRLATISDNIANSSTYGYKRVVADFHSMVVDGGKGKYTAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC---------LTRAGDFHIN 111
            ++T+ +I E+G L+ T++ TDLA++G+G   V  R +V+          L   G F  +
Sbjct: 61  GVTTQRLIDERGPLVATSNATDLAVRGRGMLPVTERSSVSVGSESDFSLRLATTGSFRTD 120

Query: 112 NEGFLENVAGGVLLGYPL-KNASAP-LIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            EG+L    G +LLG+P   + S P L  ++  GLE I +   +  + PTT   ++ NL 
Sbjct: 121 AEGYLTTTNGLLLLGWPSNADGSLPNLPRDTIGGLEPIRIDTNQFISDPTTNVELAVNLP 180

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
             AT    +     +  +    +  +    +TL  S   +V  T     +W  ++F +D 
Sbjct: 181 ATAT----EAGASGDTEELLVEYIDNLGIAETLTVSFAPNVPATG-ATNEW--TMFVEDS 233

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI------------DQQI 277
           ++          +    + FD + G       + +S N+ T G                I
Sbjct: 234 ASGTI-------IGEYTIEFDDLAGL----GGRLLSVNNTTGGAYTADGTVSVTTDSGTI 282

Query: 278 TIDISKT------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
            IDI         TQL+  F P     NG   G      V  +G+V  ++D+G    +Y+
Sbjct: 283 EIDIGNIGEPGGLTQLSDNFAPVSIIKNGSPVGTMTSVEVDANGFVRALFDNGVSRIMYQ 342

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + +  V + + L   D  +Y  T +SG   +   G    G+I S A E +  D+A+ELT 
Sbjct: 343 VPLVDVSNPNGLISEDNQSYSVTPESGQFFLWDAGDGPTGDIVSFAREESATDVAAELTN 402

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           LI+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 403 LIKTQRAYSSNAKVIQTVDEMLQETTNIKR 432


>gi|291613038|ref|YP_003523195.1| fagellar hook-basal body protein [Sideroxydans lithotrophicus ES-1]
 gi|291583150|gb|ADE10808.1| fagellar hook-basal body protein [Sideroxydans lithotrophicus ES-1]
          Length = 405

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 190/419 (45%), Gaps = 21/419 (5%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGG-----LE 61
            +  +SG++A S  +  + +N+AN  TVG+K++   F+ +   S + S  SGG       
Sbjct: 3   FQQGLSGLNAASKSLDVIGNNVANASTVGFKQSQAQFADVYASSMAGS--SGGQAGIGTR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           ++T      QG++  T ++ D+A+ G GFF +    ++   +R G F ++  GF+ N  G
Sbjct: 61  VATVAQQFTQGNITTTNNSLDMAVSGSGFFRMDNNGSI-TFSRNGQFQLDKNGFIVNSQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L G+ L NA+  ++  +      I V  A+L  +P  T  ++  L+ +A    P   P
Sbjct: 120 YKLTGF-LPNAAGAIVATT---PADIQVSTADL--LPKATANVTAGLNLDARSTVPAIAP 173

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A + + +S   YD+LG   V  +Y+ KT    W   +      T +        
Sbjct: 174 FDPNNPATFNNSTSSTIYDSLGGPHVASLYFVKTATNAWSSYL------TVDGTQVGAGA 227

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
           L  +  S   V    A +   A +F     G  Q ++I+ S T+Q    F       +G+
Sbjct: 228 LTAMTFSSSGVLTAPAGAVTSA-AFTPAGGGAAQTLSINFSGTSQFGSTFGVNSLSQDGY 286

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G    FS   DG V   Y +G    + ++ +A   +   L+    N ++ T  SG   
Sbjct: 287 TSGHMTGFSTGSDGIVTGRYSNGQTKTLAQVVLANFSNAQGLQPLGNNQWVETSTSGTPL 346

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + + A+E +NVD+ +EL  +I AQR Y  N++  +T    +  +++L+
Sbjct: 347 VGAPGSASLGVLQTSAVEDSNVDLTAELVNMITAQRVYQANAQTIKTQDQVLQTIVNLR 405


>gi|53717914|ref|YP_106900.1| flagellar hook protein FlgE [Burkholderia pseudomallei K96243]
 gi|53724565|ref|YP_104798.1| flagellar hook protein FlgE [Burkholderia mallei ATCC 23344]
 gi|67641538|ref|ZP_00440315.1| flagellar hook protein FlgE [Burkholderia mallei GB8 horse 4]
 gi|76810959|ref|YP_331879.1| flagellar hook protein FlgE [Burkholderia pseudomallei 1710b]
 gi|121599135|ref|YP_994291.1| flagellar hook protein FlgE [Burkholderia mallei SAVP1]
 gi|124384593|ref|YP_001028060.1| flagellar hook protein FlgE [Burkholderia mallei NCTC 10229]
 gi|126449658|ref|YP_001082867.1| flagellar hook protein FlgE [Burkholderia mallei NCTC 10247]
 gi|126453793|ref|YP_001064564.1| flagellar hook protein FlgE [Burkholderia pseudomallei 1106a]
 gi|167001537|ref|ZP_02267332.1| flagellar hook protein FlgE [Burkholderia mallei PRL-20]
 gi|167717660|ref|ZP_02400896.1| flagellar hook protein FlgE [Burkholderia pseudomallei DM98]
 gi|167736703|ref|ZP_02409477.1| flagellar hook protein FlgE [Burkholderia pseudomallei 14]
 gi|167813802|ref|ZP_02445482.1| flagellar hook protein FlgE [Burkholderia pseudomallei 91]
 gi|167822318|ref|ZP_02453789.1| flagellar hook protein FlgE [Burkholderia pseudomallei 9]
 gi|167843908|ref|ZP_02469416.1| flagellar hook protein FlgE [Burkholderia pseudomallei B7210]
 gi|167892410|ref|ZP_02479812.1| flagellar hook protein FlgE [Burkholderia pseudomallei 7894]
 gi|167900908|ref|ZP_02488113.1| flagellar hook protein FlgE [Burkholderia pseudomallei NCTC 13177]
 gi|167909127|ref|ZP_02496218.1| flagellar hook protein FlgE [Burkholderia pseudomallei 112]
 gi|167917164|ref|ZP_02504255.1| flagellar hook protein FlgE [Burkholderia pseudomallei BCC215]
 gi|217424944|ref|ZP_03456440.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 576]
 gi|226199793|ref|ZP_03795344.1| flagellar basal body protein FlaE [Burkholderia pseudomallei
           Pakistan 9]
 gi|242315744|ref|ZP_04814760.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1106b]
 gi|254182140|ref|ZP_04888737.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1655]
 gi|254188070|ref|ZP_04894582.1| flagellar basal body protein FlaE [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254196353|ref|ZP_04902777.1| flagellar basal body protein FlaE [Burkholderia pseudomallei S13]
 gi|254201896|ref|ZP_04908260.1| flagellar hook protein FlgE [Burkholderia mallei FMH]
 gi|254207230|ref|ZP_04913581.1| flagellar hook protein FlgE [Burkholderia mallei JHU]
 gi|254259636|ref|ZP_04950690.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1710a]
 gi|254295814|ref|ZP_04963271.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 406e]
 gi|254359732|ref|ZP_04976003.1| flagellar hook protein FlgE [Burkholderia mallei 2002721280]
 gi|52208328|emb|CAH34261.1| putative flagellar hook protein [Burkholderia pseudomallei K96243]
 gi|52427988|gb|AAU48581.1| flagellar hook protein FlgE [Burkholderia mallei ATCC 23344]
 gi|76580412|gb|ABA49887.1| Flagella basal body rod protein [Burkholderia pseudomallei 1710b]
 gi|121227945|gb|ABM50463.1| flagellar hook protein FlgE [Burkholderia mallei SAVP1]
 gi|124292613|gb|ABN01882.1| flagellar hook protein FlgE [Burkholderia mallei NCTC 10229]
 gi|126227435|gb|ABN90975.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1106a]
 gi|126242528|gb|ABO05621.1| flagellar hook protein FlgE [Burkholderia mallei NCTC 10247]
 gi|147747790|gb|EDK54866.1| flagellar hook protein FlgE [Burkholderia mallei FMH]
 gi|147752772|gb|EDK59838.1| flagellar hook protein FlgE [Burkholderia mallei JHU]
 gi|148028946|gb|EDK86878.1| flagellar hook protein FlgE [Burkholderia mallei 2002721280]
 gi|157805870|gb|EDO83040.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 406e]
 gi|157935750|gb|EDO91420.1| flagellar basal body protein FlaE [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169653096|gb|EDS85789.1| flagellar basal body protein FlaE [Burkholderia pseudomallei S13]
 gi|184212678|gb|EDU09721.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1655]
 gi|217391964|gb|EEC31990.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 576]
 gi|225928144|gb|EEH24180.1| flagellar basal body protein FlaE [Burkholderia pseudomallei
           Pakistan 9]
 gi|238522489|gb|EEP85933.1| flagellar hook protein FlgE [Burkholderia mallei GB8 horse 4]
 gi|242138983|gb|EES25385.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1106b]
 gi|243062738|gb|EES44924.1| flagellar hook protein FlgE [Burkholderia mallei PRL-20]
 gi|254218325|gb|EET07709.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 1710a]
          Length = 413

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 120/437 (27%), Positives = 194/437 (44%), Gaps = 52/437 (11%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+A  ++N+      + ++    +  PT T  I+   + N+    P  TP + 
Sbjct: 123 MGYA---ANANGVINT---AATVPLQAPTTNIAPTATTKITGQFNLNSQDAVPATTPFNY 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWE---------------VSIFRQD 228
                Y + +S   +DTLG S   ++Y+ K+    +WE               V      
Sbjct: 177 TDPTSYNYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGKTPTDLGSVKFSTAG 236

Query: 229 QSTNNSFPYNVAPLNTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
             T  S P  V   N  + SF  P T   AN                Q +T+D++ TTQ 
Sbjct: 237 TITGTSTPAGVPTTNVGQFSFSIPTTTGAAN---------------PQNLTLDLTGTTQY 281

Query: 288 AGGFIPQKSEIN-----GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
            G     K+ IN     G A G    FS+  DG V   Y +G    + ++ +A   + + 
Sbjct: 282 GG-----KNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNG 336

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L     N Y+ +  SG   I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N
Sbjct: 337 LVNVGNNQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQAN 396

Query: 403 SKVFQTGSDFMDILISL 419
           ++  +T       LI+L
Sbjct: 397 AQTIKTQQTVDQTLINL 413


>gi|229195966|ref|ZP_04322719.1| Flagellar hook protein flgE [Bacillus cereus m1293]
 gi|228587525|gb|EEK45590.1| Flagellar hook protein flgE [Bacillus cereus m1293]
          Length = 407

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/432 (24%), Positives = 195/432 (45%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDDRYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYTDGTITLTGGKTQAAMEGNGFFVVGDSKAGNMEFTRKGTFT 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   ++  + +    G  ++ +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPADPSTGNVDLTGIPGPLQVPMGSA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  IT +                    YD  G++    V + + G+  ++  ++ ++ 
Sbjct: 180 ADAKQITQE-----------------LPVYDNAGNTWTMRVEFKQDGEHNYKYKVYMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +  +N       EV FD V      +    I FN  T      + ID SK T    
Sbjct: 223 SKKET-AFNEVDGAGGEVKFDAVGKPNPVNPEANIPFNGGT------VKIDFSKLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 EKTLAVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKTGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++   A E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILAMGVSGQNGAGKVRGSAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKIS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|320538206|ref|ZP_08038101.1| fagellar hook-basal body protein [Treponema phagedenis F0421]
 gi|320145023|gb|EFW36744.1| fagellar hook-basal body protein [Treponema phagedenis F0421]
          Length = 452

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 120/457 (26%), Positives = 208/457 (45%), Gaps = 54/457 (11%)

Query: 14  MDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-----NSYVSG--------GL 60
           M     R+  + +N+ANV+T G+KR  + F  L+    S     N  V G        G+
Sbjct: 1   MQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGASRPNEEVGGVNPKEVGLGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +++ D +  QG+L  T  NTD+AIQG GFFI+K  +  +  TRAG F ++ +G L N A
Sbjct: 61  MVASIDTVHTQGALQTTGINTDIAIQGNGFFILKDGEK-SFYTRAGAFGVDRDGTLVNPA 119

Query: 121 GGVLL-GYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNNLDKNATIITPD 178
            G+ + G+  ++     I+N+    E + +   + + A  TT    + NLDK      P+
Sbjct: 120 NGMRVQGWMAEDIEGQQIINTSDQTEDLIIPIGQKIDAKATTDVAYACNLDKRL----PE 175

Query: 179 KTPKHNGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKW--EVSIFRQDQS--- 230
                N  D    T  + F  YDT G      + +++    + +W   V++  ++Q+   
Sbjct: 176 LPEGANQADILRSTWATDFNVYDTFGEQHKLQMVFSRVPGTNNQWLATVNVDPENQAGTE 235

Query: 231 TNNSFPYNVAPLNTVEVSFD-----------------PVTGYLANSSHKAISFNDNTSGI 273
           T           NT  VSFD                 P    L  +S+  +  N +  G 
Sbjct: 236 TRVGIGTTDGTENTFIVSFDNYGHLASVTDTAGNVTAPAGQVLVQASYNVVGANPDEGGA 295

Query: 274 DQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG 324
             + T +I+           TQ A     +  + +G+A G  ++F + + G +  +Y +G
Sbjct: 296 PTRHTFNINLGEIGTSRNTITQFAERSTTKAYQQDGYAMGYLENFKIDQSGIITGVYSNG 355

Query: 325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVD 384
               I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++ +G LE +NVD
Sbjct: 356 ASREIGQLALAGFANQGGLEKAGENTYIQSNNSGIANITVSGVMGKGKLIAGTLEMSNVD 415

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +  + T++I  QR +   +K  QT    ++ +++LKR
Sbjct: 416 LTDQFTDMIITQRGFQAGAKTIQTSDTMLETVLNLKR 452


>gi|89072315|ref|ZP_01158894.1| flagellar hook protein [Photobacterium sp. SKA34]
 gi|89051847|gb|EAR57299.1| flagellar hook protein [Photobacterium sp. SKA34]
          Length = 398

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 121/412 (29%), Positives = 189/412 (45%), Gaps = 36/412 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIST- 64
           S   A+SG+DA + +++ +S+NIANV T G+K +   FS++      N   +GG+E++  
Sbjct: 2   SFDIALSGLDATNIQLNTISNNIANVSTSGFKESRTEFSAVY-----NGMQAGGVEVAAI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F  + +  + +  G  L
Sbjct: 57  SQNFDKTGSITGTGRPLDLAISGSGFFVTKDLTGQTLYTRSGVFGSDKDNNIVSNNGAKL 116

Query: 125 LGYPL---KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
            GY +    N  A  + N       + +  A L A  T       NLD  +++I P   P
Sbjct: 117 QGYTVDANNNLQAGAVGN-------LKITTASLPAKATDELAFVANLDARSSVIDPAINP 169

Query: 182 -KHNGRDA---EYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
              N  D+    YT K     YD+LG+      Y+TKT   +W+V++     +T      
Sbjct: 170 FDPNATDSFNSSYTSK----VYDSLGNPHTVTQYFTKTNANEWQVNVVVDGAAT------ 219

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKS 296
              P  T  V F+      + ++  A++F    +G D   I IDI+ TTQ    F    +
Sbjct: 220 ---PTQTQNVVFNTDGTLQSPTAPFAVNFIP--AGADAANINIDIAGTTQFGANFGVSTN 274

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+  G+     V  +G V   Y +G      ++ +A   +   L   +G +++ +  
Sbjct: 275 APNGYTSGELAGVRVEDNGMVFAAYTNGQSQLQGQVMLADFANPQGLVKTNGTSWIQSFS 334

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           SG    G P     G + +GALE +NVD+ SEL  L+ AQRNY  N+K   T
Sbjct: 335 SGAPVNGAPSTGTLGGLVAGALEGSNVDLTSELVSLMTAQRNYQANAKTIST 386


>gi|229058387|ref|ZP_04196771.1| Flagellar hook protein flgE [Bacillus cereus AH603]
 gi|228719896|gb|EEL71486.1| Flagellar hook protein flgE [Bacillus cereus AH603]
          Length = 407

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 109/433 (25%), Positives = 192/433 (44%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKADDKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKLSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFA 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANAATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
            +A  I  +                    YD  G++    V +T+T +  +   +  R D
Sbjct: 180 ADAKAIAQE-----------------IPVYDNAGNTWTMRVEFTQTSEHNYSYKVQMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                +F     P     ++FD V           I FN         I +D+S+ T   
Sbjct: 223 SKKATTF--EDVPGAGGNMTFDAVGNPSPKEQSANIPFNGG------NIKLDLSQLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  + ++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 275 TDKTLSVTGVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G+I  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNYTATNTTGILALGASGQNGAGKIRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKI 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|120597305|ref|YP_961879.1| flagellar hook protein FlgE [Shewanella sp. W3-18-1]
 gi|120557398|gb|ABM23325.1| flagellar basal body FlaE domain protein [Shewanella sp. W3-18-1]
          Length = 395

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 116/417 (27%), Positives = 189/417 (45%), Gaps = 31/417 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  T G++     F+S+      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANASTNGFRGGRSEFASIY-----NGGQAGGVSVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S+ GSL +T    D+ IQG+GFF++KG D      RAG FH +++GF+ +  G  L
Sbjct: 57  TQNFSKGGSLTYTGRQLDMGIQGEGFFVLKGTDGGAMYARAGMFHKDSQGFITDPVGSRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + NA+  +   +   L+   V+ A L+A  TT   + +NLD     I     PK  
Sbjct: 117 QGYSV-NATGKIQQGNVGDLQ---VQTASLAAKATTQVGLVSNLDARVDPIAVAFDPK-- 170

Query: 185 GRDAEYTHK-SSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
             D    H   + + YD+LG+  V   YY KT   +W V+             Y +  + 
Sbjct: 171 --DINSYHSIGTTSVYDSLGAEHVVTQYYVKTAPNEWTVN-------------YTLDGVQ 215

Query: 244 TVE---VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
             E   ++FD        ++ +A          + Q  I+  K+TQ A  +       +G
Sbjct: 216 LTEQTTLTFDAKGVLDPTTTKQAFDLTLPNGASNLQFEINFDKSTQYAAKYNNSSLSQDG 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +  G+ K   +  +G +   Y +G      ++ +A   + + L     N ++ T  +G  
Sbjct: 276 YTSGELKGVRLDDNGMLYGTYTNGQEQLQGQVILANFSNPNGLSAVSNNAWVATNTAGQA 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
             G P     G +  G LE +NVD  +E+  L+ AQRNY  N+KV    S     L+
Sbjct: 336 ITGAPSTGTMGTVTGGYLEGSNVDTTAEMVNLMSAQRNYQSNAKVLDVNSTMQQALL 392


>gi|254175270|ref|ZP_04881931.1| flagellar hook protein FlgE [Burkholderia mallei ATCC 10399]
 gi|160696315|gb|EDP86285.1| flagellar hook protein FlgE [Burkholderia mallei ATCC 10399]
          Length = 413

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 120/437 (27%), Positives = 194/437 (44%), Gaps = 52/437 (11%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVTTYSRDGMFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+A  ++N+      + ++    +  PT T  I+   + N+    P  TP + 
Sbjct: 123 MGYA---ANANGVINT---AATVPLQAPTTNIAPTATTKITGQFNLNSQDAVPATTPFNY 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWE---------------VSIFRQD 228
                Y + +S   +DTLG S   ++Y+ K+    +WE               V      
Sbjct: 177 TDPTSYNYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGKTPTDLGSVKFSTAG 236

Query: 229 QSTNNSFPYNVAPLNTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
             T  S P  V   N  + SF  P T   AN                Q +T+D++ TTQ 
Sbjct: 237 TITGTSTPAGVPTTNVGQFSFSIPTTTGAAN---------------PQNLTLDLTGTTQY 281

Query: 288 AGGFIPQKSEIN-----GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
            G     K+ IN     G A G    FS+  DG V   Y +G    + ++ +A   + + 
Sbjct: 282 GG-----KNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNG 336

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L     N Y+ +  SG   I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N
Sbjct: 337 LVNVGNNQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQAN 396

Query: 403 SKVFQTGSDFMDILISL 419
           ++  +T       LI+L
Sbjct: 397 AQTIKTQQTVDQTLINL 413


>gi|89075495|ref|ZP_01161906.1| flagellar hook protein [Photobacterium sp. SKA34]
 gi|89048767|gb|EAR54338.1| flagellar hook protein [Photobacterium sp. SKA34]
          Length = 467

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 130/478 (27%), Positives = 205/478 (42%), Gaps = 75/478 (15%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSGGLE 61
           SM  A+SG+ A    ++  S+NIAN +T G+K +   F    S+ +F S + +   GG++
Sbjct: 2   SMNIALSGLGAAQKDLNTTSNNIANANTFGFKESRAEFGDVYSNSIF-SNAKTTTGGGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV---NCLTRAGDFHINNEGFLEN 118
            ST      +GS ++T +  DL + G GFF V    N    N LTR G FH+NNE  L N
Sbjct: 61  TSTVAQQFHEGSSIYTNNPLDLRVSGSGFFAVADNKNEPANNNLTRNGAFHLNNENELVN 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  LLGYP+   S     N+    E  ++K  ++   PT +G I  +L+    +   +
Sbjct: 121 SEGKFLLGYPVNKDS-----NTVASYEAKSMKIDDVFGQPTKSGTIKVSLN----LPNKE 171

Query: 179 KTPKHNGRDAE----YTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--------WEV---- 222
             PK N  D +    +   +S   YD+LG       YY    D          WEV    
Sbjct: 172 TAPKSNSFDFKDPDSFNKSTSSTIYDSLGKPYKMTTYYVAKYDPNAVPTNANTWEVHQTV 231

Query: 223 ---------------SIFRQDQSTNNSFPYNVAPLNT-VEVSFD----PVTGYLANSSHK 262
                          SI    Q  +N+ P   AP+ T   + FD    P  G L + +  
Sbjct: 232 TNNSGEERLLKPDPASIPAAYQVIDNTDP--TAPVVTGYRMRFDQNGQPYPGDLGDPTAT 289

Query: 263 AISFNDN------------TSGID-------QQITIDISKTTQLAGGFIPQK-SEINGHA 302
                              ++GID       Q +T++    TQ A  F  +K  +++G  
Sbjct: 290 PPIPPTPASPLNIQMETFASAGIDVGGADPTQSLTMNYDDPTQYASAFEVRKFQDVDGAT 349

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G      +  +G +   Y +G  + + R+A+A V +E  L    G  +  T++SG    
Sbjct: 350 TGYLSKVDIDPEGNILASYSNGKDIVVGRVALARVSNEQGLAQLGGTLWNTTQESGQAIW 409

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G       G + SG LE +N+D+  EL +LI AQRN+  +S+     +     ++ ++
Sbjct: 410 GDASQGSFGSVKSGTLEQSNIDMTQELVDLITAQRNFQASSRALDVNNQLQQNILQIR 467


>gi|83719411|ref|YP_440801.1| flagellar hook protein FlgE [Burkholderia thailandensis E264]
 gi|167617585|ref|ZP_02386216.1| flagellar hook protein FlgE [Burkholderia thailandensis Bt4]
 gi|257140548|ref|ZP_05588810.1| flagellar hook protein FlgE [Burkholderia thailandensis E264]
 gi|83653236|gb|ABC37299.1| flagellar hook protein FlgE [Burkholderia thailandensis E264]
          Length = 413

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 114/428 (26%), Positives = 193/428 (45%), Gaps = 34/428 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVLTYSRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           +GY   KN     ++N  Q    + ++    +  PT T  I+   + N+    P  TP +
Sbjct: 123 MGYQADKNG----VINPAQ---TVPLQAPTNNIAPTATTKITGQFNLNSQDTVPTNTPFN 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                 Y  +++   YD+LG S   ++Y+ K+    WE     ++Q+          P +
Sbjct: 176 YTDSTTYNFQTAVQVYDSLGGSQQVNMYFVKSAAGTWEAYAGVKNQT----------PTD 225

Query: 244 TVEVSFDPV----TGYLANSSHKAISF--------NDNTSGIDQQITIDISKTTQLAGGF 291
              V+FD      +  L  S+    +         N + S   Q + +D++ TTQ  G  
Sbjct: 226 LGTVTFDTSGAIKSTTLPGSTTPTTTLGQFQFSIPNTDGSATPQALKLDLTGTTQYGGKD 285

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G    FS+  DG V   Y +G    + ++ +A   + + L     N Y
Sbjct: 286 GVTNLAQDGFASGTLTTFSIGNDGKVTGNYSNGQTATLGQIVLANFNNPNGLVNVGNNQY 345

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T  SG   I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N++  +T   
Sbjct: 346 VETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQANAQTIKTQQT 405

Query: 412 FMDILISL 419
               LI+L
Sbjct: 406 VDQTLINL 413


>gi|237810461|ref|YP_002894912.1| flagellar hook protein FlgE [Burkholderia pseudomallei MSHR346]
 gi|237503327|gb|ACQ95645.1| flagellar hook protein FlgE [Burkholderia pseudomallei MSHR346]
          Length = 413

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 120/437 (27%), Positives = 194/437 (44%), Gaps = 52/437 (11%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++
Sbjct: 4   QQGLSGLVGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L
Sbjct: 64  VQQQFSQGTITSSTSSLNVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNSQGLNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY    A+A  ++N+      + ++    +  PT T  I+   + N+    P  TP + 
Sbjct: 123 MGYA---ANANGVINT---AATVPLQAPTTNIAPTATTKITGQFNLNSQDAVPATTPFNY 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWE---------------VSIFRQD 228
                Y + +S   +DTLG S   ++Y+ K+    +WE               V      
Sbjct: 177 TDPTSYNYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGKTPTDLGSVKFSTAG 236

Query: 229 QSTNNSFPYNVAPLNTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
             T  S P  V   N  + SF  P T   AN                Q +T+D++ TTQ 
Sbjct: 237 TITGTSTPAGVPTTNVGQFSFSIPTTTGAAN---------------PQNLTLDLTGTTQY 281

Query: 288 AGGFIPQKSEIN-----GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
            G     K+ IN     G A G    FS+  DG V   Y +G    + ++ +A   + + 
Sbjct: 282 GG-----KNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNG 336

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L     N Y+ +  SG   I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N
Sbjct: 337 LVNVGNNQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQAN 396

Query: 403 SKVFQTGSDFMDILISL 419
           ++  +T       LI+L
Sbjct: 397 AQTIKTQQTVDQTLINL 413


>gi|114320057|ref|YP_741740.1| flagellar basal body FlaE domain-containing protein
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226451|gb|ABI56250.1| flagellar basal body FlaE domain protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 430

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 117/450 (26%), Positives = 204/450 (45%), Gaps = 56/450 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-----GL 60
           S  T+++G++A  + ++   DNIAN  T G+K +   F+ L   ++SN  V+G     G+
Sbjct: 2   SFGTSLTGLNAAQSELNITGDNIANSSTWGFKESRPEFADLF--ASSNLGVTGLAIGQGV 59

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +        QG    T ++ DL I GKGFF +    ++   TR+G F ++ EG++ N A
Sbjct: 60  RLQNVGQQFSQGQFDFTENSLDLGISGKGFFRLSDDGDI-SYTRSGAFQLDREGWITNSA 118

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI------ 174
           G  L G+   +    ++ +   G + + V+   ++   TT   I  NL+  A I      
Sbjct: 119 GKRLTGFA-ADGDGNIVGD---GQQELRVETGNVAPEATTEARIQANLNAGAEIPPAYTL 174

Query: 175 --------------ITPDKTPKHNG-----RD-AEYTHKSSFAAYDTLGSSVVYDVYYTK 214
                         + PD+     G     RD A +   +S   +D+LG     + Y+ K
Sbjct: 175 DADDRLADFDQLEWVGPDENNPVPGAVFDPRDTATFNESTSTTFFDSLGRQHTANFYFIK 234

Query: 215 TGDKKWEVSIFRQDQSTNNSFPYNVA--PLNTVE--VSFDPVTGYLANSSHKAISFNDNT 270
             D  W V      +  NN  P  ++  P   +E   +FD  T  LA++           
Sbjct: 235 GNDNDWYVHTEVDGEVLNNGQPQPISFGPNGLIEGNATFD-YTRALADAE---------- 283

Query: 271 SGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
              D    +D+   TQ    F       +G A G+     VS+DG +   + +G    + 
Sbjct: 284 ---DLDFELDLESLTQFGTPFAVSDITQDGFAAGEFSSLDVSEDGTIFARFTNGQSEVLG 340

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           R+ +   PS++NL+      ++ T ++G+  +G  G +  G I SGALE +NVDI+ +L 
Sbjct: 341 RVGVTKFPSQENLQPVGDTEWVATFEAGEPVVGTAGTSDFGSIESGALEQSNVDISEQLV 400

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ++I AQRN++ N+K+  T       +++++
Sbjct: 401 KMIVAQRNFSANAKMISTEDQITQEILNIR 430


>gi|224533123|ref|ZP_03673723.1| flagellar hook protein FlgE [Borrelia burgdorferi WI91-23]
 gi|224511850|gb|EEF82251.1| flagellar hook protein FlgE [Borrelia burgdorferi WI91-23]
 gi|312149691|gb|ADQ29762.1| flagellar hook protein FlgE [Borrelia burgdorferi N40]
          Length = 442

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 208/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|302389667|ref|YP_003825488.1| fagellar hook-basal body protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200295|gb|ADL07865.1| fagellar hook-basal body protein [Thermosediminibacter oceani DSM
           16646]
          Length = 404

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 117/435 (26%), Positives = 198/435 (45%), Gaps = 47/435 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + ++G+     ++  + +NIANV+TVGYK++ + F   +  +            
Sbjct: 1   MMRSMFSGVTGLRNHQIKMDVIGNNIANVNTVGYKKSRVTFQDTLSQTMRGASSAQGNRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I+  D I    SL  T + TDLAI+G GFFI+         TRAG+F 
Sbjct: 61  GTNPMQIGLGMTIAAIDTIHTPTSLEATGNMTDLAIEGDGFFILSDGQGY-YYTRAGNFG 119

Query: 110 INNEGFLENVAGGV-LLGYPLKNASAPLIVNSFQGLERINVKHAEL-SAMPTTTGFISNN 167
            + +G L N A G  ++G+   ++  P      Q ++ IN++   L  A PT     + N
Sbjct: 120 FDEQGNLVNTANGFKVMGWQDSSSKTP------QDIKPINIQKGMLMPAKPTDIVVFAKN 173

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+K   ++T                   F  YD+LG +    + +T  GD  W+  I   
Sbjct: 174 LNKADQVVT-----------------IPFKVYDSLGRAHNLTITFTNNGDNTWDYDI--- 213

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQ 286
             S + +     +  +T  ++FDP       S+  +++      G +    T D S  TQ
Sbjct: 214 --SFDPTLISVSSGSDTGTLAFDPNGNLSGGSTINSVTLT--IVGANPITFTPDFSNVTQ 269

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            A       S  NG+  G     SV   G +  ++D+G  + + ++A+A   +   L   
Sbjct: 270 YAKETTVDLSYQNGYPAGTLLGISVDSTGTITGVFDNGQTMELAQVALAVFNNPAGLMKA 329

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N Y  + +SG+  IG  G    G I  G+LE +NVD+A E T++I  QR +  NS+V 
Sbjct: 330 GRNMYTYSNNSGEPQIGLAGTGGRGTISPGSLEMSNVDLAEEFTQMIITQRGFQANSRVI 389

Query: 407 QTGSDFMDILISLKR 421
               + +  L+++KR
Sbjct: 390 TASDEMLQELVNIKR 404


>gi|195941363|ref|ZP_03086745.1| flagellar hook protein FlgE [Borrelia burgdorferi 80a]
 gi|221217779|ref|ZP_03589247.1| flagellar hook protein FlgE [Borrelia burgdorferi 72a]
 gi|224533707|ref|ZP_03674295.1| flagellar hook protein FlgE [Borrelia burgdorferi CA-11.2a]
 gi|225549062|ref|ZP_03770037.1| flagellar hook protein FlgE [Borrelia burgdorferi 94a]
 gi|225550122|ref|ZP_03771082.1| flagellar hook protein FlgE [Borrelia burgdorferi 118a]
 gi|226320584|ref|ZP_03796144.1| flagellar hook protein FlgE [Borrelia burgdorferi 29805]
 gi|221192456|gb|EEE18675.1| flagellar hook protein FlgE [Borrelia burgdorferi 72a]
 gi|224513000|gb|EEF83363.1| flagellar hook protein FlgE [Borrelia burgdorferi CA-11.2a]
 gi|225369234|gb|EEG98687.1| flagellar hook protein FlgE [Borrelia burgdorferi 118a]
 gi|225370288|gb|EEG99726.1| flagellar hook protein FlgE [Borrelia burgdorferi 94a]
 gi|226234003|gb|EEH32724.1| flagellar hook protein FlgE [Borrelia burgdorferi 29805]
          Length = 442

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 208/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|146296289|ref|YP_001180060.1| hypothetical protein Csac_1266 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409865|gb|ABP66869.1| protein of unknown function DUF1078 domain protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 484

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 136/498 (27%), Positives = 221/498 (44%), Gaps = 93/498 (18%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----------- 51
           ++ SM ++++ + A   R+  + DNIANV+TVG+K + + F+S VF S            
Sbjct: 1   MMRSMFSSITSLRAHQTRMDVIGDNIANVNTVGFKSSRVTFAS-VFASVIKAASAPDTTS 59

Query: 52  ----SNSYVSG-GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAG 106
               SN    G G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG
Sbjct: 60  GRGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGRAPRFTRAG 119

Query: 107 DFHINNEGFLENVAGGVLLGY---PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF 163
           +F ++  G L    G  +LG+   P+ N      +++ +   +IN+  A  +  P  T  
Sbjct: 120 NFSLDKMGNLVTANGLNVLGWMADPVNNQ-----IDTTKSPSKINI-LAYPTLAPKATDK 173

Query: 164 ISNNLDKNATIITPDKTPKHNGRDAEY----------THKSSFAAYDTLGSSVVYDVYYT 213
           IS   D N +      T  + G+ A+Y           +  SF  YD+ G      + + 
Sbjct: 174 IS--FDGNLSA----DTVAYTGQIAKYEDLLNVPADSKYSMSFKVYDSQGKEHTLQLIFV 227

Query: 214 KTGDKK--W--------------EVSIFRQDQ-STNNSFPYNVAP--------------L 242
           K G+ +  W              EV  +  D    NN++   +A                
Sbjct: 228 KNGNNQWEWFVDAPRVKKNIGTAEVYAYVDDMIDANNNYDEFIARGTITFGQAGKVFDDE 287

Query: 243 NTVEVSFDPVTG--------------YLANSSHKAISFNDNTSGID----QQITIDISKT 284
           NT  V    +TG              ++ N+ +  I+F  N+S  D      I   +   
Sbjct: 288 NTPNVEGIQITGGRVYDSANGTFTINFVGNAVNP-ITFKVNSSQFDVNDNTNIAFFLKNL 346

Query: 285 TQLAGGFIPQK-SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
           TQ        + +++ G++ G  + F++   G +  IY +G    I ++AIAT  +   L
Sbjct: 347 TQFGNMDSSIRVAQMTGYSAGSLQGFNIDATGKITGIYSNGLNQLIGQIAIATFANPAGL 406

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
           +    N Y+ T +SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N+
Sbjct: 407 QRIGDNLYINTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANA 466

Query: 404 KVFQTGSDFMDILISLKR 421
           +V     + +  L+++KR
Sbjct: 467 RVITASDELLQDLVNIKR 484


>gi|219685755|ref|ZP_03540566.1| flagellar hook protein FlgE [Borrelia garinii Far04]
 gi|219672694|gb|EED29722.1| flagellar hook protein FlgE [Borrelia garinii Far04]
          Length = 442

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 113/449 (25%), Positives = 207/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDSRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   II    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPIIEEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N     +Q T++
Sbjct: 237 INGEQNSNFTIGFDNEGAL----ASLNGQPGQKGDVLQIPITFNVVGANVGEAGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  +Y +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGVYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|229090715|ref|ZP_04221948.1| Flagellar hook protein FlgE [Bacillus cereus Rock3-42]
 gi|228692657|gb|EEL46383.1| Flagellar hook protein FlgE [Bacillus cereus Rock3-42]
          Length = 437

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 121/450 (26%), Positives = 199/450 (44%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYD---VYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    +          S   D   V   K G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTESETVDGKVVEKPKAGEYTYSVSV-R 234

Query: 227 QDQSTNNSF----------PY---NVAPLNTVE--VSFDPVTGYLANSSHKAISFNDNTS 271
            D      F          P    N+  L   +  V  DPVTG +       I F D   
Sbjct: 235 NDSKNEKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITKGGTITIPFGDG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|326389474|ref|ZP_08211041.1| fagellar hook-basal body protein [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994479|gb|EGD52904.1| fagellar hook-basal body protein [Thermoanaerobacter ethanolicus JW
           200]
          Length = 417

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 121/442 (27%), Positives = 205/442 (46%), Gaps = 48/442 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVS-NGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            ++ G L    G  +LG+   +      VN+  G L  I++K+ + +  + TT   I  N
Sbjct: 120 FDSNGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISLKNWSSIDPVATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+ +  I            DA+ ++  +   YD+ G S V  + +T+ G   W+  +   
Sbjct: 177 LNASTAI------------DADISY--NIVVYDSQGGSHVATITFTRKGANSWDWKVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT--------I 279
           D       P   +   T  ++FD       + S   I+    T  +D  +T        +
Sbjct: 223 D-------PAISSIDGTGTLTFDSEGKIAPDQSGNRIATGTLTFNMDSNMTNATIGPVSL 275

Query: 280 DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPS 339
           D+SK T  +     ++   NG+  G  +  ++ K G V  IY +G R  I ++AIA   +
Sbjct: 276 DLSKLTMFSSETDLRELSKNGNEAGSLESINIDKYGVVSGIYSNGRRQIIGQIAIADFQN 335

Query: 340 EDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNY 399
              L+      ++ T +SG+  IG  G    G I  G LE +NVD+++E  ++I  QR +
Sbjct: 336 PMGLEKIGNTMFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLSNEFADMIVTQRGF 395

Query: 400 AVNSKVFQTGSDFMDILISLKR 421
             N+KV     + +  L+++KR
Sbjct: 396 QANAKVITVSDEILQDLVNMKR 417


>gi|296103611|ref|YP_003613757.1| Flagellar basal body FlaE domain protein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295058070|gb|ADF62808.1| Flagellar basal body FlaE domain protein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 399

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 195/420 (46%), Gaps = 35/420 (8%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
            +SG+ A +  +  V +NIAN  TVG+K  +++F+ +   ST       G+  +  D   
Sbjct: 6   GLSGLSAAAKALDVVGNNIANSQTVGFKAGSVSFADIFAGSTGMGVQVAGVSQNFGD--- 62

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL-GYP 128
             G+LM+ AS  D+ I G+GFF +          R G F  +  GF+ N   G+ L GY 
Sbjct: 63  --GALMNGASALDMGISGRGFFRMVDEAGSVFYGRNGQFEQDQNGFIVNKTNGLFLTGYQ 120

Query: 129 LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDA 188
             +     ++N    +  I +   ++    +T G ++ NL  +  +I    TP  +  +A
Sbjct: 121 ATDG----VINPGAQVGPIRIPTDDMPPAASTKGSVAGNLKSDDKVIPA--TPAFDPDNA 174

Query: 189 E-YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEV 247
           + Y + S   A D+LG+     VYY  T + +W+        + +++ P      +   +
Sbjct: 175 DTYNYVSEVTATDSLGNKHAIKVYYVHTAEGEWKA------HAQDSTAPGAAGGWSEQTL 228

Query: 248 SFD-------PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            F        PVT  +  +++      + ++ +D  + ++I   TQ A     +  EI+G
Sbjct: 229 KFGTDGKLTAPVTLNIKGAAY------NGSAALDLNLDLNI---TQNASDTQVKLDEIDG 279

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            APGK   + VS  G V  IY +G R  + ++ +A   +   L+    N +  T  SG  
Sbjct: 280 QAPGKFNSYQVSDTGEVIAIYSNGKRQTVAQVVLADFANAGGLEQQGNNLWAETSQSGQP 339

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +G  G    G+I    LE++NV++  E+  +I  QRNY  NS+  +T S+ +  L++L+
Sbjct: 340 FLGTSGSGSFGDISGNMLESSNVNLGDEMVNMIVYQRNYQSNSQTIKTQSEVLQTLVNLR 399


>gi|187926954|ref|YP_001893299.1| flagellar basal body FlaE domain protein [Ralstonia pickettii 12J]
 gi|241665283|ref|YP_002983642.1| flagellar hook protein FlgE [Ralstonia pickettii 12D]
 gi|187728708|gb|ACD29872.1| flagellar basal body FlaE domain protein [Ralstonia pickettii 12J]
 gi|240867310|gb|ACS64970.1| protein of unknown function DUF1078 domain protein [Ralstonia
           pickettii 12D]
          Length = 402

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 116/420 (27%), Positives = 203/420 (48%), Gaps = 27/420 (6%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIS 63
            +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S    S++ V  G+E++
Sbjct: 3   FQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQVGQGVEVT 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                  QG++  T +  D+AI G GF+ +V         +R G F  +  G++ +  G 
Sbjct: 63  RVSQSFTQGNVTITGNPLDIAINGTGFYRMVDTASGQVSYSRNGQFQTDKNGYIISATGQ 122

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY + +      VN+   L  + +   +L+ + TT      NLD  AT  T      
Sbjct: 123 NLTGYGVDSTGK---VNTAV-LTNLQIPVNDLAPLATTNTAFGINLDAAATAPTTTPFSP 178

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
            N   A + H  S   YD  G++ +   YY +T    W+V  + Q    N   P    P+
Sbjct: 179 TN--SATFNHSVSEQVYDGTGTAHMLTNYYVRTA-TGWDV--YSQVDGNN---PTGGNPV 230

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF---IPQKSEIN 299
            T+  +F+      +  S  A+SF    +G+    ++D + TTQ  GG+    P  ++ +
Sbjct: 231 TTL--TFNSNGQLTSTPSKIAVSF----AGMSI-ASMDFTGTTQYGGGYNDTAPGVTQ-D 282

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A G+   +SV  DG +   Y +G    + ++A+A   + + L+   GN ++ T +SG 
Sbjct: 283 GYATGRLASYSVGTDGTITARYSNGRTATLGQIAMANFKAPEGLQNIGGNQWVETSNSGA 342

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            ++G PG    G + S A+E +NVD++ EL  +I AQR+Y  N++  +T    +  L+++
Sbjct: 343 PNLGTPGMGSFGLLQSSAVEQSNVDLSQELVNMIIAQRSYQANAQTIKTQDTILQTLVTM 402


>gi|117928057|ref|YP_872608.1| hypothetical protein Acel_0849 [Acidothermus cellulolyticus 11B]
 gi|117648520|gb|ABK52622.1| protein of unknown function DUF1078 domain protein [Acidothermus
           cellulolyticus 11B]
          Length = 398

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 115/436 (26%), Positives = 199/436 (45%), Gaps = 55/436 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSG 58
           +L S+ + +SG+ A    +  V +NIANV+TVG+K + + F    S ++  + +   V G
Sbjct: 1   MLRSLFSGVSGLRAHQTMLDVVGNNIANVNTVGFKASQVEFEDTLSQMLRAAGAPQGVQG 60

Query: 59  G---------LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
           G         ++I+       QG    T  +TDL IQG GFF++         TR G F 
Sbjct: 61  GTNPAQVGLGVQIAAISTTFTQGPAETTGVDTDLMIQGDGFFVLD-DGGQRVYTRNGAFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMP---TTTGFISN 166
            +  G L +  G ++ G+         +VN+   +  I +     ++MP   TTT  ++ 
Sbjct: 120 FDANGNLVSANGALVQGWLASGG----VVNTTGPVTAIKLPLG--TSMPPSATTTATLAG 173

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT-KTGDKKWEVSIF 225
           NL  + +      +P  N          +   YD  G +  Y + Y+  T    W++ I 
Sbjct: 174 NLPADGS-----GSPIDN----------NLTVYDAKGQATQYTLEYSYDTTSNSWKLDIL 218

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
                     P   +P N V +SFD  TG    ++ + ++         Q I++D+S  T
Sbjct: 219 P---------PGGGSPTN-VPLSFDSTTGQYNGTNPQTVTLGG------QNISLDLSGLT 262

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
              GG   +    +G A G    +++S DG +  ++ +G + P+ ++A+AT  +   L  
Sbjct: 263 AYGGGNTVEVVSSDGSAMGSLASYTISPDGTIQGVFTNGMKQPLAKIALATFNNPGGLTK 322

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              + Y  + +SG   IG  G    G++ +G LE +NVD++ E T LI A+R +  N+KV
Sbjct: 323 VGTSEYAESVNSGAAQIGASGTGSRGQLAAGELEGSNVDLSQEFTNLIIAERGFQANAKV 382

Query: 406 FQTGSDFMDILISLKR 421
             T    +  L++LK+
Sbjct: 383 ITTSDQVLQDLVNLKQ 398


>gi|15594628|ref|NP_212417.1| flagellar hook protein FlgE [Borrelia burgdorferi B31]
 gi|223889009|ref|ZP_03623600.1| flagellar hook protein FlgE [Borrelia burgdorferi 64b]
 gi|226321601|ref|ZP_03797127.1| flagellar hook protein FlgE [Borrelia burgdorferi Bol26]
 gi|2494528|sp|Q44767|FLGE_BORBU RecName: Full=Flagellar hook protein flgE
 gi|1165267|gb|AAA85606.1| FlgE [Borrelia burgdorferi]
 gi|2688183|gb|AAC66665.1| flagellar hook protein (flgE) [Borrelia burgdorferi B31]
 gi|223885825|gb|EEF56924.1| flagellar hook protein FlgE [Borrelia burgdorferi 64b]
 gi|226232790|gb|EEH31543.1| flagellar hook protein FlgE [Borrelia burgdorferi Bol26]
          Length = 442

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 207/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I     P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGANPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|271500066|ref|YP_003333091.1| fagellar hook-basal body protein [Dickeya dadantii Ech586]
 gi|270343621|gb|ACZ76386.1| fagellar hook-basal body protein [Dickeya dadantii Ech586]
          Length = 399

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 113/418 (27%), Positives = 198/418 (47%), Gaps = 23/418 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S+ +  + +NIAN  TVG+K + I+F+ +     + S V  G ++++ 
Sbjct: 2   SFSQAVSGLNAASSNLDVIGNNIANSATVGFKASNISFADMY----AGSNVGLGTKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS+ +T+   D+AI G GF+ +   +     +R G F +++   + N  G  L 
Sbjct: 58  LQDFGNGSINNTSRALDVAINGNGFYRLLDTNGSVVYSRNGQFTLDSSRNIVNSQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        +++    +SA  T+T  I  NL+      + D T   N 
Sbjct: 118 GYPAT--GTPPTIQQGASPVALSIPETTMSAKATSTASIIANLN------SSDSTNTWNA 169

Query: 186 RDAEYT--HKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
            D   T  +K S   YD+LG++  + +Y+ KT    W+V  + QD S + +       L 
Sbjct: 170 TDPTNTSNYKGSITTYDSLGNAHNFGLYFVKTAANSWDV--YAQDTSISGAGFQGPTTL- 226

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI-NGHA 302
               SF+  +G L  ++   IS            T+  + T Q   G    K+   +G+A
Sbjct: 227 ----SFNS-SGALTTTTPATISMATLNGSAASTFTLAFTGTVQQNSGSNSTKTPTQDGYA 281

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
           PG+   +S+S DG V   Y +     + ++A+A   + + L     N +  T +SG   +
Sbjct: 282 PGELTGYSISDDGTVVGSYSNSKTQVLGQIALANFANPEGLSPQGDNVWAATSNSGQAVV 341

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G  G    G++   A E++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 342 GLAGSGNLGKLVGKATESSNVDMSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 399


>gi|119477953|ref|ZP_01618053.1| flagellar hook protein [marine gamma proteobacterium HTCC2143]
 gi|119448866|gb|EAW30108.1| flagellar hook protein [marine gamma proteobacterium HTCC2143]
          Length = 429

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 122/441 (27%), Positives = 203/441 (46%), Gaps = 39/441 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG------G 59
           S  TA+SG+ A +  +    +NIAN  T+G+KR+   F  +     +NS VSG      G
Sbjct: 2   SFNTALSGLRAANTDLEVSGNNIANASTIGFKRSRAEFGDVY----ANSLVSGSNTTGSG 57

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
           + +++     +QG++  T ++ DLAI G GFF+V         TRAG F I++EG++ N 
Sbjct: 58  VLVNSISQQFDQGNISFTDNSLDLAINGTGFFVVAESSGATAYTRAGYFGIDDEGYITNN 117

Query: 120 AGGVLLGY-PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
           +G  L G+ P    S      +      + V+  +L+   T+   +  NLD       P 
Sbjct: 118 SGSTLQGFLPTGTGSGVGGTPA-----DLRVQSGDLAPSATSAVDLLFNLDARGD--APS 170

Query: 179 KTPKHNGRDAE-YTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQDQSTN---- 232
            +P  N  DA+ +   +S   +D+ G + V+  +Y KT  +  W +  +  D + N    
Sbjct: 171 ISP-FNPNDADTFNSSTSLTIFDSRGQAQVFSTFYEKTAVENVWNMHAYISDDAGNLQNV 229

Query: 233 ----------NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG---IDQQITI 279
                     N F       + +    +P TG   ++ +   S   +T+G   I    TI
Sbjct: 230 ISPAGGAGGANPFFQLTFGTDGLLTGTNP-TGLTIDNWNPQGSNQSSTNGSTAIASDFTI 288

Query: 280 DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPS 339
           +I  +TQ    F     + NG A GK     ++  G V   Y +G  + + ++A+A   +
Sbjct: 289 NIGPSTQFGSDFSVAAVDQNGFATGKLTGLEINTTGEVFARYTNGEALILGQVAMALFSN 348

Query: 340 EDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNY 399
           E  L       +  + +SG+  +G P     G I SGALE +NVD++ EL  LI AQRN+
Sbjct: 349 EQGLNPLGETGWAQSFESGEPVVGAPLTGNLGGIQSGALEESNVDLSEELVRLIIAQRNF 408

Query: 400 AVNSKVFQTGSDFMDILISLK 420
             N+K  +T       +I+++
Sbjct: 409 QANAKTIETADTVTQAIINIR 429


>gi|237653583|ref|YP_002889897.1| flagellar basal body FlaE domain protein [Thauera sp. MZ1T]
 gi|237624830|gb|ACR01520.1| flagellar basal body FlaE domain protein [Thauera sp. MZ1T]
          Length = 450

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 122/462 (26%), Positives = 205/462 (44%), Gaps = 60/462 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-----GL 60
           S +  +SG+   S  +  +S+N+AN +T+G+K  +  FS  VF ++    +SG     G 
Sbjct: 2   SFQQGLSGLSVSSKALDIISNNVANTNTIGFKTGSAIFSD-VFAASLTGSISGKQVGVGA 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +        QG+L  T +  DLAI G GFF+V   +  +  TR G F ++ EGF+    
Sbjct: 61  TLGAVRQTFTQGNLTTTNNPLDLAINGDGFFVVSRENGPDVYTRNGQFELDKEGFIRTPT 120

Query: 121 GGVLLGY--PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
           G  L G+  P+   + P  +    GL+ + V       MPT+   I  NLD N  +    
Sbjct: 121 GERLKGFQSPVTPGALPTPIG---GLKDVQVPIVGSQPMPTSRVEIGGNLDAN-DLSAAQ 176

Query: 179 KTPK-------------HNGRDAE-YTHKSSFAAYDTLGSSVVYDVYYTK---------- 214
           + P+              N +DA  Y   +S  AYD+LG S     Y+ K          
Sbjct: 177 RYPQLFGSTFTFPLPAGENWQDARTYNFSTSIKAYDSLGKSHELTYYFAKVTPTPNDPVN 236

Query: 215 TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVE-------VSFD-------PVTG-YLANS 259
           T +  W+V       S +  +P  V    ++E       ++F+       P+ G   AN 
Sbjct: 237 TNENTWKVFT-----SVDGGYPLGVGTDGSIEDPSVIWSLTFNEKGTVNTPIVGPTAANP 291

Query: 260 SHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                S+   T G D+ +  +D S   Q+ G ++  +   +G+  G+    SV +DG V 
Sbjct: 292 LAIPASY---TPGADRIRFHVDFSDMRQIGGSYLITELTQDGYTGGELAGVSVGRDGIVT 348

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
             Y +G    + +LA+ T  + + L     N +  T +SG  +    G    G + +G +
Sbjct: 349 GRYTNGETRELAQLALQTFRNPNALLSIGNNFWEATTESGLTAPSKAGEGVAGVVSAGMI 408

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           E ANV++ +EL ++I  QRNY  N++  +     +  L++L+
Sbjct: 409 EDANVELTNELVQMIVQQRNYQANAQSIKAQDQVLQTLVNLR 450


>gi|229189850|ref|ZP_04316861.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 10876]
 gi|228593658|gb|EEK51466.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 10876]
          Length = 437

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 116/463 (25%), Positives = 199/463 (42%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GSL  T+   + AI+GKG F+V  R++ N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSLTLTSDKMETAIEGKGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-------------- 215
           +N   ++ +                 F  +D  G+S+   V   +               
Sbjct: 180 RNQNALSHE-----------------FTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKP 222

Query: 216 --GDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFD---------------PVTGYLAN 258
             G+  + VS+ R D      F           + FD               PVTG +  
Sbjct: 223 VPGEYTYTVSV-RNDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDESVQKNPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F        + +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGTVKIPFG-------KGLTLDLSGLTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MTYSDGSMKVVGQLAVATFPNSGGLMKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD+++E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSAEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|322832564|ref|YP_004212591.1| flagellar hook-basal body protein [Rahnella sp. Y9602]
 gi|321167765|gb|ADW73464.1| flagellar hook-basal body protein [Rahnella sp. Y9602]
          Length = 414

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 111/428 (25%), Positives = 202/428 (47%), Gaps = 28/428 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+ A S  +  + +NIAN  TVG+K    +F+ +     + S    G++++  
Sbjct: 2   SFSQAVSGLSAASTNLDVIGNNIANSATVGFKTATASFADMF----AGSQTGMGVKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T+   D+A+ G GFF +         +R G F ++    L N+ G  + 
Sbjct: 58  TQNFNDGTTTNTSRGLDVALSGNGFFRLTDTSGAVYYSRNGQFSLDANRNLVNMQGLSVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           G+P    + P I    Q +  +N+    +SA  TT G +  NL+   T I   KT   + 
Sbjct: 118 GFP-ATGTPPTIAAGAQPVA-LNIPTTLMSAKATTVGTMVANLNSTDTAIPAAKTFSSS- 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            D  Y + +S   YD+ G++   +VY+ KT    W+V  + QD S   S    +  +   
Sbjct: 175 DDTSYNYVNSITTYDSQGNAHDNNVYFVKTSANNWDV--YAQDGSVTGSTAGKIGAMQ-- 230

Query: 246 EVSFDPVTGYLANSSHKA----------ISFNDNTSGI--DQQITIDISKTTQLAGGFIP 293
              FD  +G L ++++ A          +  N  T+G    Q +++D + + Q + G   
Sbjct: 231 ---FD-TSGALVSTTNAAGVANAGLALTLPMNTATNGTVTPQTVSLDFTGSIQQSTGSDS 286

Query: 294 QKSEI-NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
             S+  +G+A G+   ++++ DG +   Y +     + ++ ++   + + LK    N + 
Sbjct: 287 IGSQTQDGYAAGQMTGYTINDDGTISGTYSNNKTQLLGQIVLSNFSNPEGLKSEGDNVWT 346

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T  SG    G  G      + SGALE++NVD+++EL  +I AQRNY  N++  +T    
Sbjct: 347 ATASSGQAVTGIAGQGGLASMTSGALESSNVDLSAELVNMIVAQRNYQSNAQTIKTQDSI 406

Query: 413 MDILISLK 420
           ++ L++L+
Sbjct: 407 LNTLVNLR 414


>gi|242238969|ref|YP_002987150.1| flagellar hook protein FlgE [Dickeya dadantii Ech703]
 gi|242131026|gb|ACS85328.1| flagellar basal body FlaE domain protein [Dickeya dadantii Ech703]
          Length = 399

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 113/414 (27%), Positives = 203/414 (49%), Gaps = 23/414 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A S+ +  + +NIAN +T G+K  +++F+ +     ++S V  G+++++     
Sbjct: 6   AVSGLNAASSNLDVIGNNIANSETTGFKSASVSFADIY----ADSAVGLGVKVASVTQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G++  T   TD+AI   GFF V         TR G+F ++++  L    G  + GY  
Sbjct: 62  TDGTVESTDVGTDVAISKTGFFRVTDDSGSVYYTRNGEFTLDSDRNLVTKTGYYVTGYA- 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD--KNATIITPDKTPKHNGRD 187
              + P I +  Q    +N+  + ++A  T+T   S NLD  ++A   T D T       
Sbjct: 121 ATGTPPSIASGSQ-PTVLNISSSGMAASATSTASFSANLDSGEDAITTTFDATDS----- 174

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEV 247
           + Y    S   YD+LG+    ++Y+TKT D  WEV     D S +++   ++       +
Sbjct: 175 STYNWTQSLTTYDSLGNVHTVNLYFTKTADNTWEVHAL--DSSDSSATAQDLGA-----I 227

Query: 248 SFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL-AGGFIPQKSEINGHAPGKP 306
           SF   +G +  ++   IS N          +ID + TTQ  +   +  KS+ +G+  G  
Sbjct: 228 SF-STSGQITGTTSFNISTNSLNGSAANTFSIDFTGTTQQNSDSSVNTKSQ-DGYTAGSL 285

Query: 307 KDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPG 366
             ++++ DG +   Y +     + ++ +A+  +   L     N +  T  SG   +G  G
Sbjct: 286 TSYTINDDGTITGTYSNSQTQLLGQIVLASFSNPQGLSSQGDNVWSETSASGQALLGTAG 345

Query: 367 HNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
               G + SGALE++NVDI+ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 346 TGVFGTLTSGALESSNVDISQELVNMIVAQRNYQSNAQTIKTQDAILNTLVNLR 399


>gi|163939559|ref|YP_001644443.1| flagellar hook protein FlgE [Bacillus weihenstephanensis KBAB4]
 gi|163861756|gb|ABY42815.1| protein of unknown function DUF1078 domain protein [Bacillus
           weihenstephanensis KBAB4]
          Length = 407

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 109/433 (25%), Positives = 192/433 (44%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSQGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
                IT D                    YD  G++    V +T+T +  +   +  R D
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFTQTSEHNYTYKVQMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
              +  F     P     ++FD +           I F+  +      I +D+S  T   
Sbjct: 223 SKKDTKF--EDVPGAGGNMTFDAIGNPNPKEQGANIPFDGGS------IKLDLSHLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 275 TDKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G+I  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNYTATNTTGILALGASGQNGAGKIRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKI 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|153948570|ref|YP_001399634.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis IP 31758]
 gi|152960065|gb|ABS47526.1| flagellar hook protein flgE [Yersinia pseudotuberculosis IP 31758]
          Length = 402

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 116/417 (27%), Positives = 187/417 (44%), Gaps = 20/417 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A + ++A + +++ +S+NIAN  T G+K +   F+S+   S        G+  +  
Sbjct: 2   SFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFASMYAQSQPLGVTVSGVSQN-- 59

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             I + G    T    DLAI G GFF+V+        TRAG F  + +G+L N  G  L 
Sbjct: 60  --IGKDGQKDKTGMGLDLAISGGGFFVVRENSGDKAYTRAGMFRSDVDGYLVNGQGMKLQ 117

Query: 126 GYPLKNA---SAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
           GYP  +A    A +I +       + + +A + A  +T      NL+  AT+  P  T  
Sbjct: 118 GYPADDAGNIQAGIISD-------LKINNAGVPAKASTNLDFMANLEAGATV--PSVTTF 168

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           + G    Y   ++   YD+LG       Y+ K+       S      +  +S    VA  
Sbjct: 169 NAGDQNSYNFTTTSTVYDSLGREHAVAHYFIKSATT---TSAAPNQWTVRHSIDGTVATA 225

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +   + F      + +SS K     +     D  I ID + TTQL  GF   +++ +G+ 
Sbjct: 226 HHT-LQFTNTGALIPSSSAKLTGTFNPAGAADYDIDIDYTGTTQLNQGFTTTRNKSDGYT 284

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G      +  DG V   + +G R+   ++ +A   S   L   +G ++  +  SG   +
Sbjct: 285 SGVKNGERIESDGSVYATFSNGERMLQGKVVLANFASPSGLVTQNGTSWSESNKSGAALL 344

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           G PG    G + SGALE +NVDI +EL  L+ AQRNY  ++K+  T    M+ L  +
Sbjct: 345 GTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKIISTNDSMMNALFQV 401


>gi|126176156|ref|YP_001052305.1| flagellar hook protein FlgE [Shewanella baltica OS155]
 gi|304412508|ref|ZP_07394114.1| fagellar hook-basal body protein [Shewanella baltica OS183]
 gi|307307167|ref|ZP_07586905.1| fagellar hook-basal body protein [Shewanella baltica BA175]
 gi|125999361|gb|ABN63436.1| flagellar basal body FlaE domain protein [Shewanella baltica OS155]
 gi|304349150|gb|EFM13562.1| fagellar hook-basal body protein [Shewanella baltica OS183]
 gi|306910406|gb|EFN40837.1| fagellar hook-basal body protein [Shewanella baltica BA175]
          Length = 395

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 116/415 (27%), Positives = 189/415 (45%), Gaps = 27/415 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  T G++     F+S+      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANASTSGFRGGRSEFASIY-----NGGQAGGVGVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S+ GSL +T    D+ IQG+GFF++KG D      RAG FH ++EGF+ +  G  L
Sbjct: 57  SQNFSKGGSLTYTGRQLDMGIQGEGFFVLKGNDGGAMYARAGMFHKDSEGFITDPVGSRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + NA+  +   +   L+   V+ A L+A  TT   + +NLD     I     PK  
Sbjct: 117 QGYSV-NATGKIQQGNVGDLQ---VQTASLAAKATTKVGLVSNLDARVDPIAVAFDPK-- 170

Query: 185 GRDAEYTHK-SSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL- 242
             D    H   + + YD+LG+  V   YY KT   +W V+           +  +  PL 
Sbjct: 171 --DINTYHSIGTTSVYDSLGTEHVVTQYYVKTAPNEWTVN-----------YTLDGTPLP 217

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +   + FD        ++ +A          + +  I+  K+TQ A  +       +G+ 
Sbjct: 218 DKTTLKFDSKGILDPATTKQAFDLALPNGASNLKFDINFDKSTQYAAKYNNSSLSQDGYT 277

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+ K   +  +G +   Y +G      ++ +A   + + L     N ++ T  +G    
Sbjct: 278 SGELKGVRLDDNGMLYGTYTNGQDQLQGQVILANFSNPNGLSAVSNNAWVATNTAGQAIT 337

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G P     G +  G LE +NVD  +E+  L+ AQRNY  N+KV    S     L+
Sbjct: 338 GSPSTGTMGTVTGGYLEGSNVDTTAEMVNLMSAQRNYQSNAKVLDVNSTMQQALL 392


>gi|229166594|ref|ZP_04294346.1| Flagellar hook protein flgE [Bacillus cereus AH621]
 gi|228616848|gb|EEK73921.1| Flagellar hook protein flgE [Bacillus cereus AH621]
          Length = 407

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 191/433 (44%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSQGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
                IT D                    YD  G++    V +T+T +  +   +  R D
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFTQTSEHNYTYKVQMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
              +  F     P     ++FD V           I F+  +      I +D+S  T   
Sbjct: 223 SKKDTKF--EDVPGAGGNMTFDAVGNPNPKEQGANIPFDGGS------IKLDLSHLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  + ++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 275 TDKTLSVTNVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G+I  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNYTATNTTGILALGASGQNGAGKIRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKI 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|150390478|ref|YP_001320527.1| hypothetical protein Amet_2716 [Alkaliphilus metalliredigens QYMF]
 gi|149950340|gb|ABR48868.1| protein of unknown function DUF1078 domain protein [Alkaliphilus
           metalliredigens QYMF]
          Length = 441

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 118/463 (25%), Positives = 212/463 (45%), Gaps = 66/463 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM +A+SG+ A   R+ A+ +NIANV+TVGYK T + F  +   +            
Sbjct: 1   MMRSMFSAVSGLQAHQLRMDAIGNNIANVNTVGYKGTRVTFQEVFSQTIRGAGAPQGGRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNCLTRAGD 107
            T+   V  G+ +++      +GS   T  NTDL I G GFFIV     D  +  TRAG+
Sbjct: 61  GTNPQQVGLGVNVASMSTFHVRGSAESTGYNTDLMINGDGFFIVSSDANDQNHTYTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTG----- 162
           F ++  G L    G  ++G  + +  +  +    QGL+        +++ P +TG     
Sbjct: 121 FELDEAGNLITPGGQRVMGN-MYDVESGRMGTGLQGLQ----ISKSMTSPPMSTGVPLTD 175

Query: 163 ----------FISNNLDK----NATIITPDKTPKHNGRDAE----YTHKSSFAAYDTLGS 204
                     F   NL+     NAT+   D+  + +  DAE        ++F  YD LG 
Sbjct: 176 PQDATIPKSVFFGGNLNSDVQPNATLPVLDEFLE-DLVDAEGKSSVARDTTFTVYDELGG 234

Query: 205 SVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAI 264
           +    + + KT + K+ V +             N    + ++   +   G L++ +   +
Sbjct: 235 THDIRLAFVKTEENKYGVYVVE-----------NGVITDRIDHELEFEQGKLSDGTDLVL 283

Query: 265 SFNDNTSGI-DQQITIDISKTTQLAGGFIPQKSEIN-----GHAPGKPKDFSVSKDGYVD 318
                 +G  D   T+D    TQ++      +S+++     G+  G  +DF++   G + 
Sbjct: 284 ELTGLGNGASDFTFTVDFGAVTQVS-----NESDVSADVRVGYKQGNLEDFTIDSSGVIT 338

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
            ++++G + PI ++AIA   +   L+    N Y  + +SG+  +G PG    G +  G L
Sbjct: 339 GVFNNGYKRPIGQVAIANFRNPAGLEKIGENMYRNSPNSGEPLVGTPGSGGRGTLNPGTL 398

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E +NVD++ E T +I  QR +  NS++  T  + +  ++++KR
Sbjct: 399 EMSNVDLSREFTNMITTQRGFQANSRIITTSDEMLQEVVNMKR 441


>gi|290474972|ref|YP_003467856.1| flagellar hook protein [Xenorhabdus bovienii SS-2004]
 gi|289174289|emb|CBJ81079.1| flagellar biosynthesis; hook protein [Xenorhabdus bovienii SS-2004]
          Length = 416

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 117/423 (27%), Positives = 201/423 (47%), Gaps = 24/423 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A ++ +  + +NIAN  T G+K ++ AF+ +     S S V  G+++S      
Sbjct: 6   AVSGLNAAASNLDVIGNNIANSATFGFKSSSAAFADVF----SGSDVGLGVKVSGMVKNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYP- 128
           + GS   T+   D+AI   GFF +   +     +R G F+++++  L N+ G  L GYP 
Sbjct: 62  KDGSTTTTSRQLDMAITQGGFFRMLDSNGSTFYSRNGQFNMDSDRNLINMQGMKLTGYPA 121

Query: 129 LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDA 188
           ++ A+ P I         I++    L A  TT   ++ NL  N+     D  P +     
Sbjct: 122 VQGANGPEIQKG-AAPGPISIPRDMLDAKATTNVTMTANL--NSMNKKVDINPFNPSNKD 178

Query: 189 EYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVE-- 246
            + + S  + YD+LG+    +V++ KT D +W+  I+ QD S   S    +     VE  
Sbjct: 179 SFNYSSGLSVYDSLGNEHNINVFFVKTNDNEWD--IYAQDTSVPGSDHQKLNDKKVVEKE 236

Query: 247 -----VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS----E 297
                V F      + N++  A         I   ITID + + Q +   I Q S    +
Sbjct: 237 GESKSVLFSGNGKIIGNNNAFAFDMPGLNGSIGAPITIDFNNSKQQS---ISQDSISNQQ 293

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            NG+A G   ++ V  DG +  +Y +     + ++ +A   + + L     N ++ T  S
Sbjct: 294 QNGYAAGSFTNYRVDSDGKIHGLYSNQQTQVLGQVVLANFSNPEGLAAQGDNVWVETGAS 353

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G   +G  G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    +  L+
Sbjct: 354 GSPIVGTAGSGNFGKLISGALEASNVDMSQELVNMIVAQRNYQSNAQTIKTQDQILQTLV 413

Query: 418 SLK 420
           S++
Sbjct: 414 SMR 416


>gi|218249383|ref|YP_002374806.1| flagellar hook protein FlgE [Borrelia burgdorferi ZS7]
 gi|218164571|gb|ACK74632.1| flagellar hook protein FlgE [Borrelia burgdorferi ZS7]
          Length = 442

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 207/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I     P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGANPADIARGTWVVNKS---LYDSFGNVGVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|253688972|ref|YP_003018162.1| hypothetical protein PC1_2595 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755550|gb|ACT13626.1| protein of unknown function DUF1078 domain protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 405

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 105/416 (25%), Positives = 197/416 (47%), Gaps = 21/416 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A SN +  + +NIAN  TVG+K   + F+ +     + S V  G+++++     
Sbjct: 6   AVSGLNAASNNLDVIGNNIANSATVGFKSGTVTFADMF----AGSKVGMGVKVASVLQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L GYP+
Sbjct: 62  GNGTVTSSSRDLDIAISGGGFYRLQDTNGSVYYSRNGQFMLNGRNIV-NAQGMQLTGYPV 120

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
             A  P +V +      + +   ++ A  TTT  I  NL K++  +  +      G +  
Sbjct: 121 --AGTPPVVQTGADPVPLTIPDGDMLANRTTTASIKANL-KSSDSVPANSWATTPGGEGT 177

Query: 190 YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSF 249
           Y  K++   YD  G+   Y +Y+ KT +  W+   + +D +   +   N   LN     F
Sbjct: 178 YNSKTALTTYDGQGNVHNYTLYFVKTANNTWQT--YAKDDAVTPATYQNAGTLN-----F 230

Query: 250 DPVTGYLANSSHKA-ISFNDNTSGIDQQ----ITIDISKTTQLAGGFIPQKSEINGHAPG 304
           +   G L+++   A   F  N +G +       T+D++ + Q    +  +    NG  PG
Sbjct: 231 E-ANGALSSTGATAHTPFTINMTGTNGAAGGTFTLDLTGSVQQNTEYSYKSPTQNGFGPG 289

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               ++++ DG +   Y +G +  + ++ +A   + + L     N +  T  SG   +G 
Sbjct: 290 SLTGYAINDDGTIVGSYSNGQKQALGQILLAGFANPEGLSPEGDNAWSETASSGQAVVGL 349

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G    G++   + E +NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 350 AGSGNLGKLVGKSTEMSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 405


>gi|83718065|ref|YP_438389.1| flagellar hook protein flgE [Burkholderia thailandensis E264]
 gi|167614837|ref|ZP_02383472.1| flagellar hook protein flgE [Burkholderia thailandensis Bt4]
 gi|257141422|ref|ZP_05589684.1| flagellar hook protein flgE [Burkholderia thailandensis E264]
 gi|83651890|gb|ABC35954.1| flagellar hook protein flgE [Burkholderia thailandensis E264]
          Length = 395

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 111/414 (26%), Positives = 189/414 (45%), Gaps = 25/414 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +++++ +S NIAN +T G+K     F+++V  + +N    G +  S  
Sbjct: 2   SFNIALSGINAINSQLNTISHNIANANTYGFKAGRANFATMVAGTQANGTYIGSITQS-- 59

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             +  +G  + T    D AI G GFF+ K  D     TR G F  + +G++ +  G    
Sbjct: 60  --VGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSMLFTRFGYFQRDADGYIVDGFGRRAQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD--KNATIITPDKTPKH 183
           GY    A   + V +       + + A+ S      G +S + D  KN T    D     
Sbjct: 118 GYGTGGAYGDIRVPT-------DTEPAKASDSLEYVGNLSADWDAPKNPTFDKDD----- 165

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
              D  + H  +   YD+LG   +   Y+ K      +V+ +    + +        P+ 
Sbjct: 166 ---DTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVTTYY---AMDGEIVGGSTPVQ 219

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
           TV + FD      A +S   +            I ++ + TTQ+AG      +  NG+A 
Sbjct: 220 TV-LQFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGETTTTVNRDNGYAA 278

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G P + ++ +DG V + Y +G +  +  LA+AT  ++D L       +  +  SG+  IG
Sbjct: 279 GVPGEVTLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLTAVGDTAWRASAASGNPLIG 338

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
             G    G++ +G+LE +N D+  EL +++ AQRNY  NSKV  T +  M  L+
Sbjct: 339 SAGSGALGKVVAGSLELSNADVTKELVDMMSAQRNYQANSKVLSTENQMMQALM 392


>gi|157373207|ref|YP_001471807.1| flagellar hook protein FlgE [Shewanella sediminis HAW-EB3]
 gi|157315581|gb|ABV34679.1| flagellar basal body FlaE [Shewanella sediminis HAW-EB3]
          Length = 398

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 119/417 (28%), Positives = 189/417 (45%), Gaps = 28/417 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI-ST 64
           S   A+SG+ A +  ++ +S+NIAN  TVGY+     FS++      N   +GG+ + ST
Sbjct: 2   SFNIALSGLQATTQDLNTISNNIANSSTVGYRGGRSEFSAVY-----NGGQAGGVNVMST 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               S  GSL++T    D+ IQG GFF++ G+D     +RAG F  + +G++ + AG  L
Sbjct: 57  SQNFSMGGSLVYTGRELDMGIQGDGFFVLSGQDGSTLYSRAGMFSQDADGYITDPAGNRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+  A   L   +   L+   V+   L A  TT   + +NLD +   I    TP   
Sbjct: 117 QGYPV-GAGGQLQTGNVSDLQ---VQSGSLPAKATTDVGVVSNLDASMEPIDQTTTPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK--KWEVSIFRQDQSTNNSFPYNVAPL 242
              + Y    + A YD+LG+      YY KT D   +W V      +            +
Sbjct: 173 DDISSYHSSGTVAVYDSLGNEHALTQYYVKTNDSPSEWNVHYMMDGKD-----------V 221

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS--KTTQLAGGFIPQKSEING 300
            T ++ FD   G L    +  ++ N  T G    +++D+S   +TQ A  +       NG
Sbjct: 222 GTNKLEFDD-KGALTGGEN--VTLNLGTPGGAAPMSLDLSYKNSTQYASDYSNSSLTQNG 278

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +  G+     +  +G V   Y +G      ++ +A   + + L     N +  T  +G  
Sbjct: 279 YTSGELNGVRLDDNGMVYGTYTNGQEQIQGQVVLADFNNPNGLTPVSNNAWAATNAAGQP 338

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
            +G P     G +  G LE +NVD  +E+  L+ AQRNY  N+KV    S     L+
Sbjct: 339 IVGAPTTGTLGSVSGGYLEGSNVDTTAEMVSLMTAQRNYQSNAKVLDANSTMQQALL 395


>gi|294635610|ref|ZP_06714087.1| flagellar hook protein FlgE [Edwardsiella tarda ATCC 23685]
 gi|291091062|gb|EFE23623.1| flagellar hook protein FlgE [Edwardsiella tarda ATCC 23685]
          Length = 411

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 111/422 (26%), Positives = 204/422 (48%), Gaps = 27/422 (6%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SGM+A S+++  + +NIAN  TVG+K  ++ F+ +     + S V  G+ +++ +   
Sbjct: 6   AISGMNAASSQLDVIGNNIANSQTVGFKSGSVTFADMF----AGSKVGLGVTVASVNQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
           + G+   T    D+AI G+GFF ++  +     TR G F  + +GFL N  G  L GYP 
Sbjct: 62  KDGTTTTTNRGLDVAISGQGFFRMQDPNGSVYYTRNGQFSKDAKGFLTNAQGMYLTGYP- 120

Query: 130 KNASAPLIVNSFQGLER--INVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRD 187
            + + P I    QG +   I +    + A  TT G +  NL+     I    +P    + 
Sbjct: 121 ASGTPPTIQ---QGADPVPIQIPTGLMPAKSTTQGSMVLNLNSANKAIDSKTSPFDPNKV 177

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTK----TG---DKKWEVSIFRQDQSTNNSFPYNVA 240
             YT+ +S   YD+LG+    ++Y+ K    TG   +  W V       + +++ P    
Sbjct: 178 DTYTYATSMTTYDSLGNVHNMNLYFVKGESTTGAAPETAWHV------YAVDSAAPATDK 231

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG--FIPQKSEI 298
           P +   ++FD   G L     + I+   +     Q  T+D + T Q   G   +  K++ 
Sbjct: 232 PQDVGSLTFD-ANGNLIKGGKQTINMVASNGAPAQTFTLDFTGTRQQNTGKDGVTSKTQ- 289

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G+   + ++ DG +   Y +  +  + ++ +A   + + L     N +  +  SG
Sbjct: 290 DGYKAGELTGYQINDDGTITGSYTNQQKQLLGQIVMANFAAPEGLVSEGNNVWSESAKSG 349

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
              +G  G +  G + SGA+E +NVD++ +L ++I AQRNY  N++  +T    +  L++
Sbjct: 350 QPIVGTSGTSGLGNLTSGAVEASNVDLSKQLVDMIVAQRNYQSNAQTIKTQDQILQTLVN 409

Query: 419 LK 420
           L+
Sbjct: 410 LR 411


>gi|257457611|ref|ZP_05622778.1| flagellar hook protein FlgE [Treponema vincentii ATCC 35580]
 gi|257444997|gb|EEV20073.1| flagellar hook protein FlgE [Treponema vincentii ATCC 35580]
          Length = 463

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 124/477 (25%), Positives = 221/477 (46%), Gaps = 72/477 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SGM     R+  + +NIANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVSGMQNHQTRMDVIGNNIANVNTTGFKRGRVNFQDLISQQLSGASRPTEEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D +  QG+L  T  NTD+A+QG GFF++K  +  +  TRAG F 
Sbjct: 61  GVNPKEVGLGMMVASIDTVHTQGALQSTGINTDIAVQGNGFFVLKSGEK-SFYTRAGAFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           ++ +G + N A G+ + G+  +      ++N+    E + +   + + A  TT+   + N
Sbjct: 120 VDRDGTMVNPANGMRVQGWMAQEVDGTRLINTSAQTEDLIIPIGQKIDARATTSVNYACN 179

Query: 168 LDKNATIITPDKTPKHNGRDA--EYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVS 223
           LDK      P+  P++  R    E T  + F  YDT G +   ++ +++      +W  +
Sbjct: 180 LDKRL----PE-LPENANRAQVLESTWTTEFKVYDTFGETHELNLSFSRVPGTQNQWLAT 234

Query: 224 IFRQDQSTNNSFPYNVAPLNTVE-------------VSFD------PVTGYLANSSHKA- 263
           +        N  P N     T               V+FD       VT    N+S +A 
Sbjct: 235 V--------NVDPENAEATETRTGVGTTEGTGNTFTVTFDNYGHLASVTDTAGNASAEAG 286

Query: 264 -----ISFN--DNTSGIDQ---QITIDIS---------KTTQLAGGFIPQKSEINGHAPG 304
                +S+N    T+G D    + T DI+           TQ A     +  E +G+A G
Sbjct: 287 QVLVQVSYNVPGATAGEDGAPVRHTFDINLGEIGTSRNTITQFAERSTTKAYEQDGYAMG 346

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
             ++F + + G +  +Y +G    I +LA+A   ++  L+    NTY+ + +SG  +I  
Sbjct: 347 YLENFKIDQSGIITGVYSNGVSHEIGQLAMAGFANQGGLEKAGENTYVQSNNSGIANITT 406

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            G    G++ +G LE +NVD+  + T++I  QR +   +K  QT    ++ +++LKR
Sbjct: 407 SGVMGKGKLIAGTLEMSNVDLTDQFTDMIITQRGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|254524254|ref|ZP_05136309.1| flagellar biosynthesis hook protein [Stenotrophomonas sp. SKA14]
 gi|219721845|gb|EED40370.1| flagellar biosynthesis hook protein [Stenotrophomonas sp. SKA14]
          Length = 407

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 111/419 (26%), Positives = 191/419 (45%), Gaps = 25/419 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLEISTK 65
           ++SG++A ++ +S  ++N+ANV+T G+K +   F+ L F +T    S + V  G+ +S  
Sbjct: 6   SLSGINAANSDLSVTANNVANVNTTGFKESRAEFADL-FSATGYGLSKNAVGSGVRVSNV 64

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               +QG    T  + D+AI G+GFF +   +     +RAG+F  +  GF+ N  G  L 
Sbjct: 65  AQQFKQGHNEQTGRSLDMAISGEGFFTMN-MNGTRVYSRAGNFQTDASGFVVNPQGARLQ 123

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
            +                L+ +    A         GF      K  T+ T D T  +  
Sbjct: 124 VFAPNADGTNFDSGRIVDLQLLTTDSAPKQTSEVKVGFTLPANAKPPTVTTFDPTDSN-- 181

Query: 186 RDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVAPLN 243
               Y H S     YD+LG S +   Y+ K  +  +W V  +   Q      P       
Sbjct: 182 ---TYNHSSGGITVYDSLGVSHIQVSYFVKGANPNEWTVRNYVDGQPAGTPTP------- 231

Query: 244 TVEVSFDPVTGYLANSSHKAI--SFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
              V+FD     +A +  K    +F  NT      +T+DI+ +TQ    F  + ++ +G+
Sbjct: 232 ---VTFDNSGKLIAPTDGKVSLGTFTPNTGAGQLNMTLDITGSTQYGEKFALRNTQQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + +VS+ G V   Y +G   P+ ++A+ T  +   L+    N ++ T  SG   
Sbjct: 289 AAGKLNEITVSETGVVYARYSNGADKPLGQVALTTFNNPQGLESKGNNLWVDTFSSGTPR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G+I +G+LE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 349 TGMPDTSNLGKIQAGSLEASTVDLTEQLVNMITAQRNFQANAQMITTQDQITQTVINIR 407


>gi|330818585|ref|YP_004362290.1| flagellar hook protein FlgE [Burkholderia gladioli BSR3]
 gi|327370978|gb|AEA62334.1| flagellar hook protein FlgE [Burkholderia gladioli BSR3]
          Length = 414

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 117/427 (27%), Positives = 192/427 (44%), Gaps = 31/427 (7%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---GLEIST 64
           +  +SG+   SN +  + +NIAN +T G+K     F+ +   S S++  +G   G +++ 
Sbjct: 4   QQGLSGLQGASNDLDVIGNNIANANTTGFKAATAQFTDMYANSVSSAVANGIGIGTQLAA 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              + +QG    T +  ++AI G GFF V   + V   TR G F+ +  G + N AG  L
Sbjct: 64  VAQVFQQGGFTTTQNPLNMAINGNGFFQVT-NNGVTTYTRDGTFNADKNGNIVNAAGAQL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY +    A  ++N+   L  +      L+  P  T  I+   + + +  +   T   N
Sbjct: 123 MGYAVN---ANGVINT-GALVPLTAPQGNLA--PKATSSITGQFNLSTSDTSQSSTAAFN 176

Query: 185 GRD-AEYTHKSSFAAYDTLGSSVVYDVYYTK-TGDKKWEV-----SIFRQDQSTNNSFPY 237
             D   YT   S  A+D+LG+S   D+Y+ K T    WEV         QD  T   F  
Sbjct: 177 PNDPTTYTLHQSVPAFDSLGNSENVDLYFVKSTTTGSWEVWAGANGAAPQDMGTA-KFDS 235

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
           +   + TV    +P     A ++  A++ N+      Q I I++S +TQ    F   KS 
Sbjct: 236 SGKLIGTVGTDGNPT----AVTNTFALAVNNTNGATAQTININLSGSTQ----FGASKSG 287

Query: 298 I-----NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
           +     +G+  G    +SV  DG +  IY +   + + ++ +    +   L    GN Y+
Sbjct: 288 VANLNADGYPTGTLNSYSVGADGTIQGIYSNNQTLTLGQVVVVNFNNPQGLTSIGGNQYI 347

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T  SG   +G PG   HG +     E +  D+  EL  LI AQR+Y  N++  +T    
Sbjct: 348 QTSASGVPQVGVPGSTNHGTLKGSTTEASTTDLTGELVNLITAQRDYQANAQTIKTQQAV 407

Query: 413 MDILISL 419
              LI+L
Sbjct: 408 DQTLINL 414


>gi|303240279|ref|ZP_07326798.1| fagellar hook-basal body protein [Acetivibrio cellulolyticus CD2]
 gi|302592189|gb|EFL61918.1| fagellar hook-basal body protein [Acetivibrio cellulolyticus CD2]
          Length = 439

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 126/457 (27%), Positives = 214/457 (46%), Gaps = 56/457 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV--------FPSTSNS 54
           ++ SM + +SG+ A   ++  + +N+ANV+TV YK   + F  +          P T+  
Sbjct: 1   MMRSMFSGVSGLRAHQTKMDVIGNNVANVNTVAYKSGRVTFQEVFSQTIKGAGAPDTATG 60

Query: 55  -------YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAG 106
                   V  G+ +S+ D I+ +GSL  T + TDLAI+G GFFIVKG   +    TRAG
Sbjct: 61  RGGTNPMQVGLGIGVSSVDTITTRGSLQRTDNPTDLAIEGDGFFIVKGGSADTYRFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLG-------------YPLKNASAPLIVNSFQGLERINVKHAE 153
           +F I+  G L   +G  + G             Y  +N   P  +N +  +   N +   
Sbjct: 121 NFGIDKTGNLVTGSGMNVYGWQAYTRETDGTYNYDTENPIEP--INLYSDIPNKNKRM-- 176

Query: 154 LSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKS-SFAAYDTLGSSVVYDVYY 212
           ++A  TT+   + NLD +   +        +G  A     S     YD+LG+S   +V  
Sbjct: 177 IAAKATTSSVFAGNLDASYESL-------GSGASAGNVQFSVPMTVYDSLGNSYSINV-- 227

Query: 213 TKTGDKKWEVSIFRQDQSTN---NSFPYNVAPLNTVEVSFDPVTGYLAN--SSHKAISFN 267
                  W++S+       N   ++   + A   +  +SFD     +A+  S + AIS  
Sbjct: 228 -----DLWKISVGSSGSEWNWAIDTGSGSTASSASGTISFDSEGQIIASGTSVNPAISII 282

Query: 268 DNTSGIDQQITI--DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
              S   + I +  D SK T  +     + + ++G++ G    FS+  DG +  IY +G 
Sbjct: 283 PPESVGSEPIDVLFDFSKLTMYSADSSAKPTSVDGYSTGTLVSFSIGSDGIITGIYSNGQ 342

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF-PGHNQHGEIFSGALETANVD 384
           + P+  +A+A+  +   L+    N ++PT +SGD   G   G    G +  G LE +NVD
Sbjct: 343 QQPLGLIALASFENPAGLQKSGNNMFIPTTNSGDFKKGVKAGSEGVGTLNPGTLEMSNVD 402

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +++E T++I  QR +  NS++  T  + +  L++LKR
Sbjct: 403 LSTEFTDMIVTQRGFQANSRIITTSDEMLQELVNLKR 439


>gi|166712062|ref|ZP_02243269.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 407

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 116/424 (27%), Positives = 201/424 (47%), Gaps = 27/424 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLE 61
           +  T++SG+ A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ 
Sbjct: 2   AFNTSLSGISAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G
Sbjct: 61  VSNVAQQFSQGNIDPTGRSLDLAISGEGFFTVS-SNGAKMYTRAGNFQTDANGYVVNPQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP
Sbjct: 120 ARLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTP 174

Query: 182 KHNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNV 239
            +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V
Sbjct: 175 FNPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGAA--------V 226

Query: 240 APLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
               T++ S    TG L   ++  I+   F  +T      + +++S +TQ    F  + +
Sbjct: 227 GSPTTLQFS---DTGALTTPANGIIAMAPFTPSTGAGVLSMQLNVSGSTQYGEQFALRDT 283

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  
Sbjct: 284 RQDGYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYT 343

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG    G P  +  G+I SG+LE++ VD+  +L  +I AQRN+  NS++  T       +
Sbjct: 344 SGAARTGAPNTSDLGQIESGSLESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTI 403

Query: 417 ISLK 420
           I+++
Sbjct: 404 INIR 407


>gi|225552055|ref|ZP_03772995.1| flagellar hook protein FlgE [Borrelia sp. SV1]
 gi|225371053|gb|EEH00483.1| flagellar hook protein FlgE [Borrelia sp. SV1]
          Length = 442

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 207/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGKKVINTASDIEDLIIPIGDKEGARSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N     +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEAGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSVTQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRELGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|58582195|ref|YP_201211.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624088|ref|YP_451460.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58426789|gb|AAW75826.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368028|dbj|BAE69186.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 407

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 116/424 (27%), Positives = 201/424 (47%), Gaps = 27/424 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLE 61
           +  T++SG+ A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ 
Sbjct: 2   AFNTSLSGISAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G
Sbjct: 61  VSNVAQQFSQGNIDPTGRSLDLAISGEGFFTVS-SNGAKMYTRAGNFQTDANGYVVNPQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP
Sbjct: 120 ARLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTP 174

Query: 182 KHNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNV 239
            +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V
Sbjct: 175 FNPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGAA--------V 226

Query: 240 APLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
               T++ S    TG L   ++  I+   F  +T      + +++S +TQ    F  + +
Sbjct: 227 GSPTTLQFS---DTGALTTPANGIIAMAPFTPSTGAGVLSMQLNVSGSTQYGEQFALRDT 283

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  
Sbjct: 284 RQDGYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYT 343

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG      PG +  G+I SG+LE++ VD+  +L  +I AQRN+  NS++  T       +
Sbjct: 344 SGAARTSAPGTSDLGQIESGSLESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTI 403

Query: 417 ISLK 420
           I+++
Sbjct: 404 INIR 407


>gi|146278769|ref|YP_001168928.1| hypothetical protein Rsph17025_2736 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557010|gb|ABP71623.1| protein of unknown function DUF1078 domain protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 474

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 132/489 (26%), Positives = 217/489 (44%), Gaps = 83/489 (16%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS--YVSG 58
           M I  S+   ++G+ A + ++++++DNIAN  T GYKR    F S+V   ++NS  Y +G
Sbjct: 1   MTISSSLNAGVAGLYANATKLASIADNIANSGTYGYKRADADFESMVITQSANSGTYSAG 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIV---------KGRDNVNCLTRAGDFH 109
           G+  +T  ++ E+G+++ T++  D+AI G+G   V          G D +  +TR G F 
Sbjct: 61  GVRANTLRLVEERGAIVSTSNAMDIAISGRGMLPVVRETSLGSTTGNDAL-LMTRTGSFK 119

Query: 110 INNEGFLENVAGGVLLGYPL-KNASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNN 167
            +  G L+   G VLLG+P   + + P +  +S   L+ + +   + +A PTT   +  N
Sbjct: 120 TDPNGVLKTDTGLVLLGWPANADGTVPTMSRDSISQLQPVVIAANQTAADPTTRMNLGVN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT--------GDKK 219
           L    T +    +P       EY        +  LG+S    V Y  T           K
Sbjct: 180 LPAERTKLGASASPLTVA--VEY--------FGNLGTSETLQVSYYPTIPTVAADSPTNK 229

Query: 220 WEVSIFRQDQSTNN-------------------------SFPYN---VAPLNTVE----V 247
           W + I  QD ++++                         + P     V PL+T      V
Sbjct: 230 WTMVI--QDSASSDRTIAIYELQFSDARSGGGTLLDLSGATPAGSPAVKPLSTFSPVAGV 287

Query: 248 SFDPVTGYLANSSHKAISFNDNTSGIDQQI------TIDI--------SKTTQLAGGFIP 293
           SFD V  Y A +   + ++N  T  +   +      T+D+        S  TQ++G F  
Sbjct: 288 SFD-VDPYGAGTPTASPAYNSATGQVTLAVGGSAANTLDLTLGRPGSASALTQVSGDFAQ 346

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDG-TRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                NG   G      +   G +   YD G TRV IY++ +  VP+ + L   +  T+ 
Sbjct: 347 TGITKNGSPVGNLTGVEIDAGGLIKATYDTGFTRV-IYQIPLVDVPNYNGLTALNNQTFA 405

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            + DSG   +   G    G++   A E +  D+A ELT LI+ QR Y+ N+K+ QT  + 
Sbjct: 406 ISPDSGSFYLWDAGDGPTGDVVGYAREGSTTDVAQELTNLIQTQRAYSSNAKIIQTVDEM 465

Query: 413 MDILISLKR 421
           +    +LKR
Sbjct: 466 LQETTNLKR 474


>gi|315497293|ref|YP_004086097.1| fagellar hook-basal body protein [Asticcacaulis excentricus CB 48]
 gi|315415305|gb|ADU11946.1| fagellar hook-basal body protein [Asticcacaulis excentricus CB 48]
          Length = 459

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 127/460 (27%), Positives = 218/460 (47%), Gaps = 40/460 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  +M + +S + A S  ++A+S+NIANV+T  YK  + +F++ V  S S++Y SGG+
Sbjct: 1   MSISSAMLSGVSALSANSTALAAISNNIANVNTTAYKSVSTSFAANVSSSGSSTYSSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIV-KGRDNV--NCLTRAGDFHINNEGFLE 117
             ST   I+E G+L  T S+ DLAI G GFF+V +G D    +  TR G F +N+EG+L 
Sbjct: 61  SASTALSITEAGALQTTTSSLDLAIDGSGFFVVSEGADGSGGSYYTRDGSFSVNDEGYLV 120

Query: 118 NVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI--- 174
           N +G  L G+   ++      +S   L  I +  +  +   TT+  ++ NL+        
Sbjct: 121 NSSGYYLQGWQADSSGNVTAASSVSDLSAIKIPTSSDTPTATTSISLAANLNSATEAYAG 180

Query: 175 ---ITPDKTPKHNGRDAEYTHKSSF----AAYDTLGS--SVVYDVYYTKTGDKKWEVSIF 225
              I+   +  +   D E   +  F    +  D+LG   ++   V  ++T   +W   ++
Sbjct: 181 EYDISTGLSMANYDEDEETGVEPDFEIGISVSDSLGKEHTLTLSVLKSET-TNEWTAELW 239

Query: 226 RQDQSTNNSFPYNVAPLNTV------EVSFDPVTGY------------LANSSHK--AIS 265
             D +       N+    T+       ++ D +  +            +A SS +  A+ 
Sbjct: 240 SDDVTGGYGSEGNIIKSGTITFNEDGTLNEDSLAAFFGAEDLSQIKIDIAASSDETGALR 299

Query: 266 FNDNTSGIDQQITIDISKT----TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIY 321
           +   T    Q +++    T    TQ A     +  + +G       D +++ DG V+ IY
Sbjct: 300 WTSETGAAAQSLSLSFDDTQGGLTQYATTSEVKSIKADGTVFSDLSDVTIADDGTVNAIY 359

Query: 322 DDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETA 381
           +DGT   + ++ +AT  + + L    GN Y  + +SG  ++  PG    G + S +LE +
Sbjct: 360 EDGTSRVLAQIPVATFVNANGLTAKSGNVYALSSESGSYTLRTPGSGGAGLLASSSLEAS 419

Query: 382 NVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            VD++SE T LI  QR Y+  SK+  T  + M  +I  KR
Sbjct: 420 TVDLSSEFTSLITIQRAYSAASKIITTSDEMMQTVIESKR 459


>gi|289666047|ref|ZP_06487628.1| flagellar hook protein FlgE [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 407

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 115/423 (27%), Positives = 199/423 (47%), Gaps = 27/423 (6%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLEI 62
             T++SG++A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ +
Sbjct: 3   FNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAISGEGFFTVS-SNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVA 240
               D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V 
Sbjct: 176 DPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGAA--------VG 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
              T++ S    TG L   ++  I+   F  +T      + +++S +TQ    F  + + 
Sbjct: 228 APTTLQFS---DTGALTTPANGIIAMDPFTPSTGAGVLNMQLNVSGSTQYGEAFALRDTR 284

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  S
Sbjct: 285 QDGYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTS 344

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G    G P  +  G++ SG+LE + VD+  +L  +I AQRN+  NS++  T       +I
Sbjct: 345 GAARTGAPNTSDLGQVESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTII 404

Query: 418 SLK 420
           +++
Sbjct: 405 NIR 407


>gi|307131609|ref|YP_003883625.1| flagellar hook protein flgE [Dickeya dadantii 3937]
 gi|306529138|gb|ADM99068.1| Flagellar hook protein flgE [Dickeya dadantii 3937]
          Length = 399

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 115/419 (27%), Positives = 202/419 (48%), Gaps = 25/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A SN +  + +NIAN  TVG+K + I+F+ +     + S V  G  +++ 
Sbjct: 2   SFSQAVSGLNAASNNLDVIGNNIANSATVGFKASNISFADMY----AGSNVGLGTRVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS+  T+ + D+AI G GF+ +   +     +R G F +++   + N  G  L 
Sbjct: 58  LQDFSNGSITSTSRSLDVAINGNGFYRLLNSNGSVVYSRNGQFTLDSSRNIVNAQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAE--LSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           GYP    + P I    QG + + +   E  +SA  T+T  I  +L+ + +  T D T   
Sbjct: 118 GYP-ATGTPPAIQ---QGADPVGLSIPETTMSAKATSTASIIASLNSSDSTNTWDPTDPT 173

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS-TNNSFPYNVAPL 242
           N  +    +K S   YD+LG++  + +Y+ K+    W+V  + QD S T   F     P 
Sbjct: 174 NTSN----YKGSITTYDSLGNAHNFALYFVKSASNSWDV--YAQDTSITGAGFQ---GP- 223

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI-NGH 301
               +SF+  +G L  ++   IS             +  + T Q   G    K+   +G+
Sbjct: 224 --TTLSFN-TSGALTTTTPATISMATLNGSAASTFNLSFTGTVQQNSGSNSTKTPTQDGY 280

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
            PG+   +S+S+DG V   Y +     + ++A+A   + + L     N +  T +SG   
Sbjct: 281 EPGELTGYSISEDGSVVGSYSNNKTQLLGQIALANFANPEGLSPQGDNVWAATGNSGQAV 340

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G  G    G++   A E++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 341 VGSAGTGNLGKLVGKATESSNVDMSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 399


>gi|216264643|ref|ZP_03436635.1| flagellar hook protein FlgE [Borrelia burgdorferi 156a]
 gi|215981116|gb|EEC21923.1| flagellar hook protein FlgE [Borrelia burgdorferi 156a]
          Length = 442

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 207/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N     +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEAGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|312147981|gb|ADQ30640.1| flagellar hook protein FlgE [Borrelia burgdorferi JD1]
          Length = 442

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 207/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N     +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEAGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFINPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|307264876|ref|ZP_07546438.1| fagellar hook-basal body protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920134|gb|EFN50346.1| fagellar hook-basal body protein [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 417

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 120/442 (27%), Positives = 205/442 (46%), Gaps = 48/442 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVS-NGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            ++ G L    G  +LG+   +      VN+  G L  I++K+ + +  + TT   I  N
Sbjct: 120 FDSNGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISLKNWSSIDPVATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+ +  I            DA+ ++  +   YD+ G S V  + +T+     W+  +   
Sbjct: 177 LNASTAI------------DADISY--NIVVYDSQGGSHVATITFTRKAANSWDWKVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT--------I 279
           D       P   +   T  ++FD       + S   I+    T  +D  +T        +
Sbjct: 223 D-------PAISSIDGTGTLTFDSEGKIAPDQSGNRIATGTLTFNMDSNMTNATIGPVSL 275

Query: 280 DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPS 339
           D+SK T  +     ++   NG+  G  ++ ++ K G V  IY +G R  I ++AIA   +
Sbjct: 276 DLSKLTMFSSETDLRELSKNGNEAGSLENINIDKYGVVSGIYSNGRRQIIGQIAIADFQN 335

Query: 340 EDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNY 399
              L+      ++ T +SG+  IG  G    G I  G LE +NVD+++E  ++I  QR +
Sbjct: 336 PMGLEKIGNTMFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLSNEFADMIVTQRGF 395

Query: 400 AVNSKVFQTGSDFMDILISLKR 421
             N+KV     + +  L+++KR
Sbjct: 396 QANAKVITVSDEILQDLVNMKR 417


>gi|119953082|ref|YP_945291.1| flagellar hook protein FlgE [Borrelia turicatae 91E135]
 gi|119861853|gb|AAX17621.1| flagellar hook protein FlgE [Borrelia turicatae 91E135]
          Length = 442

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 116/447 (25%), Positives = 205/447 (45%), Gaps = 35/447 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QGS   T   +DL I G GFFI++  +N +  TRAG F 
Sbjct: 61  GVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFFILRDGNN-SFYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAEL-SAMPTTTGFISNN 167
           +++   L N A G+ + G+  K+     ++N+   +E + +   +  SA  T     + N
Sbjct: 120 VDSNRCLVNPANGMRIQGWMAKSIGGEQVINTSADVEDLVIPIGDKESAKATEHITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TGDKKWEVSIF 225
           LDK   II    +     R     +K+    YD+ G++ V ++   K  T    W  ++ 
Sbjct: 180 LDKRLPIIEEGASEVDVARGTWVVNKT---IYDSFGNTSVVELRVVKDTTTPNLWNATVL 236

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITIDIS 282
              + TN++F         + +S +   G   +     I+F   N N   + +Q TI++ 
Sbjct: 237 VNGE-TNSNFTIGFNNEGAL-LSLNGQAGQPGDLLEFPITFGVVNANAGEVGEQQTINLR 294

Query: 283 ---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLA 333
                      TQ A     +    +G+  G  +++ + ++G +  +Y +G R  I ++A
Sbjct: 295 LGNVGSYTDSITQFADASTTKAIIQDGYGMGYMENYEIDQNGIIMGVYSNGIRRDIGKIA 354

Query: 334 IATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELI 393
           +A+  +   L       +  T +SG   IG  G    G I +G LE ANVD+A + T++I
Sbjct: 355 LASFVNPGGLAKVGDTNFSETSNSGQARIGETGLAGLGTIRAGVLEMANVDLAEQFTDMI 414

Query: 394 EAQRNYAVNSKVFQTGSDFMDILISLK 420
             QR +  N+K   T    +  L+ LK
Sbjct: 415 VTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|228984838|ref|ZP_04145009.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229155324|ref|ZP_04283435.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 4342]
 gi|228628249|gb|EEK84965.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 4342]
 gi|228774890|gb|EEM23285.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 437

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 119/463 (25%), Positives = 198/463 (42%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT---------------- 213
           +N   ++ +                 F  +D  G+S+   V                   
Sbjct: 180 RNQNALSHE-----------------FTVFDAEGNSLTLRVNIKQKTTKETVDGKVVEKP 222

Query: 214 KTGDKKWEVSIFRQDQSTNNSF----------PY---NVAPLNTVE--VSFDPVTGYLAN 258
           K G+  + VS+ R D      F          P    N+  L   +  V  DPVTG +  
Sbjct: 223 KAGEYTYSVSV-RNDSKNEKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F          +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGSIKIPFGSG-------LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LAIAT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MKYSDGSMKVVGQLAIATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|187918157|ref|YP_001883720.1| flagellar hook protein FlgE [Borrelia hermsii DAH]
 gi|119861005|gb|AAX16800.1| flagellar hook protein FlgE [Borrelia hermsii DAH]
          Length = 442

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 113/450 (25%), Positives = 205/450 (45%), Gaps = 41/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QGS   T   +DL I G GFFI++  +N +  TRAG F 
Sbjct: 61  GVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFFILRDGNN-SFYTRAGAFD 119

Query: 110 INNEGFLENVAGGV-LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  K+     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRRLVNPANGMKIQGWMAKSIGGEQVINTSADVEDLVIPIGDKEGAKSTEYITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TGDKKWEVSIF 225
           LDK   I+    +     R     +K+    YD+ G++ V ++   K  T    W  ++ 
Sbjct: 180 LDKRLPIVEEGASEVDIARGTWVVNKT---IYDSFGNTSVVELRVVKDATTPNTWNATVL 236

Query: 226 RQDQSTNN---SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISF---NDNTSGIDQQITI 279
              ++ +N    F    A L     S +   G + +     I+F   N N   + +Q T+
Sbjct: 237 VNGEANSNFTMGFNNEGALL-----SLNGQAGQVGDLLEFPITFDVVNANAGEVGEQQTV 291

Query: 280 DIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
           ++            TQ A     +    +G+  G  +++ + ++G +  +Y +G R  I 
Sbjct: 292 NLRLGNVGSYTDSITQFADASTTKAIVQDGYGMGYMENYEIDQNGVITGVYSNGIRRDIG 351

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           ++A+A+  +   L       +  T +SG   IG  G    G I +G LE ANVD+A + T
Sbjct: 352 KIALASFVNPGGLAKAGDTNFSETSNSGQARIGETGFAGLGTIRAGVLEMANVDLAEQFT 411

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ++I  QR +  N+K   T    +  L+ LK
Sbjct: 412 DMIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|1184296|gb|AAA87351.1| flagellar hook protein [Borrelia burgdorferi]
          Length = 442

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 111/449 (24%), Positives = 208/449 (46%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+      +  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTIMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K   N+   TRAG F+
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFY 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +P    R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPLIQEGASPADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|167576662|ref|ZP_02369536.1| flagellar hook protein flgE [Burkholderia thailandensis TXDOH]
          Length = 395

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 111/414 (26%), Positives = 188/414 (45%), Gaps = 25/414 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +++++ +S NIAN +T G+K     F+++V  + +N    G    ST 
Sbjct: 2   SFNIALSGINAINSQLNTISHNIANSNTYGFKAGRANFATMVAGTQANGTYIG----STT 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             +  +G  + T    D AI G GFF+ K  D     TR G F  + +G++ +       
Sbjct: 58  QSVGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSTLFTRVGYFKRDADGYIVDGFRRRAQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD--KNATIITPDKTPKH 183
           GY    A   + V +       + + A+ S      G +S + D  KN T    D     
Sbjct: 118 GYGASGAYGDIRVPT-------DTEPAKASDSLEYVGNLSADWDAPKNPTFDKDD----- 165

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
              D  + H  +   YD+LG   +   Y+ K      +V+ +    + +        P+ 
Sbjct: 166 ---DTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVTTYY---AMDGEIVGGSTPVQ 219

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
           TV + FD      A +S   +            I ++ + TTQ+AG      +  NG+A 
Sbjct: 220 TV-LQFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGEPTTTVNRDNGYAA 278

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G P + ++ +DG V + Y +G +  +  LA+AT  ++D L       +  +  SG+  IG
Sbjct: 279 GVPGEVTLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLTAVGDTAWRASAASGNPLIG 338

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
             G    G++ +G+LE +N D+  EL +++ AQRNY  NSKV  T +  M  L+
Sbjct: 339 SAGSGALGKVVAGSLELSNADVTKELVDMMSAQRNYQANSKVLSTENQMMQALM 392


>gi|134283656|ref|ZP_01770355.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 305]
 gi|134245065|gb|EBA45160.1| flagellar basal body protein FlaE [Burkholderia pseudomallei 305]
          Length = 404

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 119/431 (27%), Positives = 190/431 (44%), Gaps = 52/431 (12%)

Query: 14  MDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEISTKDMISE 70
           M   S+ +  + +NIAN +TVG+K +   FS +      S  N+ +  G  +++      
Sbjct: 1   MAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYANSVASAVNNPIGIGTMLASVQQQFS 60

Query: 71  QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLK 130
           QG++  + S+ ++AI G GFF +   + V   +R G F  +  G++ N  G  L+GY   
Sbjct: 61  QGTITSSTSSLNVAINGNGFFQMS-NNGVTTYSRDGTFQRDKNGYIVNSQGLNLMGYA-- 117

Query: 131 NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEY 190
            A+A  ++N+      + ++    +  PT T  I+   + N+    P  TP +      Y
Sbjct: 118 -ANANGVINT---AATVPLQAPTTNIAPTATTKITGQFNLNSQDAVPATTPFNYTDPTSY 173

Query: 191 THKSSFAAYDTLGSSVVYDVYYTKTGDK-KWE---------------VSIFRQDQSTNNS 234
            + +S   +DTLG S   ++Y+ K+    +WE               V        T  S
Sbjct: 174 NYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGKTPTDLGSVKFSTAGTITGTS 233

Query: 235 FPYNVAPLNTVEVSFD-PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
            P  V   N  + SF  P T   AN                Q +T+D++ TTQ  G    
Sbjct: 234 TPAGVPTTNVGQFSFSIPTTTGAAN---------------PQNLTLDLTGTTQYGG---- 274

Query: 294 QKSEIN-----GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
            K+ IN     G A G    FS+  DG V   Y +G    + ++ +A   + + L     
Sbjct: 275 -KNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNGLVNVGN 333

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N Y+ +  SG   I  PG   HG +   ALE +NVD+ S+L +LI AQRNY  N++  +T
Sbjct: 334 NQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQANAQTIKT 393

Query: 409 GSDFMDILISL 419
                  LI+L
Sbjct: 394 QQTVDQTLINL 404


>gi|92114098|ref|YP_574026.1| flagellar basal body FlaE [Chromohalobacter salexigens DSM 3043]
 gi|91797188|gb|ABE59327.1| flagellar basal body FlaE [Chromohalobacter salexigens DSM 3043]
          Length = 387

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 116/417 (27%), Positives = 191/417 (45%), Gaps = 41/417 (9%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS-NSYVSGGLEISTKDMI 68
           ++SG++A S+++  + +NIAN  TVG+K +++ F+ +   S    + V+G L    +D  
Sbjct: 6   SLSGVNAASSQLDTIGNNIANSQTVGFKSSSVQFADIFANSQGLGTRVAGKL----QDFG 61

Query: 69  SEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYP 128
           +  GSL  T    DLAI G GFF     + +   +R G   ++ +G+ EN  G  L    
Sbjct: 62  T--GSLETTGRGLDLAIAGDGFFQFTQNEQL-AYSRNGQLSMSADGYFENAQGARLT--- 115

Query: 129 LKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRD 187
                 PL V  F QG            A  TT    + NL+     + P+   +     
Sbjct: 116 -DQQGEPLQVTQFSQG------------AQATTGVETAFNLNAETEALAPNNFNQDQSDT 162

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF----RQDQSTNNSFPYNVAPLN 243
             Y   +    YD+LG +    +YYTKTG+  WEV         D     S  +N + + 
Sbjct: 163 YSYVTNAG-TVYDSLGVAHDMSLYYTKTGENDWEVRAALDGEMADGGAAQSISFNESGVP 221

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
            V+ +     G L N S       DN       I +D++ TTQ    F  ++   +G+A 
Sbjct: 222 DVDTALSFNFGDLGNGSADF----DN-------IEVDLAGTTQYGEAFELREFAQDGNAS 270

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G      ++++G V   Y +G    +  + +A   + + L+    N +  T++SG   +G
Sbjct: 271 GTFVGVEITENGEVLANYSNGNSEAVGTVGMANFRNPEGLEPQGDNLWAATQESGAALLG 330

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G  Q G + SG LE +NVD+  EL ++I AQRN+  N+   QT SD ++ + +L+
Sbjct: 331 QAGTGQLGSLESGTLEASNVDLTQELVDMIIAQRNFQANNNAIQTQSDILETVTNLR 387


>gi|32490790|ref|NP_871044.1| hypothetical protein WGLp041 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25165996|dbj|BAC24187.1| flgE [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 410

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 116/425 (27%), Positives = 199/425 (46%), Gaps = 34/425 (8%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
            ++G+++ +  +  + +NIAN  T+G+K + ++FS +     S S V  G ++S      
Sbjct: 6   GINGINSAAQALDVIGNNIANSQTIGFKSSYVSFSDIF----SGSMVGLGSQLSNVTQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             GS++  + N D+AI G GFF +         TR G+F +N+   + N+    L GY  
Sbjct: 62  ASGSMVTGSKNLDMAISGNGFFRLSDSGGKIYFTRNGEFKLNSHRQIVNLQNKFLTGYQA 121

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI----ITPDKTPKHNG 185
           +    P  ++S   +E I +    ++ + +T G I  NL  +  +    I   K PK   
Sbjct: 122 R--GNPPSIDSGSSIENIIIPSTSMNPVVSTEGEIHGNLKSDVDVPKNSIFNIKNPK--- 176

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQ-----DQSTNNSFPYNV 239
               Y   +   AYD+LG   V  +++ K      W V  + +     D S N       
Sbjct: 177 ---SYNFTTQLEAYDSLGKKHVIKIFFVKQEAQGNWMVHGYDETSPIVDDSKN------- 226

Query: 240 APLNTVEVSFDPVTGYLANS--SHKAISFNDNT-SGIDQ-QITIDISKTTQLAGGFIPQK 295
              N + +SFD   G L  S  S+K IS + ++  G D  ++ I++ + TQ +       
Sbjct: 227 IKTNPILISFDE-NGNLKKSENSNKYISIDGSSLDGSDPLKVEINLEEMTQYSSDNQINY 285

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
            +INGH  GK  D++VS  G +   Y +G    I ++A+A   +   L     N +L + 
Sbjct: 286 QKINGHGVGKFNDYNVSDSGKIIANYSNGQTQLIAQIAMANFTNNLGLTPNGENCWLESA 345

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG   IG       G I    LE++NVDI++EL +++  Q NY  N++  +T    + I
Sbjct: 346 ESGPAIIGLSETGSFGRISGQKLESSNVDISNELVKMMTQQSNYQSNAQTIKTQDQLLQI 405

Query: 416 LISLK 420
           L+++K
Sbjct: 406 LVNMK 410


>gi|229069305|ref|ZP_04202595.1| Flagellar hook protein flgE [Bacillus cereus F65185]
 gi|229078936|ref|ZP_04211488.1| Flagellar hook protein flgE [Bacillus cereus Rock4-2]
 gi|228704350|gb|EEL56784.1| Flagellar hook protein flgE [Bacillus cereus Rock4-2]
 gi|228713792|gb|EEL65677.1| Flagellar hook protein flgE [Bacillus cereus F65185]
          Length = 407

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 108/433 (24%), Positives = 190/433 (43%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
                IT D                    YD  G++    V + +T +  +   +  R D
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFKQTSEHNYTYKVQMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                 F     P     ++FD V           I F+  +      I +D+S  T   
Sbjct: 223 SKKETEF--KDVPGAGGNMTFDAVGNPNPKEQGANIPFDGGS------IKLDLSHLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 275 TDKTLSVTDVDGRAAATVKDCLIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNYTATNTTGILALGTSGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKV 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|77464881|ref|YP_354385.1| putative flagellar hook protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463723|ref|YP_001044837.1| hypothetical protein Rsph17029_2963 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640802|ref|YP_002527064.1| hypothetical protein RSKD131_2703 [Rhodobacter sphaeroides KD131]
 gi|332559780|ref|ZP_08414102.1| FlgE2 [Rhodobacter sphaeroides WS8N]
 gi|77389299|gb|ABA80484.1| putative flagellar hook protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105387|gb|ABN78065.1| protein of unknown function DUF1078 domain protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221161583|gb|ACM02563.1| Hypothetical Protein RSKD131_2703 [Rhodobacter sphaeroides KD131]
 gi|332277492|gb|EGJ22807.1| FlgE2 [Rhodobacter sphaeroides WS8N]
          Length = 465

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 130/478 (27%), Positives = 214/478 (44%), Gaps = 70/478 (14%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN--SYVSG 58
           M I  S+   ++G++A + +++ ++DNIAN  T GYKR    F S+V   ++N  SY +G
Sbjct: 1   MTISSSLNAGVAGLNANATKLATIADNIANSGTYGYKRADADFESMVITQSANGGSYAAG 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--------LTRAGDFHI 110
           G+  +T   + E G+ + TAS  D+AI G+G   V    ++          +TR G F  
Sbjct: 61  GVRANTIRRVEEWGAPVSTASALDIAISGRGMLPVIRETSLGASSGNEALLMTRTGSFAT 120

Query: 111 NNEGFLENVAGGVLLGYP-LKNASAPLIV-NSFQGLERINVKHAELSAMPTTTGFISNNL 168
           +  G L+   G VLLG+P   + + P +  +S   LE + +   + +A PTT   +  NL
Sbjct: 121 DPSGVLKTDTGLVLLGWPATADGTIPTMSRDSIAQLEPVVIAANQTAADPTTRINLGVNL 180

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GD---KKW 220
                   P +  K+       T    +  +  LG+S    V Y  T     GD     W
Sbjct: 181 --------PAEETKYGASGRVLTVSVEY--FGNLGTSETLSVSYHPTLPAAAGDPPTNNW 230

Query: 221 EVSI----------------FRQDQSTNNSFPYNVA--PLNTVEVSFDPVTGYLANSSH- 261
            + I                F   +S   +   + A  PLNT  V+ D  T  + N+   
Sbjct: 231 TMVIRDSANADKVIGIYTMQFSDARSGGGTILDDTAITPLNT--VTLDGTTYTVENAGST 288

Query: 262 ---KAISFNDNTSGI--------DQQITIDISK------TTQLAGGFIPQKSEINGHAPG 304
               + +++  T GI        D +I + + K       TQ++G F       +G   G
Sbjct: 289 PPDSSPAYDPLTGGIVLEVAGNADNKIAMTLGKPGSANAMTQVSGDFAQTGITKDGSPVG 348

Query: 305 KPKDFSVSKDGYVDIIYDDG-TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
                 +   G++   YD G TRV IY++ +  VP+ + L   +  T+  + DSG+  + 
Sbjct: 349 NLTGVEIDDGGFMRATYDTGFTRV-IYQVPLVDVPNYNGLTALNNQTFAISPDSGNFYLW 407

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
             G    G++   A E +  D+A+ELT LI+ QR Y+ N+K+ QT  + +    +LKR
Sbjct: 408 DAGDGPTGDVLGYAREGSTTDVATELTNLIQTQRAYSSNAKIIQTVDEMLQETTNLKR 465


>gi|118477189|ref|YP_894340.1| flagellar hook protein FlgE [Bacillus thuringiensis str. Al Hakam]
 gi|225863612|ref|YP_002748990.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB102]
 gi|229183945|ref|ZP_04311161.1| Flagellar hook protein FlgE [Bacillus cereus BGSC 6E1]
 gi|118416414|gb|ABK84833.1| flagellar hook protein [Bacillus thuringiensis str. Al Hakam]
 gi|225790448|gb|ACO30665.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB102]
 gi|228599597|gb|EEK57201.1| Flagellar hook protein FlgE [Bacillus cereus BGSC 6E1]
          Length = 437

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 118/463 (25%), Positives = 198/463 (42%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT---------------- 213
           +N   ++ +                 F  +D  G+S+   V                   
Sbjct: 180 RNQNALSHE-----------------FTVFDAEGNSLTLRVNIKQKTTKETVDGKVVEKP 222

Query: 214 KTGDKKWEVSIFRQDQSTNNSF----------PY---NVAPLNTVE--VSFDPVTGYLAN 258
           K G+  + VS+ R D      F          P    N+  L   +  V  DPVTG +  
Sbjct: 223 KAGEYTYSVSV-RNDSKNEKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F          +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGSIKIPFGSG-------LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MKYSDGSMKVVGQLAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|220934394|ref|YP_002513293.1| flagellar basal body FlaE domain protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995704|gb|ACL72306.1| flagellar basal body FlaE domain protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 408

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 105/419 (25%), Positives = 188/419 (44%), Gaps = 18/419 (4%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFS---SLVFPSTSNSYVSGGLEIS 63
            +TA+SG++A S  +    +NIAN  T G+K++   F+   +L +   S + +  G+ +S
Sbjct: 3   FRTALSGLNAASADLRVTGNNIANSGTTGFKQSRAEFADVFALSYGGISQTAIGTGVRLS 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG++  T +N DLA+ G+GFF++         +RAG F +N EG++ N  G  
Sbjct: 63  AVTQQFSQGNIEFTGNNLDLAMNGQGFFVLN-DSGTQVYSRAGAFQVNREGYVVNTQGQR 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L  Y  +NA        F      +++ +   A P+ T  ++  L+ ++ +   D     
Sbjct: 122 LQVYTPQNAEG----TQFNTGSLADLQLSLSEAPPSATTDVNVRLNLSSVVEPIDPAIAF 177

Query: 184 NGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +  D + + + +S   YDTLG +    +Y+  T   +W+  +           P      
Sbjct: 178 DVADPSSFHYSTSLTVYDTLGQAHTASLYFRNTDTLQWDSYLAIDGNLAGGPLP------ 231

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGH 301
             +E + D        ++         T+G D   I  D++  TQ  G F       NG 
Sbjct: 232 --LEFNSDGTLNTATTTTPLNFGTYALTNGADDLNIDFDLANATQYGGAFNVTSLSQNGF 289

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+     +   G V   + +G    + R+A+A   +   L+    N +  +  +GD+ 
Sbjct: 290 TTGRLNSIDIDPTGVVFARFTNGQSQALGRVALANFANPQGLQQLGDNAWGESFAAGDVI 349

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G       G I +G LE++NVDIA +L +LI AQRN+  N++V  T       +I+++
Sbjct: 350 LGEADTGNFGLIQAGGLESSNVDIAEQLVKLITAQRNFQANAQVITTADAVTQTIINIR 408


>gi|319764539|ref|YP_004128476.1| flagellar hook-basal body protein [Alicycliphilus denitrificans BC]
 gi|330826755|ref|YP_004390058.1| flagellar hook-basal body protein [Alicycliphilus denitrificans
           K601]
 gi|317119100|gb|ADV01589.1| flagellar hook-basal body protein [Alicycliphilus denitrificans BC]
 gi|329312127|gb|AEB86542.1| flagellar hook-basal body protein [Alicycliphilus denitrificans
           K601]
          Length = 426

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 115/435 (26%), Positives = 200/435 (45%), Gaps = 32/435 (7%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF-----PSTSNSYVSGGLE 61
            +  +SG++A S  +  +  NIAN +TVG+K +   F+S+V       ST N+ +  G++
Sbjct: 3   FQQGLSGLNASSKNLDVIGHNIANSNTVGFKASRTEFASMVATAIGTASTGNAGI--GVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +        QG++  T +N D+AI G GFF ++  D     TRAG+F ++++G +    G
Sbjct: 61  VGAVAQQFTQGNITVTGNNLDVAINGNGFFKIQQPDGSFAYTRAGNFKLDDKGNVITNNG 120

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA--TIITPDK 179
           G ++GYP+   +     ++ Q L  +    A + A  TT+   + NLD  A      P  
Sbjct: 121 GKVMGYPMDPITQTRTASTPQPL--VFPTGAPIPAKQTTSIKATFNLDARAPDAAGNPSA 178

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK-WEVSIFRQDQSTNNSFPYN 238
           TP         T+ +S   YD+ G +    +Y+ KTG    W+V  + +    N + P  
Sbjct: 179 TPPI-AATPRSTYGTSLNVYDSQGVATPVSLYFQKTGTANTWDV--YDRLDDPNATPPVV 235

Query: 239 VAPLNTVEVSFD------------PVTGY-LANSSHKAISFNDNTSGIDQQITIDISKTT 285
             P+   +++FD            P TG+ L  +        +N      Q+ +D    T
Sbjct: 236 ATPIG--QITFDNNGQITGPAATPPATGFQLPITIAPPTPNPNNLPAYTVQVNLD--GVT 291

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q    F       +G+  G+    ++  DG +   Y +G      ++A+A+  +   L  
Sbjct: 292 QFGAKFAVSDLTQDGYTAGQLTGINIGDDGTIMTSYSNGVTRAEGQIALASFRNAQGLAD 351

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N ++ T +SG   +G       G + SGALE +NVD+ +EL  ++ AQR Y  N++ 
Sbjct: 352 IGNNLWVETFESGQPVMGVATEGAFGALRSGALEDSNVDLTAELVNMMTAQRAYQANAQT 411

Query: 406 FQTGSDFMDILISLK 420
            +T    M  L++L+
Sbjct: 412 IKTQDQVMSTLVNLR 426


>gi|218235227|ref|YP_002366439.1| flagellar hook protein FlgE [Bacillus cereus B4264]
 gi|228907387|ref|ZP_04071245.1| Flagellar hook protein flgE [Bacillus thuringiensis IBL 200]
 gi|228938867|ref|ZP_04101467.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228964737|ref|ZP_04125844.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228971748|ref|ZP_04132369.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228978357|ref|ZP_04138734.1| Flagellar hook protein flgE [Bacillus thuringiensis Bt407]
 gi|218163184|gb|ACK63176.1| flagellar hook protein [Bacillus cereus B4264]
 gi|228781374|gb|EEM29575.1| Flagellar hook protein flgE [Bacillus thuringiensis Bt407]
 gi|228787838|gb|EEM35796.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228794987|gb|EEM42486.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228820716|gb|EEM66741.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228852248|gb|EEM97044.1| Flagellar hook protein flgE [Bacillus thuringiensis IBL 200]
 gi|326939367|gb|AEA15263.1| flagellar hook protein FlgE [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 407

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 108/433 (24%), Positives = 190/433 (43%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
                IT D                    YD  G++    V + +T +  +   +  R D
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFKQTSEHNYTYKVQMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                 F     P     ++FD V           I F+  +      I +D+S  T   
Sbjct: 223 SKKETEF--KDVPGAGGNMTFDAVGNPNPKEQGANIPFDGGS------IKLDLSHLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 275 TDKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNYTATNTTGILALGASGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKV 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|30248322|ref|NP_840392.1| flagellar hook protein FlgE [Nitrosomonas europaea ATCC 19718]
 gi|30138208|emb|CAD84216.1| Flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
          Length = 410

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 112/419 (26%), Positives = 197/419 (47%), Gaps = 23/419 (5%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
            +SG+ A S ++    +NIAN +TVG+K++   F+ +   +        G+      +  
Sbjct: 6   GLSGLKAASAKLDVTGNNIANANTVGFKQSQAQFADVYANALGGGRNQIGIGTQLAAVAQ 65

Query: 70  E--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGY 127
           E  QG++  T +  D+AI G GFF +    ++   TR G FH++ +GFL N +   + G+
Sbjct: 66  EFNQGNVTPTNNPLDVAITGNGFFRMDNNGSI-SFTRNGQFHLDKDGFLVNASNYNVTGF 124

Query: 128 PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRD 187
              +AS  +I N    L    +  A+++  PTT+     NLD  A ++T    P +    
Sbjct: 125 G-ADASGQIIPNIPVNLR---LPTADMTPNPTTSFMTGVNLDARADVVT---DPFNVANP 177

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ----DQSTNNSFPYNVAPLN 243
             YTH +S   +D+ G+S + ++Y+ KT    W V         D ST  S        +
Sbjct: 178 DTYTHSTSGEIFDSFGNSHILNLYFQKTAASTWGVYTAVDGTVVDPSTGLS-----GTDS 232

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ---ITIDISKTTQLAGGFIPQKSEING 300
            + +SF+P +G + ++    I+   +  G         +D++++TQ    F       +G
Sbjct: 233 PITLSFNP-SGIMTSTGSSTINVAASVLGAGVSPLAFELDLTRSTQFGSKFGVNVMSQDG 291

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            A G+   +S+S DG +   Y +     + +L +A   + + LK    N +  T +SG  
Sbjct: 292 FASGRLAGYSISDDGQIRASYSNNVTRTVGQLVLAGFSNPNGLKPLGSNQWGETAESGLP 351

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            +G P     G + S A+E +NVD+ +EL  LI  QR Y  N+K  +T    M  ++++
Sbjct: 352 LVGTPETGVLGSLQSSAVEESNVDLTTELVTLIMTQRVYQANAKTIETQDAVMQTIMNI 410


>gi|225871934|ref|YP_002753388.1| flagellar hook protein flgE [Acidobacterium capsulatum ATCC 51196]
 gi|225793054|gb|ACO33144.1| flagellar hook protein flgE [Acidobacterium capsulatum ATCC 51196]
          Length = 409

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 108/424 (25%), Positives = 192/424 (45%), Gaps = 47/424 (11%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS------YVS 57
           + S    ++G++A S  +  +++N++N++T  +K    +F  L +    NS       V 
Sbjct: 1   MSSFSIPLTGLEASSTSLDTIANNLSNMNTTAFKSQQASFGDLFYQQIGNSGSGDPLEVG 60

Query: 58  GGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLE 117
            G++++  +    QG++  T + TD+A+ G GFF+V+  D     TR G+F + + G L 
Sbjct: 61  AGVQVAATNTNFTQGTVSETGNATDVALNGSGFFVVRNSDGTPAYTRDGNFTLTSSGDLT 120

Query: 118 NVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNNLDKNATIIT 176
              G  ++GYP  N     +VN+   L  I +   ++     +  F ++ NL+ +A + T
Sbjct: 121 TQGGQAVMGYPAANG----VVNTNSALSPIQIPVGQVEQPQASQKFGLTANLNSSAAVGT 176

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI--------FRQD 228
                            ++   YD+LG +    V +TKT    W  S+            
Sbjct: 177 --------------NFSATVPTYDSLGQTQDVTVNFTKTATNTWSYSLALPAGASTGGTG 222

Query: 229 QSTNNSFPYN---VAPLNTVE-VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT 284
            +    F  N   ++P   V  +SF  +T   +N     ++ N N  G +   TI     
Sbjct: 223 LTGTLQFDNNGNLISPAANVSGISFTGLTDGASN-----MNLNWNLYGSNGTSTI----- 272

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           +Q+        +  +G+  G+   F++  DG V   + +G    + +LA+A++ +E  L+
Sbjct: 273 SQVDTTSGYSGTTTDGYPSGQYTGFTIGADGTVSAQFSNGQTQAVGQLALASITNEQGLQ 332

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
           L  GN Y  T  SG  SIG  G    G +   ALE +NV+I++E + L+ AQ  Y  +SK
Sbjct: 333 LDGGNLYQTTLASGSASIGLAGSAGLGTVQDSALEGSNVNISTEFSNLVVAQNAYEASSK 392

Query: 405 VFQT 408
              T
Sbjct: 393 ALTT 396


>gi|228952133|ref|ZP_04114228.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228807665|gb|EEM54189.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 437

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 115/463 (24%), Positives = 198/463 (42%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GSL  T+   + AI+G G F+V  R++ N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSLTLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-------------- 215
           +N   ++ +                 F  +D  G+S+   V   +               
Sbjct: 180 RNQNALSHE-----------------FTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKP 222

Query: 216 --GDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFD---------------PVTGYLAN 258
             G+  + VS+ R D      F           + FD               PVTG +  
Sbjct: 223 VPGEYTYTVSV-RNDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDESVQKNPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F        + +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGTVKIPFG-------KGLTLDLSGLTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MTYSDGSMKVVGQLAVATFPNSGGLMKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD+++E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSAEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|325921024|ref|ZP_08182906.1| flagellar hook protein FlgE [Xanthomonas gardneri ATCC 19865]
 gi|325548506|gb|EGD19478.1| flagellar hook protein FlgE [Xanthomonas gardneri ATCC 19865]
          Length = 407

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 116/424 (27%), Positives = 201/424 (47%), Gaps = 27/424 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLE 61
           +  T++SG++A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ 
Sbjct: 2   AFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G
Sbjct: 61  VSNVAQQFSQGNIDPTGRSLDLAISGEGFFAVS-SNGAKMYTRAGNFQTDANGYVINPQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP
Sbjct: 120 ARLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTP 174

Query: 182 KHNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNV 239
            +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +         
Sbjct: 175 FNPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGAAVG------- 227

Query: 240 APLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
           AP     + F   TG L N ++  I+   F  +T      + ++++ +TQ    F  + +
Sbjct: 228 AP---TALQFSD-TGALTNPANGIIAMDPFTPSTGAGVLNMQLNVTGSTQYGEAFALRDT 283

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+A GK  + S+   G V   Y +G    + ++A+++  +   L+    N +  +  
Sbjct: 284 RQDGYASGKLNEISIDTSGVVFARYSNGADKALGQVALSSFVNPQGLQSQGNNMWAESYT 343

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG   IG P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +
Sbjct: 344 SGAARIGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTI 403

Query: 417 ISLK 420
           I+++
Sbjct: 404 INIR 407


>gi|302343058|ref|YP_003807587.1| fagellar hook-basal body protein [Desulfarculus baarsii DSM 2075]
 gi|301639671|gb|ADK84993.1| fagellar hook-basal body protein [Desulfarculus baarsii DSM 2075]
          Length = 452

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 127/453 (28%), Positives = 205/453 (45%), Gaps = 54/453 (11%)

Query: 11  MSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---------STSNSYVSGGLE 61
           +SG+ + S  ++ V+DN+AN +T GYK +   F+ +++          +T    V  G  
Sbjct: 10  VSGLKSFSQGLNIVADNLANSNTYGYKSSRAEFADVLYRELSYTGSDLTTEIDQVGQGAT 69

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL-TRAGDFHIN----NEGFL 116
           + +  +++ QG++  T    DLAI G GFF VK  D      TRAG F ++     EGF+
Sbjct: 70  VWSHQLMN-QGAIQETGRTLDLAIDGNGFFTVKNLDTEELYYTRAGQFGVDGVVGQEGFI 128

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL---DKNAT 173
            N  G  L G+ + +   P++ N    L  + +    L    TT   +  NL   D    
Sbjct: 129 INDQGYRLQGFAIGDDGEPIVGN----LIDLQIPVENLPGEATTIVGLGVNLNPADTRVN 184

Query: 174 IITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----------GDKKWEVS 223
            +  D  P+ +G    Y + SS   YD  G +    VYY +           G   W+ S
Sbjct: 185 QVATDIDPEVSGT---YNYSSSTTVYDANGDTHQISVYYQRVDDYAGTVPEGGQTVWKAS 241

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLA---NSSHKAISFNDNTSGID------ 274
            F        + P +  P NT  + F   TG LA   +S+   +S +     +D      
Sbjct: 242 TFETQDGEQVANPAD--PANTFYLHFTD-TGALAGVTDSTGATVSADSIGLTMDFGEAGQ 298

Query: 275 QQITIDIS-----KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
           Q IT+D +      TTQ+A G+    +  +G A G  +  +VS+DG+V   Y +G  V +
Sbjct: 299 QAITLDFAPAAGQATTQVAEGYSTSTNTQDGFAEGGLESVAVSEDGFVTAYYSNGEMVDV 358

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQH--GEIFSGALETANVDIAS 387
             +A+ T  S  NL+    N +    D+G+I +G P   +   G I   +LET+ VD A+
Sbjct: 359 GVVALTTFASPGNLRREGDNLWAYDADAGEIWVGQPTDEEFAMGAIEDQSLETSTVDTAT 418

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           E+  +I  QR +  +SK   T  + +   I++K
Sbjct: 419 EMMNMIIYQRAFQASSKTVTTSDEMIKTAINMK 451


>gi|206970889|ref|ZP_03231841.1| flagellar hook protein FlgE [Bacillus cereus AH1134]
 gi|228920464|ref|ZP_04083809.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229178162|ref|ZP_04305533.1| Flagellar hook protein flgE [Bacillus cereus 172560W]
 gi|206734525|gb|EDZ51695.1| flagellar hook protein FlgE [Bacillus cereus AH1134]
 gi|228605292|gb|EEK62742.1| Flagellar hook protein flgE [Bacillus cereus 172560W]
 gi|228839094|gb|EEM84390.1| Flagellar hook protein flgE [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 407

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 108/433 (24%), Positives = 190/433 (43%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
                IT D                    YD  G++    V + +T +  +   +  R D
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFKQTSEHNYTYKVQMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                 F     P     ++FD V           I F+  +      I +D+S  T   
Sbjct: 223 SKKETEF--KDVPGAGGNMTFDAVGNPNPKEQGANIPFDGGS------IKLDLSHLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L     
Sbjct: 275 TDKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNYTATNTTGILALGTSGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKV 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|52143704|ref|YP_083124.1| flagellar hook protein FlgE [Bacillus cereus E33L]
 gi|228926789|ref|ZP_04089857.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229121305|ref|ZP_04250536.1| Flagellar hook protein FlgE [Bacillus cereus 95/8201]
 gi|51977173|gb|AAU18723.1| flagellar hook protein [Bacillus cereus E33L]
 gi|228662150|gb|EEL17759.1| Flagellar hook protein FlgE [Bacillus cereus 95/8201]
 gi|228832902|gb|EEM78471.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 437

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 120/450 (26%), Positives = 198/450 (44%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYD---VYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    +          S   D   V   K G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTESETVDGKVVEKPKAGEYTYSVSV-R 234

Query: 227 QDQSTNNSF----------PY---NVAPLNTVE--VSFDPVTGYLANSSHKAISFNDNTS 271
            D      F          P    N+  L   +  V  DPVTG +       I F D   
Sbjct: 235 NDSKNEKEFKPIVGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITKGGTITIPFGDG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|289548122|ref|YP_003473110.1| fagellar hook-basal body protein [Thermocrinis albus DSM 14484]
 gi|289181739|gb|ADC88983.1| fagellar hook-basal body protein [Thermocrinis albus DSM 14484]
          Length = 454

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 128/468 (27%), Positives = 205/468 (43%), Gaps = 63/468 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----------S 52
           +L S   A++G++A    +   SDN+ANV+T+G+K +   F  ++   T           
Sbjct: 1   MLRSFFNAVTGLNAYRTWMDITSDNLANVNTIGFKASRPIFQDVISSVTVGLNTVTNTIK 60

Query: 53  NSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR-DNVNCLTRAGDFHIN 111
            +    G+ I +   I   G+   T  NTDLAIQG+G FI+K      +  TR G+F ++
Sbjct: 61  TTTYGAGVLIDSTQKIWTIGNFKQTGINTDLAIQGRGLFILKDPISGAHYYTRDGEFRLS 120

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
            +GF+ N AG  L G+ +      +      GLE I V   +L   PT         + N
Sbjct: 121 RDGFMVNSAGLKLQGFRVDENGRTV----GTGLEDIKVV-PQLEPKPTGVINFLQPSNLN 175

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEV-------- 222
           AT   P   P +    + Y ++ +   YD+LG+    D+Y+ KT    +WE+        
Sbjct: 176 ATATEP-PNPFNPLDPSSYNYRYTLTIYDSLGTPYQADMYFRKTNLPNQWEIHLRADIDP 234

Query: 223 --------------------------SIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYL 256
                                     ++ R+ Q +N  F Y + P N    +  P  G  
Sbjct: 235 NSPGYELSGDWTVTFDSYGKLIYDNATVLREPQGSN--FAYYLNPANLSVPASTPSGGTF 292

Query: 257 ANSSHKAISFNDN--TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKD-FSVSK 313
            ++S   I    +  +   +    I  S  TQ A  F+   S+ NG+A G   D + +S+
Sbjct: 293 PSASVWRIYVGTSLQSGAPNPGQPIPTSFVTQHASDFVVTASQ-NGYARGDLVDVYVLSE 351

Query: 314 DGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEI 373
           DG V  +Y +G  +P+YR+A+A     + L     N Y         ++  PG  +  ++
Sbjct: 352 DGAVVGVYSNGKSLPLYRVAVAVFSDPEELIKKGANLYTSISTP---TVMVPGGAE--KV 406

Query: 374 FSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            SG LE +NVDIA+E   LI AQR Y  N+K     +  +D  ++L R
Sbjct: 407 RSGMLEMSNVDIATEFVNLISAQRAYQANAKTITATNAVLDETVNLVR 454


>gi|21242727|ref|NP_642309.1| flagellar hook protein FlgE [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294625274|ref|ZP_06703913.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664591|ref|ZP_06729932.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325927875|ref|ZP_08189099.1| flagellar hook protein FlgE [Xanthomonas perforans 91-118]
 gi|21108203|gb|AAM36845.1| flagellar biosynthesis hook protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|292600448|gb|EFF44546.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605648|gb|EFF48958.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325541715|gb|EGD13233.1| flagellar hook protein FlgE [Xanthomonas perforans 91-118]
          Length = 407

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 114/423 (26%), Positives = 200/423 (47%), Gaps = 27/423 (6%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLEI 62
             T++SG++A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ +
Sbjct: 3   FNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAVSGEGFFTVS-SNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVA 240
           +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V 
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVYNYVDGAA--------VG 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
              T++ S    TG L   ++  I+   F  +T      + ++++ +TQ    F  + + 
Sbjct: 228 APTTLQFS---DTGALTTPANGIIAMDPFTPSTGAGVLNMQLNVTGSTQYGEAFALRDTR 284

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  S
Sbjct: 285 QDGYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTS 344

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G    G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I
Sbjct: 345 GAARTGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTII 404

Query: 418 SLK 420
           +++
Sbjct: 405 NIR 407


>gi|149911702|ref|ZP_01900310.1| flagellar hook protein FlgE [Moritella sp. PE36]
 gi|149805232|gb|EDM65249.1| flagellar hook protein FlgE [Moritella sp. PE36]
          Length = 435

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 124/443 (27%), Positives = 202/443 (45%), Gaps = 37/443 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGGLEIST 64
           S   A+SG++A    ++  ++NIANV+T G+K +   F  +   S  SN+  S G  ++T
Sbjct: 2   SFNIALSGINAAQKDLNTTANNIANVNTTGFKESRAEFGDVYATSIFSNAKTSVGNGVAT 61

Query: 65  KDMISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL----TRAGDFHINNEGFLEN 118
             +  +  QGSL  T ++ DLAI G GFF++   D +  +    TRAG F ++   F+ N
Sbjct: 62  SHIAQQFQQGSLNFTENSLDLAINGNGFFVMA--DGLESMDRNYTRAGAFKLDANSFVTN 119

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFI--SNNLDKNATIIT 176
            AG  L  Y + +  +P  V S    + + +   + + +P +TG +  + NL   + ++ 
Sbjct: 120 SAGNYLQVYDVNDDGSPKAV-SMASTKPLQIP--DTAGVPESTGNVDMTMNLPATSPLLD 176

Query: 177 PDK-TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-----KKWEVSIFRQDQS 230
           P K  P  +G    YT  +S + YD+LG S     YY K G        W    +  DQ 
Sbjct: 177 PTKFDPVDSGT---YTAATSVSIYDSLGESHTLSTYYVKDGTAGAPANSWLEFNYVDDQP 233

Query: 231 TN-------NSFPYNVAPLNTVEVSFDPVTGYLANS------SHKAISFNDNTSGIDQQI 277
            +        S P        ++++FD  +G L         +    +   N +   Q I
Sbjct: 234 VDIVGGQAVASAPGTPVKPAALQLTFDS-SGLLQQQLPVIAETVPLGAILTNGADTSQTI 292

Query: 278 TIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
            ++I+  TQ A  F   K E +G   G+     +  DG V   Y +G    +  +A+A  
Sbjct: 293 KVNINNPTQFASAFEVSKLEQDGATVGRLTGIDIGPDGMVLASYSNGRNDKLGMIAMAKF 352

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
            +E  L       +  ++ SG    G       G+I S ALE +NV++ SEL  LI AQR
Sbjct: 353 ANEQGLSQTGDTGWRASQLSGAAIAGEANSGTFGKINSSALEQSNVNLTSELVNLITAQR 412

Query: 398 NYAVNSKVFQTGSDFMDILISLK 420
           NY  NS+  +  S   D ++ ++
Sbjct: 413 NYQANSRTLEVNSKLQDTVLQIR 435


>gi|325918877|ref|ZP_08180954.1| flagellar hook protein FlgE [Xanthomonas vesicatoria ATCC 35937]
 gi|325534914|gb|EGD06833.1| flagellar hook protein FlgE [Xanthomonas vesicatoria ATCC 35937]
          Length = 407

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 114/424 (26%), Positives = 199/424 (46%), Gaps = 27/424 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLE 61
           +  T++SG++A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ 
Sbjct: 2   AFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  ++ G++ N  G
Sbjct: 61  VSNVAQQFSQGNIDPTGRSLDLAVSGEGFFTVS-SNGAKMYTRAGNFQTDSNGYVINPQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L  +    +           L+ +       S   T+T  ++  L  NAT   P  TP
Sbjct: 120 ARLQVFAPNPSGNGFDAGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTP 174

Query: 182 KHNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNV 239
                D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V
Sbjct: 175 FSPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGTA--------V 226

Query: 240 APLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
               T++ S    TG L   ++  I+   F  +T      + +++S  TQ    F  + +
Sbjct: 227 GAPTTLQFS---DTGALTTPANGVIAMDPFTPSTGAGVLNMQLNVSGATQYGEAFALRDT 283

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  
Sbjct: 284 RQDGYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYT 343

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG    G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +
Sbjct: 344 SGAARTGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTI 403

Query: 417 ISLK 420
           I+++
Sbjct: 404 INIR 407


>gi|218902868|ref|YP_002450702.1| putative flagellar hook protein FlgE [Bacillus cereus AH820]
 gi|218535884|gb|ACK88282.1| putative flagellar hook protein FlgE [Bacillus cereus AH820]
          Length = 437

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 120/450 (26%), Positives = 198/450 (44%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYD---VYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    +          S   D   V   K G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTESETVDGKVVEKPKAGEYTYSVSV-R 234

Query: 227 QDQSTNNSF----------PY---NVAPLNTVE--VSFDPVTGYLANSSHKAISFNDNTS 271
            D      F          P    N+  L   +  V  DPVTG +       I F D   
Sbjct: 235 NDSKNEKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITKGGTITIPFGDG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|121997319|ref|YP_001002106.1| flagellar basal body FlaE domain-containing protein [Halorhodospira
           halophila SL1]
 gi|121588724|gb|ABM61304.1| flagellar basal body FlaE domain protein [Halorhodospira halophila
           SL1]
          Length = 418

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 111/425 (26%), Positives = 200/425 (47%), Gaps = 42/425 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV------FPSTSNSYVSGG 59
           S   +++G+++ S  +   S+N+AN  T G+K +   F+ L        P  +   V  G
Sbjct: 2   SFNISLTGINSASKDLETTSNNLANAGTTGFKESRAEFNDLFAMGPMGIPQLA---VGQG 58

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
             ++    +  QGS   T  + DL I+G+GFF ++    V   TRAG F ++ +G++ N 
Sbjct: 59  SRLANVGQMFSQGSFDFTERSLDLGIEGRGFFRMEDDGEV-SYTRAGQFEVDRDGYIVNN 117

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  L G+      + +      G +++ +    + A  +    I+ NL  +A +I    
Sbjct: 118 TGKRLTGFQTDEDGSRI----GDGRDQLQLPTDGIPARASENVEIAANLSADADVIDEGV 173

Query: 180 T--PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI------FRQDQST 231
              P  N     +T  ++   YD+ GS+     Y+ K G+ +W+V        + Q  + 
Sbjct: 174 AFDPDDN---ETFTESTTTTLYDSQGSARDATFYFRKVGNNEWDVYTQVDGVDYEQADTE 230

Query: 232 NNSF-PYNVAPLNTVEVSFDPVTGYLANSSH----KAISFNDN---TSGIDQQITIDISK 283
            + F P+         +SFD  +G L ++      +  S  D        D  + ID  +
Sbjct: 231 GDYFGPH--------RLSFD-TSGSLVDAEGDDEGRIASLEDVPLLAEVDDLDLDIDFGE 281

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQ A  F       +G+A G+ ++ +V  DG +   Y +G    + ++A+ + PSE+ L
Sbjct: 282 MTQFARPFNVTNVSQDGYAAGEFENINVEGDGTILARYSNGEAQAVGQVALTSFPSEEKL 341

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
           +     ++  TRD+GD  IG PG  Q G + +GALE +NV+++ +L  +I AQRN++ N+
Sbjct: 342 QSVGETSWQATRDAGDPLIGVPGQGQFGRVENGALEQSNVEVSDQLVNMITAQRNFSANA 401

Query: 404 KVFQT 408
           ++  T
Sbjct: 402 QMVST 406


>gi|196033295|ref|ZP_03100707.1| putative flagellar hook protein FlgE [Bacillus cereus W]
 gi|195993729|gb|EDX57685.1| putative flagellar hook protein FlgE [Bacillus cereus W]
          Length = 437

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 120/450 (26%), Positives = 196/450 (43%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEI 62
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 63  STKDMIS------------EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           +    I               GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNVVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYD---VYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    +          S   D   V   K G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTESETVDGKVVEKPKAGEYTYSVSV-R 234

Query: 227 QDQSTNNSF-PYNVAP------------LNTVE--VSFDPVTGYLANSSHKAISFNDNTS 271
            D      F P    P            L   +  V  DPVTG +       I F D   
Sbjct: 235 NDSKNEKEFKPIEGMPDDKPLIFDNSGNLKQTDEPVQKDPVTGEITKGGTITIPFGDG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|114777402|ref|ZP_01452399.1| hypothetical protein SPV1_13919 [Mariprofundus ferrooxydans PV-1]
 gi|114552184|gb|EAU54686.1| hypothetical protein SPV1_13919 [Mariprofundus ferrooxydans PV-1]
          Length = 467

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 126/486 (25%), Positives = 208/486 (42%), Gaps = 84/486 (17%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV-----FPSTSNSY 55
           MGI  ++ +  SG+ +    V  V DNIANV+++G+K  +++F+ ++       ST +  
Sbjct: 1   MGIYNALFSGASGLTSFGEAVRVVGDNIANVNSIGFKSQSVSFTDVLSQTIGVSSTGSQQ 60

Query: 56  VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD---NVNCLTRAGDFHINN 112
           V  G++I T      QGS+ +T+S TD+AI G G F +  RD   N    +RAG F ++ 
Sbjct: 61  VGNGVKIGTISRNQMQGSIQNTSSATDMAINGNGLFAL--RDPATNQTSYSRAGSFQLDK 118

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
              L +  G ++ GY +   S   I ++       ++    L+A   +T  ++++L  ++
Sbjct: 119 NFNLIDGGGNIVQGYAIDPLSGKAIGSA------TDLSFGNLAAQAKSTANVTSSLTLDS 172

Query: 173 TI-ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
           T  + P  T  +    A +  KS    +D LG++ V    +T+ G          QD + 
Sbjct: 173 TAPVLPTGTVFNPADPATFHFKSDVTVFDALGATHVVSQQFTRMG----------QDAAG 222

Query: 232 NNSFPYN--------------------------------VAPLNTVEVSFDPVTGYLANS 259
           NN + Y+                                V  + T  + F P  G L   
Sbjct: 223 NNVWDYHTSVDGKEIVGGTAGTPTEVGAPTASTVSAGGTVTAIGTQTLVFGPA-GELVQE 281

Query: 260 SHKAISFN-------------DNTSGI----------DQQIT-IDISKTTQLAGGFIPQK 295
           +    +FN              N +G            Q IT   +  T Q+AG F  ++
Sbjct: 282 NAPPATFNWSGSAASTITLNFGNAAGQGTLYPVATADSQGITGTGLDATVQMAGAFATRQ 341

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              +G+A G     +    G V   + +G R  ++++A+A  P++  L    GN    T 
Sbjct: 342 VSKDGYAAGFLDTLTTDSSGTVSGTFTNGQRRALFQVALAKFPNDAVLNHVGGNLMQETI 401

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG   +  PG+   G I    LE +NVD+A+E  +LI  QR Y  NSK   T    +  
Sbjct: 402 QSGSPVLEKPGNGGMGTITPYGLEQSNVDLAAEFVKLIVVQRGYEANSKTILTTDQMLSS 461

Query: 416 LISLKR 421
           L+ LKR
Sbjct: 462 LMQLKR 467


>gi|229160717|ref|ZP_04288709.1| Flagellar hook protein flgE [Bacillus cereus R309803]
 gi|228622732|gb|EEK79566.1| Flagellar hook protein flgE [Bacillus cereus R309803]
          Length = 407

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 107/433 (24%), Positives = 194/433 (44%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T++SGM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSISGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSVGAKGDERYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T +A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQVAMEGNGFFVVGDSKAGNMEFTRKGTFT 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   ++  + ++   G  +I +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPADPSTGNVDLSGIPGPLQIPMGSA-IGGIRTSKGIVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
            +A  IT +                    YD  G++    + +T+ G+  ++ ++  R D
Sbjct: 180 ADAKHITQE-----------------LPVYDDAGNTWTMRMEFTQDGEHNYKYTVKMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                 F         V+  FD V      +    I FN  T      + ID+SK T   
Sbjct: 223 SKKETEFHEVQGAAGNVK--FDAVGKPDPINPEANIPFNGGT------VKIDLSKLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  + ++G      KD  ++  GYV + Y DG+     +LA+   P+E  L     
Sbjct: 275 TEKTIAVTNVDGRPAATVKDCFMADGGYVMVKYSDGSMKAAGQLAVGMFPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             +  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNFTATNTTGILALGVSGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKI 394

Query: 409 GSDFMDILISLKR 421
             + ++ +++L R
Sbjct: 395 SDEVLNEVVNLIR 407


>gi|187478185|ref|YP_786209.1| flagellar hook protein [Bordetella avium 197N]
 gi|115422771|emb|CAJ49299.1| flagellar hook protein [Bordetella avium 197N]
          Length = 406

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 114/430 (26%), Positives = 192/430 (44%), Gaps = 48/430 (11%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
            +SG+ A S  +  + +NIAN  T+G+K  + +F+ +     +NS V  G++++  +   
Sbjct: 6   GLSGLQAASQNLDVIGNNIANSGTIGFKSGSTSFADVY----ANSRVGLGVKVAAVNQRF 61

Query: 70  EQGSLMHTASNTDLAIQG-KGFF-IVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGY 127
             G++  T    D+AI G KGFF +    DN+   TR+G+F I+   F+ N  G  L GY
Sbjct: 62  TAGTVSGTGGEYDIAIDGAKGFFRVTDASDNI-VYTRSGEFGIDKNFFITNAMGYRLTGY 120

Query: 128 PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRD 187
           P+      L+         + V  A ++   T    I  NL+ NA I+ P          
Sbjct: 121 PVGGIGTNLV--------PLQVPQANIAPQETNAASIQTNLNANAKIV-PAAPAFDPANQ 171

Query: 188 AEYTHKSSFAAYDTLGSS----------------VVYDVYYTKTGDKKWEVSIFRQDQST 231
             YT       YD+LG+S                 VYD+YYT  G          +  + 
Sbjct: 172 DTYTDLVPTTIYDSLGNSHQMVQYFVKRAPVNGESVYDIYYTVDG----------KPATV 221

Query: 232 NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS-GIDQQITIDISKTTQLAGG 290
           +   P +    N+  V    +TG   N   +       TS   D  + ++    T     
Sbjct: 222 DGGQPSSRLTFNSAGV----LTGGQPNRDIEITGLGSTTSPARDITVRMNYQNVTHFGSD 277

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F P K   NG++ G+    S+ K+G +   Y +G    +  +A+A   +   LK    ++
Sbjct: 278 FGP-KVTANGYSSGEFSGISIEKNGTIMAKYTNGESQAVGTIALANFNNVGGLKPVGDSS 336

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           ++ T +SG   +G PG N    +F  ALE +NV+++ EL  +I AQR Y  N++  +T  
Sbjct: 337 WVETGESGQAIMGQPGTNGLATLFGQALEQSNVEMSQELVNMIVAQRTYQANAQTIKTQD 396

Query: 411 DFMDILISLK 420
           + + +LI+++
Sbjct: 397 EVLQVLINMR 406


>gi|78047586|ref|YP_363761.1| flagellar hook protein FlgE [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78036016|emb|CAJ23707.1| flagellar hook protein FlgE [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 407

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 114/423 (26%), Positives = 200/423 (47%), Gaps = 27/423 (6%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLEI 62
             T++SG++A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ +
Sbjct: 3   FNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAVSGEGFFTVW-SNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVA 240
           +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V 
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVYNYVDGAA--------VG 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
              T++ S    TG L   ++  I+   F  +T      + ++++ +TQ    F  + + 
Sbjct: 228 APTTLQFS---DTGALTTPANGIIAMDPFTPSTGAGVLNMQLNVTGSTQYGEAFALRDTR 284

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  S
Sbjct: 285 QDGYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTS 344

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G    G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I
Sbjct: 345 GAARTGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTII 404

Query: 418 SLK 420
           +++
Sbjct: 405 NIR 407


>gi|326204617|ref|ZP_08194473.1| fagellar hook-basal body protein [Clostridium papyrosolvens DSM
           2782]
 gi|325985184|gb|EGD46024.1| fagellar hook-basal body protein [Clostridium papyrosolvens DSM
           2782]
          Length = 443

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 118/450 (26%), Positives = 209/450 (46%), Gaps = 38/450 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + +SG+ A   ++  + +N+ANV+T+G+K   + F  +   +            
Sbjct: 1   MMRSMFSGVSGLKAHQAKMDVIGNNVANVNTLGFKAGRVTFQEIFNQTLRGAGAPDAATA 60

Query: 51  ---TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAG 106
              T+   +  G+ + + D     GS   T + TDL+I G GFFIVKG   +    TRAG
Sbjct: 61  RGGTNPMQIGLGIAVGSIDNQMTGGSPQRTDNPTDLSISGNGFFIVKGSAADTFKFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPLK----------NASAPL-IVNSFQGLERINVKHAELS 155
           +F ++  G L +  G  + G+             +  AP+  +N +   +  N     ++
Sbjct: 121 NFGLDKLGNLVSGDGMNVYGWTKYEQQGDGTVKFDTEAPIGPINLYS--DATNGNKKIIA 178

Query: 156 AMPTTTGFISNNLDK-NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK 214
           A  TT    S NL+     + TP  TP  +  D ++     +  +D+LG++    + +TK
Sbjct: 179 AKATTYAEFSGNLNSAQKAVATPPATPPAS--DEQFIMP--YTVFDSLGNAHEMTLTFTK 234

Query: 215 TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN-DNTSGI 273
                   +          +    V    T  + FD   G L + +  +I      T+G 
Sbjct: 235 AAPTGTPPTTTWTYTLAAKAGDGTVPIPTTGTLKFDG-EGKLTSDTVNSIKVTMTPTAGA 293

Query: 274 DQ-QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRL 332
           +   +T+D  K TQ +G    + S ING+  G    F++  DG +  +Y +G + P+  +
Sbjct: 294 NPFDVTLDFKKLTQFSGDSSVKPSNINGYTTGNLVTFNIGSDGMITGVYSNGQQQPLGLI 353

Query: 333 AIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQH-GEIFSGALETANVDIASELTE 391
           A+A   +   L+   GN ++PT +SGD + G P  +Q  G +  G LE +NVD++ E T+
Sbjct: 354 ALAGFDNPAGLQKVGGNLFMPTTNSGDFNKGVPAGSQGVGTLSPGTLEMSNVDLSREFTD 413

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +I  QR +  NS++  T  + +  L++LKR
Sbjct: 414 MIVTQRGFQANSRIITTSDEMLQELVNLKR 443


>gi|328545575|ref|YP_004305684.1| FlgE protein [polymorphum gilvum SL003B-26A1]
 gi|326415316|gb|ADZ72379.1| FlgE protein [Polymorphum gilvum SL003B-26A1]
          Length = 418

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 120/439 (27%), Positives = 202/439 (46%), Gaps = 39/439 (8%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M ++G++ +A+S + AQS  +S VS N+AN  T  YK ++ +F+SLV  +TS+S     +
Sbjct: 1   MSLMGALNSAISSLYAQSQALSNVSSNLANSQTTAYKASSTSFTSLVAGTTSSSSGG--V 58

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLEN 118
             ST+  +SEQG L+ ++S+T LAI+G GFF+V           TR G+F I+  G+L N
Sbjct: 59  VASTRSSVSEQGLLVSSSSSTHLAIEGSGFFVVSSEVSGGQTYYTRNGEFEIDANGYLTN 118

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  LLG+    +  P+   S   L  I+V   + S   T+   +  NL  +A +    
Sbjct: 119 -GGYYLLGWATDASGNPVAGTSEASLVPIDVDSVKSSVGATSNVTMQANLPADAAV---- 173

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
                       +  ++   YD+LG++    V +TKT    WE+S F        +    
Sbjct: 174 ----------GDSFDTTIEVYDSLGTTNTITVTWTKTDANTWEMS-FADPTLAGGTAASG 222

Query: 239 VAPLNTVEVSF---------DP------VTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                 V ++F         DP      + G+   ++  AI+ N  T G    +T   S 
Sbjct: 223 TVTSTPVTITFNSDGTLAVTDPSPAELTIAGWTTGAADSAIALNLGTLGAANGLTQYASG 282

Query: 284 TTQLAGGFIP-QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           +T     +I  Q    +G A G      +  DG V   +D+G +  IY++ +AT P+ + 
Sbjct: 283 STDP---YIAIQSITQDGLAYGALTGVEIGADGSVTAFFDNGEQRVIYKIPVATFPNANG 339

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L       Y  +  SG+ ++   G    G I  G LE +  D ++E + ++ AQ+ Y+  
Sbjct: 340 LTEMSNGIYARSSYSGNSTLHLAGTGGVGTINGGYLEASTTDTSTEFSRMLTAQQAYSAA 399

Query: 403 SKVFQTGSDFMDILISLKR 421
           S++    ++    L+   R
Sbjct: 400 SQILSASNEMFQSLMQAVR 418


>gi|241766920|ref|ZP_04764726.1| flagellar basal body FlaE domain protein [Acidovorax delafieldii
           2AN]
 gi|241362624|gb|EER58472.1| flagellar basal body FlaE domain protein [Acidovorax delafieldii
           2AN]
          Length = 425

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 117/439 (26%), Positives = 197/439 (44%), Gaps = 39/439 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGGLEIST 64
           S +  +SG++A S  +  +  NIAN +T G+K +   F+ +V  +  S    + G+ + T
Sbjct: 2   SFQQGLSGLNASSKNLDVIGHNIANANTTGFKASRAEFAEMVASAIGSAGGNNAGIGVET 61

Query: 65  KDMISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
            ++  +  QG+L  T ++ D+AI G GFF ++  D     TRAG+F ++  G +      
Sbjct: 62  ANVAQQFTQGNLTITGNSLDVAINGNGFFTLQQPDGSPAYTRAGNFKLDKTGNMVTNDNA 121

Query: 123 VLLGYP------LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
            ++GYP      L++ +AP+ +  F   E I  K        TT      NLD  A    
Sbjct: 122 KVMGYPVDPLTGLRSGTAPVPM-VFPTAEPIPAKQ-------TTKIMAGFNLDARAPDAA 173

Query: 177 --PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
             P  TP         T+ +S   YD+ G +    +Y+ K G   W+V  + +      S
Sbjct: 174 GNPAATPPIPAT-PRATYGTSINVYDSQGVAKPVSLYFQKNGANTWDV--YDKLDDPKAS 230

Query: 235 FPYNVAPLNTVEVSFD------------PVTGYLANSSHKAISFNDNTSGIDQ-QITIDI 281
            P    P+   ++ FD            P T +L N +      N N  G+    + I++
Sbjct: 231 PPVVATPIG--QIKFDNNGAIVSPAPVAPSTEHLLNLTIAPSPPNPN--GLPTFPVDINL 286

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
            K TQ    F       +G+  G+    +V  +G +   Y +G      +LA+A+  +  
Sbjct: 287 DKVTQFGTKFAVSDLTQDGYTAGELTGINVENNGMIMTRYSNGVTRAEGQLALASFRNTQ 346

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L    GN ++ T +SG   +G       G + SGALE +NVD+ +EL  ++ AQR Y  
Sbjct: 347 GLAAVGGNNWVETFESGQPVLGTATDGNFGALRSGALEDSNVDLTAELVNMMTAQRAYQA 406

Query: 402 NSKVFQTGSDFMDILISLK 420
           N++  +T    M  L++L+
Sbjct: 407 NAQTIKTQDQVMSTLVNLR 425


>gi|37525841|ref|NP_929185.1| flagellar hook protein FlgE [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785270|emb|CAE14211.1| Flagellar hook protein FlgE [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 404

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 116/436 (26%), Positives = 196/436 (44%), Gaps = 62/436 (14%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A +  +  + +NIAN  T G+K + +AFS +     + S V  G+++S  +   
Sbjct: 6   AVSGLNAAAGNLDVIGNNIANAATYGFKSSTVAFSDIF----AGSQVGLGVKVSGVNQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
           + G+   T    DLAI   GFF ++G D     +R G F ++    + N+ G  L GYP 
Sbjct: 62  KDGTPTTTNRTLDLAITQGGFFRMQGGDGGIYYSRNGQFKMDENRNIINMQGMKLTGYPA 121

Query: 130 K--NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRD 187
              N  AP I       E I +    L A  TT   ++ NL+      T   +P++N   
Sbjct: 122 ASVNGGAPEIQKGAN-PEPITIPQGILMAKATTKVTMTANLNSMHKKPTEAFSPENN--- 177

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST---------------- 231
             Y + +S   +D+LG+     V++ KT D +W+V    QD +                 
Sbjct: 178 DSYNYPTSVTTFDSLGNPHAIQVFFVKTNDNEWQV--HAQDSAVEGAKAASLGTLKFDGN 235

Query: 232 ------NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID-ISKT 284
                 NN F +NV  LN             +N++   I FN +     Q+I  D IS  
Sbjct: 236 GKLIGDNNQFTFNVPSLNG------------SNAADITIDFNGSK---QQKIDTDSISAP 280

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
            Q            +G+A G+ K + + +DG V   Y +     + ++ +    + + L 
Sbjct: 281 KQ------------DGYAAGEFKGYRIEQDGRVIGTYTNEQSQLLGQIVLTNFANPEGLA 328

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
               N ++ T  SG+  +G       G++ SG+LE +NVD++ EL  +I AQRNY  +++
Sbjct: 329 AKGDNVWVETSASGNPVVGIADSGGFGKLLSGSLEASNVDMSQELVNMIVAQRNYQSSAQ 388

Query: 405 VFQTGSDFMDILISLK 420
             +T    +  L+S++
Sbjct: 389 TIKTQDQILQTLVSMR 404


>gi|218896686|ref|YP_002445097.1| flagellar hook protein [Bacillus cereus G9842]
 gi|228900335|ref|ZP_04064565.1| Flagellar hook protein flgE [Bacillus thuringiensis IBL 4222]
 gi|218545583|gb|ACK97977.1| flagellar hook protein [Bacillus cereus G9842]
 gi|228859370|gb|EEN03800.1| Flagellar hook protein flgE [Bacillus thuringiensis IBL 4222]
          Length = 407

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 109/439 (24%), Positives = 192/439 (43%), Gaps = 52/439 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
                IT D                    YD  G++              W + + F+Q 
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNT--------------WTMRVEFKQT 208

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISF-NDNTSGID-----QQITIDIS 282
              N ++   +   +  E  F  V G   N +  A+   N    G +       I +D+S
Sbjct: 209 SEHNYTYKVQMRNDSKKETEFKDVQGAGGNMTFDAVGNPNPKEQGANIPFDGGSIKLDLS 268

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
             T          ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  
Sbjct: 269 HLTNHPTDKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGG 328

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L       Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N
Sbjct: 329 LMKTGNGNYTATNTTGILALGASGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGN 388

Query: 403 SKVFQTGSDFMDILISLKR 421
           +KV +   + ++ +++L R
Sbjct: 389 AKVIKVSDEVLNEVVNLIR 407


>gi|157371207|ref|YP_001479196.1| flagellar hook protein FlgE [Serratia proteamaculans 568]
 gi|157322971|gb|ABV42068.1| flagellar basal body FlaE domain protein [Serratia proteamaculans
           568]
          Length = 407

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 109/422 (25%), Positives = 205/422 (48%), Gaps = 31/422 (7%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A +  +  + +NIAN  T G+K   ++F+ +     + S V  G++++      
Sbjct: 6   AVSGLNAAATNLDVIGNNIANSATSGFKSGTVSFADMF----AGSQVGLGVKVAGITQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
           + G+   T+   D+AI G GFF ++ +D     +R G F ++    L N+ G  L GYP 
Sbjct: 62  KGGTTTGTSRALDVAISGNGFFRMQDQDGGVFYSRNGQFKLDENRNLTNMQGLQLTGYPA 121

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
             A  P  +        +++    ++A  +T+G +  NL   +T   PD       +   
Sbjct: 122 --AGTPPTIQQGANPVPLSIPEGMMNAKASTSGTMVANLK--STHKVPDNKTFDPAKQDS 177

Query: 190 YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSF 249
           Y + ++  AYD+LG++   + Y+ KT + KW+V  + QD S         AP++   ++F
Sbjct: 178 YNYVNTITAYDSLGNAHNINAYFVKTDENKWQV--YTQDGS--------AAPVDAGTMTF 227

Query: 250 DPVTGYLANSSHKA---------ISFNDNTSGIDQQITIDISKTTQ--LAGGFIPQKSEI 298
           D  +G L  ++ K          +  +       Q +++  +K+ Q  ++   + + S+ 
Sbjct: 228 D-TSGNLTGTTSKQGTAAEFSMLVPMSAKDGAPAQNLSLSFAKSMQQSVSADSVSKVSQ- 285

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G+  +F ++ DG V  IY +     + ++ +A   + + L     N +  T  SG
Sbjct: 286 DGYGAGEYTNFQINNDGTVVGIYSNQQTQVLGQIVMANFSNPEGLSSQGDNVWQETGASG 345

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
              +G  G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    +  L+S
Sbjct: 346 QPRVGIAGGGGFGKLTSGALEASNVDLSQELVNMIVAQRNYQSNAQTIKTQDSILQTLVS 405

Query: 419 LK 420
           L+
Sbjct: 406 LR 407


>gi|161777623|ref|YP_427619.2| flagellar hook protein FlgE [Rhodospirillum rubrum ATCC 11170]
          Length = 460

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 143/460 (31%), Positives = 212/460 (46%), Gaps = 50/460 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-GLEIST 64
           S+  A+S M+AQS+ VSA+S+N+AN  T+GYK +  +F SLV  + S S  +G G+  S 
Sbjct: 7   SLNVAVSAMNAQSSSVSAISNNLANSSTIGYKTSNASFYSLVTGTGSTSNFTGAGVVASA 66

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVAGG 122
              +  QG ++ T + TDLA+ GKG FIV  R   N L  TRAGDF+ N +G L N    
Sbjct: 67  TQNVINQGVIVGTQNVTDLAVDGKGMFIVTDRSGSNELYYTRAGDFYPNADGDLVNSNNY 126

Query: 123 VLLGYPLKNASAPLI--VNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
            L GYP      PL    NS   LE IN+  A  +A  T+   I   L   AT       
Sbjct: 127 YLQGYPTDRNGVPLTNTGNSGASLETINLAGATGAAKATSEMSIQAVLPAQATAGDSTAV 186

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS------ 234
           P      A YT  S    YD+LG +    V +TK  D KW ++++    S++ +      
Sbjct: 187 PPV----AAYTSSSDVEIYDSLGVAHTMTVKWTKMSDTKWTMTLYDPKLSSDMTGDATGA 242

Query: 235 ----------FPYNVAPLNT-----VEVSFDPVTGYLANSSHKAISFN-DNTSGIDQQIT 278
                      P N  P  T     V+V F    G L   S  A+    D ++G    I+
Sbjct: 243 ISSTTTGVTDVPANAGPPATSHGIAVDVEFTD-QGLLKTPSVLALKITPDASNGTGAAIS 301

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPK-DF----------------SVSKDGYVDIIY 321
            +I+     AG      +  N  + GKP  D                 ++SK G V   +
Sbjct: 302 -EIALNLGTAGKANGLSTYSNEDSDGKPAVDLKKVVQDGVTYGTYYSNTISKAGLVYANF 360

Query: 322 DDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETA 381
            +G   PIY++ +A   + + L+   G  Y  T  SG  +    G    G + SG++E++
Sbjct: 361 TNGISYPIYQVPLAMFSNVNGLEAVSGTAYSATVKSGTPTYVTAGTGGSGGVSSGSVESS 420

Query: 382 NVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            VD A+E ++LI +Q+ Y+  +++  +  +    LIS KR
Sbjct: 421 TVDTAAEFSKLIVSQQAYSAATQIISSNQEMFQNLISAKR 460


>gi|326791535|ref|YP_004309356.1| flagellar hook-basal body protein [Clostridium lentocellum DSM
           5427]
 gi|326542299|gb|ADZ84158.1| flagellar hook-basal body protein [Clostridium lentocellum DSM
           5427]
          Length = 432

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 126/455 (27%), Positives = 198/455 (43%), Gaps = 59/455 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ SM +A+SG+     R+  + +NIANV+T+GYK   + F+  VF  T +S        
Sbjct: 1   MMRSMFSAVSGLRVHQTRMDVIGNNIANVNTIGYKSQRVTFND-VFSQTLSSASAASDET 59

Query: 55  --------YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAG 106
                    V  G+ +S+ DM+  QG+   T +  DL I G+GF +V G  N    TRAG
Sbjct: 60  GRGGRNPMQVGLGVNVSSIDMLMTQGAAQRTDNPFDLMINGEGFIVV-GDTNGTYFTRAG 118

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
               + +G L      +  G  +K  +A L           N +  +   +    G I N
Sbjct: 119 ALRADVDGNLI-----IANGMKVKGWTAQL-----------NEETNKYEIVKGEAGSI-N 161

Query: 167 NLDKNATIITPDKTPK----HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--- 219
             D N     P  T K     N        +++F  YD+LG+        T + DK    
Sbjct: 162 LADPNFVSSKPKVTDKLQLSGNLNSTSTKEETNFRFYDSLGNYYSLATTLTPSTDKVDGY 221

Query: 220 --WEVSIFRQDQSTNNSFPYNVAPLNTVEVSFD---------PVTGYLANSSH--KAISF 266
             WE+ +     +  N     ++P   V++ FD          V G   N++     I  
Sbjct: 222 SVWEMKLGDIKDANGNKLNGTLSPDTAVKLYFDTNGKLASVGAVPGATGNATSIDLEIEN 281

Query: 267 NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
            D TS   ++ITID S  TQ A         ING+A GK   + +  DG +   YD+G  
Sbjct: 282 TDKTSTFAEKITIDFSSMTQYASASTIDPKTINGNAAGKMIGYEIGGDGVITASYDNGDM 341

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             + ++ +A   + + L+    N Y  T +SG+    F G    G   +G LE +NVD++
Sbjct: 342 RILAQVVVAKFDNPEGLEKVGDNLYKVTPNSGE----FDGIGTVGTFNTGVLEMSNVDLS 397

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           SE T++I  QR +  NS++     + +  L +LKR
Sbjct: 398 SEFTDMIVTQRGFQANSRIISVSDEMLQELTNLKR 432


>gi|120613059|ref|YP_972737.1| hypothetical protein Aave_4423 [Acidovorax citrulli AAC00-1]
 gi|120591523|gb|ABM34963.1| protein of unknown function DUF1078 domain protein [Acidovorax
           citrulli AAC00-1]
          Length = 425

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 116/432 (26%), Positives = 192/432 (44%), Gaps = 25/432 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEI 62
           S +  +SG++A S  +  +  N+AN  TVG+K +   F+ +V     S   +    G+E+
Sbjct: 2   SFQQGLSGLNAASKNLDVIGHNVANSGTVGFKASRAEFAEMVANAIGSAGGTNAGIGVEL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T ++ D+AI G GFF ++  D  +  TRAG+F +++ G L      
Sbjct: 62  SAVAQQFNQGNISVTGNSLDVAINGDGFFTLQQPDGSHAYTRAGNFKLDSNGQLVTNTKA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GY L   +     ++   L     K   + A  TTT     NLD  A     D T  
Sbjct: 122 QVMGYALDPITGKRTASNAAPLTFPTSK--PIPAKQTTTITAEFNLDARAPDAAGDATAT 179

Query: 183 HN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                    T+ +S   YD+ G +    +Y+ K G   W+V   R D +T N  P    P
Sbjct: 180 PPVPATPRSTYGTSINVYDSQGVAKPVSLYFQKNGANTWDV-YDRLDDATANP-PVVATP 237

Query: 242 LNTVEVSFD------------PVTGYLANSSHKAISFNDNTSGI-DQQITIDISKTTQLA 288
           +   ++ FD            P TG+    + K    N N  G+ D  + I +   +Q  
Sbjct: 238 IG--QIKFDNSGKIVSPAATAPETGFQMPLTVKPTPPNPN--GLADYTVNIKLDGVSQYG 293

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
             F       +G+  G+    S+  +G V   Y +G      ++A+A+  +   L     
Sbjct: 294 KAFAVSNLSQDGYTAGELTGISIENNGTVMTRYSNGVTRAEGQVALASFRNTQGLASVGN 353

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N ++ T  SG   +G P   + G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T
Sbjct: 354 NNWVETFQSGQPVLGTPTEGKFGGLRSGALEDSNVDLTAELVNMMTAQRAYQANAQTIKT 413

Query: 409 GSDFMDILISLK 420
               M  L++L+
Sbjct: 414 QDQVMSTLVNLR 425


>gi|229102353|ref|ZP_04233061.1| Flagellar hook protein flgE [Bacillus cereus Rock3-28]
 gi|229115194|ref|ZP_04244604.1| Flagellar hook protein flgE [Bacillus cereus Rock1-3]
 gi|228668334|gb|EEL23766.1| Flagellar hook protein flgE [Bacillus cereus Rock1-3]
 gi|228681000|gb|EEL35169.1| Flagellar hook protein flgE [Bacillus cereus Rock3-28]
          Length = 407

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 106/432 (24%), Positives = 192/432 (44%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
                IT D                    YD  G++    V + +T +  +   +  ++ 
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFKQTSEHNYTYKVQMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +   +V       ++FD V           I F+  +      I +D+S  T    
Sbjct: 223 SKKETEFKDVQGAGG-NMTFDAVGNPNPKEQRANIPFDGGS------INLDLSHLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 DKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILALGASGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKVS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|83814503|ref|YP_446705.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Salinibacter ruber DSM 13855]
 gi|294508641|ref|YP_003572700.1| flagellar hook protein FlgE [Salinibacter ruber M8]
 gi|83755897|gb|ABC44010.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Salinibacter ruber DSM 13855]
 gi|294344970|emb|CBH25748.1| Flagellar hook protein FlgE [Salinibacter ruber M8]
          Length = 432

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 124/452 (27%), Positives = 204/452 (45%), Gaps = 56/452 (12%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---------SN- 53
           L S+   +SG+ +   R+  VS+NIAN  T  +KR   AFS  +  +          SN 
Sbjct: 3   LQSLSIGVSGLRSHQTRLDTVSNNIANSSTTAFKRQRAAFSEELGQAILGVGRTAGGSNI 62

Query: 54  --SYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC----LTRAGD 107
             S V  G+ +++ D    QGSL  T   TDLA+ G GFF+   +         LTRAG+
Sbjct: 63  NPSKVGRGVSVASIDRNFSQGSLNDTGIKTDLALNGDGFFVASPKSGAASDQRRLTRAGN 122

Query: 108 FHINNEGFLENVAGGVLLGYPL-KNASAPLIVNSFQGLERINVK---HAELSAMPTTTGF 163
           F  N  G L    G  + G+ + ++ +A          E  NV+   +A+ +A  TT   
Sbjct: 123 FTFNQNGELVTANGLNVQGWEVGEDGTANT-------GELKNVQFDPNAQSAAKATTEAQ 175

Query: 164 ISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS 223
           +  NL  +A              +A  T + S   YD  G +    + +  T +  W  S
Sbjct: 176 VGGNLSADA--------------EAGDTSEISSVVYDEQGKAHNVVINFENTSEDTWTFS 221

Query: 224 IFRQD---QSTNNSFPYNVAPLNTV--EVSFDPVTGYL------ANSSHKAISF---NDN 269
           +   D   Q  N   P +     T   + S D ++G         N ++  +S    ND 
Sbjct: 222 VEDPDGVLQDANGGGPGDANGTITFKDDGSVDSISGMTNAYDPDGNGTNDGVSLDWTNDA 281

Query: 270 TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
             G  + + I +   TQ +G    +    NG++ G+      + +G + + Y +G +   
Sbjct: 282 VQG-GKSLGISLRDITQFSGSTTSKFQGQNGNSSGELSGVQFTPEGKLQLNYTNGVQEEE 340

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASEL 389
           Y+LAI  V + + L+    N +  T  SGD+ +G  G +    + SGALE++NVD+A E 
Sbjct: 341 YQLAIGDVNNPNGLEQQGENFFTTTGASGDLQLGRAGRDLQTSVVSGALESSNVDLAKEF 400

Query: 390 TELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ++LI+AQR+Y  +S++  T  + ++  + LKR
Sbjct: 401 SDLIKAQRSYQASSQIITTADEVLNQTVQLKR 432


>gi|296126058|ref|YP_003633310.1| fagellar hook-basal body protein [Brachyspira murdochii DSM 12563]
 gi|296017874|gb|ADG71111.1| fagellar hook-basal body protein [Brachyspira murdochii DSM 12563]
          Length = 441

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 113/455 (24%), Positives = 204/455 (44%), Gaps = 50/455 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  V +NIANV+T G+KR  + F  ++  S S +        
Sbjct: 1   MMRSLFAGVSGLQNHQTRMDVVGNNIANVNTYGFKRGRVTFKDMISQSLSGAAKPQEDRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+L  T  NTDLAIQG+GFFI K R N +  TR G F 
Sbjct: 61  GINPQQVGLGMMVATIDTIHTQGALQVTGVNTDLAIQGEGFFIEK-RGNNSYYTRNGAFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ +G+L N +    +GY ++  +A  ++N   G         EL+        I     
Sbjct: 120 LDRDGYLVNPS----IGYKVQGWNA--VLNPETG-------EMELNTAAGVEDLIIPVGS 166

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
           K+    T +     N + +  TH+S    YD+ G        +T+T   +W+++I   D 
Sbjct: 167 KDPARATANTKYFCNLQKSGETHQSDLTIYDSTGIPRQLRATFTRTDVNRWDMTIDIPDA 226

Query: 230 -----STNNSFPYNVAPLNTVEVSFDPVTGYLANSS------------HKAISFNDNTSG 272
                S +   P      NT ++ F+     ++ S             + + ++      
Sbjct: 227 TEGSVSVSAGDPVEGGGNNTFQLVFNDAGSLISVSDGTNTQTEGVLMPNVSFTYQGTEGE 286

Query: 273 IDQQITIDISKT------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
           ++Q I + + +       TQ       +  E +G+  G  + FS    G +  ++ +G R
Sbjct: 287 VNQTINLTMGEVGLFNGITQFESPSTTKAIEQDGYTMGMLEGFSFDDSGQITGVFTNGNR 346

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             + ++A+A   +   L+      ++ + +SG  +IG       G + +GALE +NVD++
Sbjct: 347 KTLGQVALAKFNNAGGLEKAGDTLFVASNNSGAANIGTAAAEGRGSLKAGALEMSNVDLS 406

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            + T++I  QR +  N++   T    +  +I+LKR
Sbjct: 407 EQFTDMIVTQRGFQSNARTITTADQMLQEVIALKR 441


>gi|194365680|ref|YP_002028290.1| flagellar hook protein FlgE [Stenotrophomonas maltophilia R551-3]
 gi|194348484|gb|ACF51607.1| flagellar basal body FlaE domain protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 407

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 192/420 (45%), Gaps = 27/420 (6%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLEISTK 65
           ++SG++A ++ +S  ++N+ANV+T G+K +   F+ L F +T    S + V  G+ +S  
Sbjct: 6   SLSGINAANSDLSVTANNVANVNTTGFKESRAEFADL-FSATGYGLSKNAVGSGVRVSNV 64

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               +QG    T  + D+AI G+GFF +   +     +RAG+F  +  G++ N  G  L 
Sbjct: 65  AQQFKQGHNEQTGRSLDMAISGEGFFTMN-MNGTRVYSRAGNFQTDPSGYVINPQGARLQ 123

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
            +                L+ +    A         GF      K  T+ T D T  +  
Sbjct: 124 VFAPNADGTNFDAGRMVDLQLLTTDSAPKQTSEVKVGFTLPANAKQPTVTTFDPTDSN-- 181

Query: 186 RDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVAPLN 243
               Y H S     YD+LG S +   Y+ K  +  +W V  +   Q      P       
Sbjct: 182 ---SYNHSSGGITVYDSLGVSHIQVSYFVKGANPNEWTVRNYVDGQPAGAPTP------- 231

Query: 244 TVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
              V+FD  +G L   ++  +S   F   T      +T+D+S +TQ    F  + ++ +G
Sbjct: 232 ---VTFDN-SGKLTAPANGKVSLGTFTPTTGAGVLNMTLDVSGSTQYGEKFALRNTQQDG 287

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +A GK  + +VS+ G V   Y +G   P+ ++A+ T  +   L+    N ++ T  SG  
Sbjct: 288 YAAGKLNEITVSETGVVYARYSNGADKPLGQVALTTFNNPQGLESKGNNLWVDTFSSGTP 347

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G P  +  G+I +G+LE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 348 RTGMPDTSNLGKIQAGSLEASTVDLTEQLVNMITAQRNFQANAQMITTQDQITQTVINIR 407


>gi|222095377|ref|YP_002529437.1| flagellar hook protein flge [Bacillus cereus Q1]
 gi|221239435|gb|ACM12145.1| flagellar hook protein [Bacillus cereus Q1]
 gi|324325771|gb|ADY21031.1| flagellar hook protein FlgE [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 406

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 106/432 (24%), Positives = 192/432 (44%), Gaps = 39/432 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDGNYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  I+ +                    YD  G++    V +T+T +  +   +  ++ 
Sbjct: 180 ADAKAISQE-----------------IPIYDNAGNTWTMRVEFTQTSEHNYSYKVQMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S    F  +V       ++FD V           I FN         + +D+S  T    
Sbjct: 223 SKKEEFK-DVQGAGG-NMTFDAVGNPSPKEQAANIPFNGG------NVKLDLSNLTNHPT 274

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 + ++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 275 DKTLSVTGVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLMKTGNG 334

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G+I   A E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 335 NYTATNTTGILALGASGQNGAGKIRGAAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKVS 394

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 395 DEVLNEVVNLIR 406


>gi|229096239|ref|ZP_04227212.1| Flagellar hook protein flgE [Bacillus cereus Rock3-29]
 gi|228687199|gb|EEL41104.1| Flagellar hook protein flgE [Bacillus cereus Rock3-29]
          Length = 407

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 106/432 (24%), Positives = 192/432 (44%), Gaps = 38/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKSDGKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G I  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGTIKGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
                IT D                    YD  G++    V + +T +  +   +  ++ 
Sbjct: 180 TGEKQITQD-----------------LPVYDNAGNTWTMRVEFKQTSEHNYTYKVQMRND 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           S   +   +V       ++FD V           I F+  +      I +D+S  T    
Sbjct: 223 SKKETEFKDVQGAGG-NMTFDAVGNPNPKEQRANIPFDGGS------INLDLSHLTNHPT 275

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 ++++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L      
Sbjct: 276 DKTLSVTDVDGRAAATVKDCFIADGGYVMVKYSDGSMKSAGQLAVAMFPNEGGLMKTGNG 335

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV +  
Sbjct: 336 NYTATNTTGILALGASGQNGAGKVRGGAQEGANVDLSIEFVDLMLYQRGFQGNAKVIKVS 395

Query: 410 SDFMDILISLKR 421
            + ++ +++L R
Sbjct: 396 DEVLNEVVNLIR 407


>gi|229109210|ref|ZP_04238809.1| Flagellar hook protein flgE [Bacillus cereus Rock1-15]
 gi|228674220|gb|EEL29465.1| Flagellar hook protein flgE [Bacillus cereus Rock1-15]
          Length = 406

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 107/437 (24%), Positives = 192/437 (43%), Gaps = 49/437 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKADDKYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T   T  A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKLSGTVTDYSDGTITLTGGKTQAAMEGNGFFVVGDSKGGNMEFTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   A+  + ++   G  +I +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTEGQYVFAYPANEATGEVDLSGIPGPLQIPMGTA-IGGIRTSKGVVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A  I+ +                    YD  G++    V +T+T +  +   +  ++ 
Sbjct: 180 ADAKAISQE-----------------IPIYDNAGNTWTMRVEFTQTSEHNYSYKVQMRND 222

Query: 230 STNNSFPYNVAPLNTVE-----VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT 284
           S    F         VE     ++FD V           I FN         I +D+S  
Sbjct: 223 SKKEGFK-------DVEGAGGNMTFDAVGNPSPKEQAANIPFNGG------NIKLDLSNL 269

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           T          + ++G A    KD  ++  GYV + Y DG+     +LA+A  P+E  L 
Sbjct: 270 TNHPTDKTLSVTGVDGRAAATVKDCFIADGGYVMVKYSDGSMKAAGQLAVAMFPNEGGLM 329

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
                 Y  T  +G +++G  G N  G++   A E ANVD++ E  +L+  QR +  N+K
Sbjct: 330 KTGNGNYTATNTTGILALGASGQNGAGKVRGSAQEGANVDLSVEFVDLMLYQRGFQGNAK 389

Query: 405 VFQTGSDFMDILISLKR 421
           V +   + ++ +++L R
Sbjct: 390 VIKVSDEVLNEVVNLIR 406


>gi|306820122|ref|ZP_07453770.1| flagellar hook protein FlgE [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304551900|gb|EFM39843.1| flagellar hook protein FlgE [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 474

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 124/482 (25%), Positives = 213/482 (44%), Gaps = 71/482 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAF----SSLVFPSTSNSYVSG 58
           ++ SM +A+S +     R+  + +NIANV+TV +K     F    S L   ++ +S   G
Sbjct: 1   MMRSMNSAVSSLKNHQARMDVIGNNIANVNTVAFKAARTTFKDTYSQLTRAASGSSGDRG 60

Query: 59  G---------LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
           G         + +S+ D   ++G++  T  NTDL I G+GFF+V G D     TR G+F 
Sbjct: 61  GINPGQIGLGMNLSSIDNAMDKGTVETTNINTDLYIDGEGFFMVDGPDG-RFYTRDGNFG 119

Query: 110 INNEGFLENVAGGVLLGY-----------------PLKNASAPLIVNSFQGLERINVKHA 152
           ++ EG+L N  G  ++GY                 P+K+   P + ++ Q    ++ K A
Sbjct: 120 VDEEGYLVNKNGNYVMGYQADKDGNIIEKIDKIQVPIKDVLKPKVTSNIQLEGNLSSKTA 179

Query: 153 E--LSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDV 210
           E   S +P T   I +   K      P K   +  +  E    SS      +G ++   V
Sbjct: 180 EGLPSPLPNTLATIYDK--KPVDPADPSKGFTYTVK-PELAEGSSPKRESIIGKTITTSV 236

Query: 211 YYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSH--------- 261
             +  G+   +V   ++  +T +++ +   P    + +  PVTG   N++          
Sbjct: 237 IDSLGGEHTIQVDFVKEGPNTWSAYAFYKTP----DGAMVPVTGSTINTNPATTADGKAL 292

Query: 262 -----------------KAISFNDNTSGID-----QQITIDISKTTQLAGGFIPQKSEIN 299
                            K ++F  + SGI+         I +S  TQ            +
Sbjct: 293 TGFKFTDKGLVDPANAVKELTFTLDPSGINGAAPINNFKIGLSSLTQYESKSTAFAKTND 352

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+  G+    S+  DG V   +++G    + ++  AT  + + L+    N + PT +SG+
Sbjct: 353 GYKLGELTKMSIGSDGKVIGQFNNGDTKALGQIVTATFSNVNGLQKQGDNLWSPTENSGE 412

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            +I  PG   +G + SGALE +NVD+A E T +I  QR +  NS+V  T    ++ L++L
Sbjct: 413 ANINKPGSGGNGALLSGALEMSNVDLAKEFTNMIVTQRGFQANSRVITTTDQMLEELVNL 472

Query: 420 KR 421
           KR
Sbjct: 473 KR 474


>gi|188576756|ref|YP_001913685.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188576947|ref|YP_001913876.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188521208|gb|ACD59153.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521399|gb|ACD59344.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 407

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 112/421 (26%), Positives = 195/421 (46%), Gaps = 21/421 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLE 61
           +  T++SG+ A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ 
Sbjct: 2   AFNTSLSGISAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  +  G++ N  G
Sbjct: 61  VSNVAQQFSQGNIDPTGRSLDLAVSGEGFFTVS-SNGAKMYTRAGNFQTDANGYVVNPQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L  +    +     V     L+ +       S   T+T  ++  L  NAT   P  TP
Sbjct: 120 ARLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAT--APTVTP 174

Query: 182 KHNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNV 239
            +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V
Sbjct: 175 FNPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGAA--------V 226

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
               T++ S        AN       F  +T      + +++S +TQ    F  + +  +
Sbjct: 227 GSPTTLQFSDTGALTAPANGIIAMTPFTPSTGAGVLSMQLNVSGSTQYGEQFALRDTRQD 286

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG 
Sbjct: 287 GYASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNVWAESYTSGA 346

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
                P  +  G+I SG+LE++ VD+  +L  +I AQRN+  NS++  T       +I++
Sbjct: 347 ARTSAPNTSDLGQIESGSLESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINI 406

Query: 420 K 420
           +
Sbjct: 407 R 407


>gi|289578425|ref|YP_003477052.1| fagellar hook-basal body protein [Thermoanaerobacter italicus Ab9]
 gi|289528138|gb|ADD02490.1| fagellar hook-basal body protein [Thermoanaerobacter italicus Ab9]
          Length = 413

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 120/439 (27%), Positives = 210/439 (47%), Gaps = 46/439 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVS-NGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            +++G L    G  +LG+   +      VN+  G L  I++K+ + ++   TT   I  N
Sbjct: 120 FDSQGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISIKNWSSIAPAATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+ +  I         NG     +   +   YD+ G S +  + +T+T    W+ S+   
Sbjct: 177 LNASTEI---------NG-----SISYNILVYDSQGGSHIATLTFTRTDASTWDWSVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLA--NSSHKAISFNDNTSGIDQQI---TIDIS 282
           D + ++     V    T+    D   G +A   ++   ++FN NT+  +  I    +D+S
Sbjct: 223 DPAISS-----VDGSGTLTFGAD---GKIAPNTTATGTLTFNMNTNETNATIGPVQLDLS 274

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           + T  +     ++   NG+  G  +  ++ K G V  IY +G +  I ++AIA   +   
Sbjct: 275 QLTMFSSETDLRELSKNGNEAGSLESINIDKYGVVSGIYSNGRKQIIGQIAIADFQNPMG 334

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L+      ++ T +SG+  IG  G    G I  G LE +NVD+A+E  ++I  QR +  N
Sbjct: 335 LEKVGNTMFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLANEFADMIVTQRGFQAN 394

Query: 403 SKVFQTGSDFMDILISLKR 421
           +K+     + +  L+++KR
Sbjct: 395 AKIITASDEMLQDLVNMKR 413


>gi|86157813|ref|YP_464598.1| hypothetical protein Adeh_1387 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774324|gb|ABC81161.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 428

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 122/442 (27%), Positives = 192/442 (43%), Gaps = 35/442 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST--SNSYVSG 58
           M +L ++ +  +G+ A S  +S V DNIAN +TVG+K    AF   +  +    +  V  
Sbjct: 1   MSLLTALSSGTTGLQASSLELSVVGDNIANANTVGFKSGRAAFEDALSQTVIGGSGQVGL 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR---DNVNCLTRAGDFHINNEGF 115
           G  ++    I  QG+L  T   TDLA+QG GFF+V+G          TR G F ++++G+
Sbjct: 61  GARLAGVQKILTQGALASTGLATDLALQGNGFFVVRGAHAGQTGTFYTRDGQFTVDDDGY 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGL-ERINVKHAELSAMPTTTGFISNNLDKNATI 174
           L N+ G  + G+P   + A        GL + + V  A      TT   +  NL  +A +
Sbjct: 121 LVNLEGLRVQGFPADPSGA------VAGLPDDLLVGTASAQPRATTRLTLKANLQADAAV 174

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
                 P + G  + ++  ++   YD LG+     VY+ KTGD  W+             
Sbjct: 175 PAAAWDPANPGATSNFS--TTMTVYDALGAGHAVQVYFRKTGDGAWDWHALTDGAGVAGG 232

Query: 235 FPYNVAPLNTVEVSF---DPVTGYLANSSHKA----------ISFNDNTS--GIDQQITI 279
               +  +    ++F     +T     SS              SF D TS  G       
Sbjct: 233 TAGQLTQIAGGTLAFGDGGELTSMTQTSSFTPAGQAAPQPLDFSFGDPTSAGGTGLAGVT 292

Query: 280 DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPS 339
             S T+  A  FI Q    +G+  G+     V  +G +  ++ +G    + ++A+A   +
Sbjct: 293 QFSATS--ASTFIGQ----DGYGSGQLASVRVGPEGVISGVFTNGQTRVLGQVAVAGFAA 346

Query: 340 EDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNY 399
            D L    GN    T  SG   +G  G      I +G+LE +NVD+A +   LI AQR +
Sbjct: 347 PDQLDRAGGNLLQQTPGSGQPVVGAAGAGGRASIVAGSLEQSNVDLAEQFVRLIAAQRAF 406

Query: 400 AVNSKVFQTGSDFMDILISLKR 421
             NSK   T    +  LI++KR
Sbjct: 407 QANSKTITTADQLLSELIAMKR 428


>gi|332298237|ref|YP_004440159.1| flagellar hook-basal body protein [Treponema brennaborense DSM
           12168]
 gi|332181340|gb|AEE17028.1| flagellar hook-basal body protein [Treponema brennaborense DSM
           12168]
          Length = 463

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 117/470 (24%), Positives = 216/470 (45%), Gaps = 58/470 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY------- 55
           ++ S+ + +SGM     R+  + +N+ANV+T G+KR  + F  ++    S +        
Sbjct: 1   MMRSLYSGVSGMQNHQTRLDVIGNNVANVNTTGFKRGRVNFQDMISQQLSGAAKPTTEVG 60

Query: 56  ------VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D +  QG+L  T   TD+AIQG GFF++K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGVMVASIDTVFTQGNLQSTGVATDVAIQGNGFFVLKNGEET-FYTRAGAFG 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNN 167
           ++++G L N A G+ + G+  + A+  +I+N+    E + +   ++  A  T     + N
Sbjct: 120 LDSDGTLVNPANGLRVQGWMAQEANGEMILNTAGSPEDLIIPVGSKDPAKATQNVNFACN 179

Query: 168 LDKNATIITPDKTPKHNGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVSI 224
           L+KN    TP+     +  D  + T  +    YD+ G+  +  V + +      +W+ ++
Sbjct: 180 LNKN----TPEILEGASESDIMKGTWSTEQKVYDSFGNEHMLSVAFARVPGNPNQWQATV 235

Query: 225 FRQDQS-----TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI 279
                +     T           NT  V+FD  TG L + +  A +  + T  I  Q + 
Sbjct: 236 LIDPDNADVTQTRVGLGTTDGVANTFLVNFDN-TGSLQSVTDSAGNVTNPTGQIVLQTSF 294

Query: 280 DISKTTQLAGGFIPQKSEIN----------------------------GHAPGKPKDFSV 311
            ++ +   A G  P +  +N                            G+  G   +F +
Sbjct: 295 TVTDSNPDADGN-PYRQTMNINLGTIGSQQHTITQSASQSSTKAYYQDGYTMGYLDNFKI 353

Query: 312 SKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHG 371
              G +  +Y +GT   + ++A+AT  ++  L+    NTY+ + +SG  +IG  G    G
Sbjct: 354 DSSGIITGVYSNGTNRVLGQIALATFSNQGGLEKAGDNTYVQSNNSGLANIGTSGIAGKG 413

Query: 372 EIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            + +G+LE +NVD+  + T++I  QR +  +SK  QT    +D +++LKR
Sbjct: 414 SMLAGSLEMSNVDLTEQFTDMIVTQRGFQASSKTIQTADTLLDTVMNLKR 463


>gi|228933037|ref|ZP_04095900.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228826638|gb|EEM72409.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 437

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 119/459 (25%), Positives = 197/459 (42%), Gaps = 62/459 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPD-------------------KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDV 210
           +N   ++ +                   KT K N  D +   K     Y T   SV  D 
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKEN-VDGKEVEKPVPGEY-TYTVSVRNDS 237

Query: 211 YYTK--------TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHK 262
              K        TG+K  +       + T+ +            V  DPVTG +      
Sbjct: 238 KNEKEFKPVEGMTGEKNLKFDTLGNLKETDEA------------VQKDPVTGEITKGGSV 285

Query: 263 AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD 322
            I F          +T+D+S  T    G     +E+ G       D+S+S  G+V + Y 
Sbjct: 286 QIPFGSG-------LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYS 338

Query: 323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETAN 382
           DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++N
Sbjct: 339 DGSMKVVGQLAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSN 398

Query: 383 VDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           VD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 399 VDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|51598543|ref|YP_072731.1| flagellar hook protein FlgE [Borrelia garinii PBi]
 gi|51573114|gb|AAU07139.1| flagellar hook protein [Borrelia garinii PBi]
          Length = 442

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 206/449 (45%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDSRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++++   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVIHTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   II    +     R     +KS    YD+ G+  V ++   K  +    W   + 
Sbjct: 180 LDKRLPIIEEGASSADIARGTWVVNKS---LYDSFGNVSVLELTVVKDLNTPNLWNAPVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +   G   +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTIGFDNEGAL----ASLNGQPGQKEDILQIPITFNVVGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|256750749|ref|ZP_05491634.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750332|gb|EEU63351.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 417

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 122/440 (27%), Positives = 207/440 (47%), Gaps = 44/440 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV  +   N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVS-KGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            +++G L    G  +LG+   +      VN+  G L  I++K+ + +    TT   I  N
Sbjct: 120 FDSQGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISLKNWSSIDPAATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           ++ +  I         NG         +   YD+ G S +  + +TK     W  S+   
Sbjct: 177 INASTEI---------NG-----AISYNILVYDSQGGSHIATITFTKNDATTWNWSVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKA---ISFNDNT---SGIDQQITIDI 281
           D + ++     V    T+    D      AN    A   ++FN NT   S     +++D+
Sbjct: 223 DPAISS-----VDGSGTLTFGADGRILPDANGVRIANGTLNFNMNTAVTSATIGPVSLDL 277

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S+ T  +     ++   +G+  G  +  ++ K G V  IY +G R  I ++AIA   +  
Sbjct: 278 SRLTMFSSETDLRELSKDGNEAGSLESINIDKYGVVSGIYSNGRRQVIGQIAIADFQNPM 337

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+      ++ T +SG+  IG  G N  G I  G LE +NVD+A+E T++I  QR +  
Sbjct: 338 GLEKVGNTMFINTVNSGEPMIGAAGTNTRGSINPGTLEMSNVDLANEFTDMIVTQRGFQA 397

Query: 402 NSKVFQTGSDFMDILISLKR 421
           N++V     + +  L+++KR
Sbjct: 398 NARVITASDEILQDLVNMKR 417


>gi|304316900|ref|YP_003852045.1| fagellar hook-basal body protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778402|gb|ADL68961.1| fagellar hook-basal body protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 420

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 124/445 (27%), Positives = 201/445 (45%), Gaps = 51/445 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A    +  + +NIANV+TVG+K + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQAEMDVIGNNIANVNTVGFKASRMTFKEIFNQTIKGASAPQGSGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   V  G+ I++ D +   G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQVGLGVAIASIDTLFTNGGSQRTDNPTDLSIDGNGFFIVN-NGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKHAELSAMPTTTGFIS--N 166
            ++ G L    G  ++G+  ++      VN+  G L  I++K+   S  P +T  I    
Sbjct: 120 FDSNGDLVTPDGYKVMGWISQDGKT---VNTDTGNLSPISIKNWS-STSPASTKLIQLGG 175

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIF 225
           NLD   +I          G    Y    +   YD+ G S V  + +TK  +   W+ +I 
Sbjct: 176 NLDAGTSI----------GSSVSY----NVTIYDSQGGSHVATIQFTKKDNAGNWDAAIT 221

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN---------DNTSGIDQQ 276
             D +       + +P+    + FD   G + N +    S N         + T G    
Sbjct: 222 NFDGN-----DLSASPVTIGSIQFDS-NGLITNPAGSIFSVNVSSLPITNTNATLGDGTN 275

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           ITID+S  T  +     ++   +G+  G  +  ++ + G V  IY +G    I ++A+A 
Sbjct: 276 ITIDLSNLTMYSSSTDIRELSKDGNEAGSIESINIDQYGVVSGIYSNGRTQVIGQIALAD 335

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L+      ++ T +SGD  IG       G I  G LE +NVD+A+E   +I  Q
Sbjct: 336 FQNTQGLEKVGNTMFINTVNSGDPMIGAANTGTRGTINPGTLEMSNVDLANEFANMITTQ 395

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           R +  NSKV  T  + +  L++LKR
Sbjct: 396 RGFEANSKVITTSDEILQDLVNLKR 420


>gi|51597637|ref|YP_071828.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis IP 32953]
 gi|186896771|ref|YP_001873883.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis PB1/+]
 gi|51590919|emb|CAH22575.1| Putative FlgE-like flagellar hook protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699797|gb|ACC90426.1| flagellar basal body FlaE domain protein [Yersinia
           pseudotuberculosis PB1/+]
          Length = 414

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 118/426 (27%), Positives = 191/426 (44%), Gaps = 26/426 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A + ++A + +++ +S+NIAN  T G+K +   FSS+   S        G+     
Sbjct: 2   SFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFSSMYAQSQPLGVAVSGVS---- 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS+ G    T    DLAI G GFF+V+        TRAG F  + +G+L N  G  L 
Sbjct: 58  QNISKDGQKEKTGMGLDLAISGGGFFVVRESSGDKAYTRAGMFRSDVDGYLVNGQGMKLQ 117

Query: 126 GYPLK---NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
           GYP     N  A +I +       + + +A + A  +       NL  NA++  P  +  
Sbjct: 118 GYPADAAGNIQAGIISD-------LKINNAGVPAKASEQLDFMANL--NASVTAPSVSVF 168

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIFRQDQSTNNSFPY 237
           +   +  Y   ++   YD+LG       Y+ K+     G    E ++         + P 
Sbjct: 169 NPTNEKSYNFTTTSTVYDSLGREHAVAHYFVKSTTLPAGSVASEWAVHHTVDGGAATPPL 228

Query: 238 NVAPLNTVEV---SFDPVTGYL-ANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
            +    T E+   S     G L  N+ +   +FN      D  I ID + TTQL+ GF  
Sbjct: 229 TLQFTTTGELISGSGTTTAGVLKGNAINLHGTFNP-AGAADYDIDIDYTGTTQLSQGFTT 287

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
            +++ +G+  G      +  DG V   + +G R+   ++ +A   S + L   +G ++  
Sbjct: 288 TRNKSDGYTSGVKNGERIESDGSVYATFSNGERMLQGKVVLANFASPNGLVTQNGTSWSE 347

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           +  SG   +G PG    G + SGALE +NVDI +EL  L+ AQRNY  ++K+  T    M
Sbjct: 348 SNKSGAALLGTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKIISTNDSMM 407

Query: 414 DILISL 419
           + L  +
Sbjct: 408 NALFQV 413


>gi|145297454|ref|YP_001140295.1| flagellar hook protein FlgE [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850226|gb|ABO88547.1| lateral flagellar hook protein LfgE [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 397

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 111/428 (25%), Positives = 184/428 (42%), Gaps = 51/428 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS-T 64
           S    +SG+ A +  +S +S+N+AN  T G+K +   F+++            G+E++  
Sbjct: 2   SFSIGLSGLRAVNQELSVISNNVANASTAGFKSSRAEFAAIY-----------GVEMNNV 50

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                  G +M T    DLAI G GFF++K  +     TRAG F  +   +L    G  L
Sbjct: 51  SQNFDRNGDVMRTGKGLDLAISGSGFFVLKDSNGQTSYTRAGMFQRDASNYLTTANGTRL 110

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY   +A    + +   G   I VK   L A  +       NL  +A+IITP   P   
Sbjct: 111 QGYTTNDAGE--LQSGVVG--DIQVKAGSLPAKASDQLEFVANLKADASIITPPPPPAPA 166

Query: 185 ---GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
               +   +++  S   YD+LG+      Y+ KTG   W+V           +F   V P
Sbjct: 167 FDPNKSETFSYSQSSKVYDSLGTEHTVTQYFVKTGANAWDVHY---------TFNGAVVP 217

Query: 242 LNTVEVSFD------------PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
               +++FD            P +  LA +    I+           + +D+S+ +Q A 
Sbjct: 218 PVGAKMNFDLNGKLDIAASTIPASLALAPAGASPIA-----------LQLDMSRVSQYAS 266

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
            F   +++ NG+A G      V  DG V   + +G  +   ++ +A   + + L   +  
Sbjct: 267 DFNATRNQSNGYAAGDLTGVKVDADGGVYATFTNGQNLLQGQVVMANFTNPNGLIQTNNT 326

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
           T+  +  SG   +G PG    G + +GA E++NVD+  EL  L+ +QRNY  N+K   + 
Sbjct: 327 TWQQSFSSGQPVLGAPGTGTMGSLTAGAYESSNVDLTGELVSLMTSQRNYQANAKTISSA 386

Query: 410 SDFMDILI 417
                +L 
Sbjct: 387 DKMTQVLF 394


>gi|22127327|ref|NP_670750.1| flagellar hook protein FlgE [Yersinia pestis KIM 10]
 gi|45442796|ref|NP_994335.1| flagellar hook protein FlgE [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809055|ref|YP_652971.1| flagellar hook protein FlgE [Yersinia pestis Antiqua]
 gi|108810748|ref|YP_646515.1| flagellar hook protein FlgE [Yersinia pestis Nepal516]
 gi|145597817|ref|YP_001161893.1| flagellar hook protein FlgE [Yersinia pestis Pestoides F]
 gi|150260249|ref|ZP_01916977.1| lateral flagellar hook protein [Yersinia pestis CA88-4125]
 gi|162421081|ref|YP_001604847.1| flagellar hook protein FlgE [Yersinia pestis Angola]
 gi|165924960|ref|ZP_02220792.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939066|ref|ZP_02227618.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008888|ref|ZP_02229786.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211930|ref|ZP_02237965.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399572|ref|ZP_02305096.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419268|ref|ZP_02311021.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425161|ref|ZP_02316914.1| flagellar hook protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167466340|ref|ZP_02331044.1| flagellar hook protein [Yersinia pestis FV-1]
 gi|218927912|ref|YP_002345787.1| flagellar hook protein FlgE [Yersinia pestis CO92]
 gi|229837408|ref|ZP_04457571.1| Flagellar hook protein flgE [Yersinia pestis Pestoides A]
 gi|229840621|ref|ZP_04460780.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842828|ref|ZP_04462980.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229900945|ref|ZP_04516069.1| Flagellar hook protein flgE [Yersinia pestis Nepal516]
 gi|270487673|ref|ZP_06204747.1| flagellar hook protein FlgE [Yersinia pestis KIM D27]
 gi|294502788|ref|YP_003566850.1| flagellar hook protein [Yersinia pestis Z176003]
 gi|21960408|gb|AAM87001.1|AE013948_9 putative flagellar hook protein [Yersinia pestis KIM 10]
 gi|45437662|gb|AAS63212.1| flagellar hook protein FlgE [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774396|gb|ABG16915.1| flagellar hook protein [Yersinia pestis Nepal516]
 gi|108780968|gb|ABG15026.1| putative flagellar hook protein [Yersinia pestis Antiqua]
 gi|115346523|emb|CAL19399.1| putative flagellar hook protein [Yersinia pestis CO92]
 gi|145209513|gb|ABP38920.1| flagellar hook protein [Yersinia pestis Pestoides F]
 gi|149289657|gb|EDM39734.1| lateral flagellar hook protein [Yersinia pestis CA88-4125]
 gi|162353896|gb|ABX87844.1| flagellar hook protein [Yersinia pestis Angola]
 gi|165913022|gb|EDR31647.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923160|gb|EDR40311.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992227|gb|EDR44528.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206676|gb|EDR51156.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963262|gb|EDR59283.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052076|gb|EDR63484.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055924|gb|EDR65705.1| flagellar hook protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229682284|gb|EEO78376.1| Flagellar hook protein flgE [Yersinia pestis Nepal516]
 gi|229690095|gb|EEO82152.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696987|gb|EEO87034.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229705531|gb|EEO91541.1| Flagellar hook protein flgE [Yersinia pestis Pestoides A]
 gi|262360820|gb|ACY57541.1| flagellar hook protein [Yersinia pestis D106004]
 gi|270336177|gb|EFA46954.1| flagellar hook protein FlgE [Yersinia pestis KIM D27]
 gi|294353247|gb|ADE63588.1| flagellar hook protein [Yersinia pestis Z176003]
 gi|320016711|gb|ADW00283.1| Flagellar hook protein flgE [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 413

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 117/424 (27%), Positives = 188/424 (44%), Gaps = 23/424 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A + ++A + +++ +S+NIAN  T G+K +   FSS+   S        G+     
Sbjct: 2   SFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFSSMYAQSQPLGVAVSGVS---- 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             IS+ G    T    DLAI G GFF+V+        TRAG F  + +G+L N  G  L 
Sbjct: 58  QNISKDGQKEKTGMGLDLAISGGGFFVVRESSGDKAYTRAGMFRSDVDGYLVNGQGMKLQ 117

Query: 126 GYPLK---NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
           GYP     N  A +I +       + + +A + A  +       NL  NA++  P  +  
Sbjct: 118 GYPADAAGNIQAGIISD-------LKINNAGVPAKASEQLDFMANL--NASVTAPSVSVF 168

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIFRQDQSTNNSFPY 237
           +   +  Y   ++   YD+LG       Y+ K+     G    E ++         + P 
Sbjct: 169 NPTNEKSYNFTTTSTVYDSLGREHAVAHYFVKSTTPPAGSVASEWAVHHTVDGGTATPPL 228

Query: 238 NVAPLNT-VEVSFDPVTGYLANSSHKAISFNDNTSGI-DQQITIDISKTTQLAGGFIPQK 295
            +   +T   +   P  G     S   +    N +G  D  I ID + TTQL+ GF   +
Sbjct: 229 TLQFTDTGALIPGIPAAGSGMKGSAINLHGTFNPAGAADYDIDIDYTGTTQLSQGFTTTR 288

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           ++ +G+  G      +  DG V   + +G RV   ++ +A   S   L   +G ++  + 
Sbjct: 289 NKSDGYTSGVKNAERIESDGSVYATFSNGERVLQGKVVLANFASPSGLVTQNGTSWSESN 348

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG   +G PG    G + SGALE +NVDI +EL  L+ AQRNY  ++K+  T    M+ 
Sbjct: 349 KSGAALLGTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKIISTNDSMMNA 408

Query: 416 LISL 419
           L  +
Sbjct: 409 LFQV 412


>gi|121533754|ref|ZP_01665581.1| protein of unknown function DUF1078 domain protein [Thermosinus
           carboxydivorans Nor1]
 gi|121307745|gb|EAX48660.1| protein of unknown function DUF1078 domain protein [Thermosinus
           carboxydivorans Nor1]
          Length = 420

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 122/456 (26%), Positives = 201/456 (44%), Gaps = 73/456 (16%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ S+   +SG+     R+  + +NIANV+T+G+K + + F   +   T     SG    
Sbjct: 1   MMRSLFAGVSGLRNHQTRMDVIGNNIANVNTIGFKASRVNFQD-ILSQTMQGASSGIGNQ 59

Query: 59  ----------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK---GRDNVNCLTRA 105
                     G+ I++ D I   GS   T   TDL+IQGKGFF++    G+  V   TRA
Sbjct: 60  GGTNPIQIGLGVSIASIDTIFTDGSFQPTGKQTDLSIQGKGFFVLSPDGGKTEV--FTRA 117

Query: 106 GDFHINNEG-FLENVAGGVLLGY-----------PLKNASAPLIVNSFQGLERINVKHAE 153
           G+F  +  G F+    G  ++G+           P K  +  + V +            +
Sbjct: 118 GNFDFDRLGNFIVPGTGYKVVGWKADSNGNIDTDPSKRTTIDIPVGT------------Q 165

Query: 154 LSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT 213
           + A  T     +NNL  +A           NG     T K S+  YD LG      V +T
Sbjct: 166 MPAQATKAITFANNLSADA----------ANGT----TVKVSYDIYDNLGKRYTLPVVFT 211

Query: 214 KTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVS----FDPVTGYLANSSHKAISFNDN 269
           KTGD  W+ +I       +N+  Y VA L    V+    FD  TG L++++   ++  D 
Sbjct: 212 KTGDTTWDYTI-------SNTSEYTVATLPATSVTGRLTFDAATGKLSSTTPPTVTTIDI 264

Query: 270 TSGIDQQ----ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
           +     Q    I +   + TQ  G    Q  + +G+ PG  +  ++  +G +   + +G 
Sbjct: 265 SYTTPAQKVSGIQLKFDQVTQYGGDTTLQIVDQDGYPPGSLEGVTIDPNGVIVGRFSNGK 324

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
              + ++A+AT  +   L     + Y  + +SG   IG  G    G++  G LE +NVD+
Sbjct: 325 TRNLAQVALATFNNPAGLTKIGDSLYAVSSNSGTPEIGVTGSGGRGKLNPGTLEMSNVDL 384

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           A E + +I  QR +  NSK+     + +  L +LKR
Sbjct: 385 AQEFSNMIITQRGFQANSKIISVTDEMLQELANLKR 420


>gi|229017042|ref|ZP_04173962.1| Flagellar hook protein flgE [Bacillus cereus AH1273]
 gi|229023223|ref|ZP_04179734.1| Flagellar hook protein flgE [Bacillus cereus AH1272]
 gi|228738148|gb|EEL88633.1| Flagellar hook protein flgE [Bacillus cereus AH1272]
 gi|228744313|gb|EEL94395.1| Flagellar hook protein flgE [Bacillus cereus AH1273]
          Length = 407

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 106/433 (24%), Positives = 192/433 (44%), Gaps = 40/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF------------PS 50
           ++ ++ T+++G++A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGLNATQNALSVTSNNIANAQTVGYKKQKAMFDDLLYNNSIGAKGDDRYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
           T+   +  G+++S        G++  T      A++G GFF+V      N   TR G F 
Sbjct: 61  TNPKSIGNGVKMSGTVTDYSDGTITLTGGKVQAAMEGNGFFVVGDSKAGNMEFTRKGTFA 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I+++ ++ N  G  +  YP   ++  + ++   G  +I +  A +  + T+ G +  N+ 
Sbjct: 121 ISSDYYITNTGGQYVFAYPADPSTGNVDLSGIPGPLQIPMGSA-IGGIRTSKGIVGGNIP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-FRQD 228
            +A  IT +                   AYD  G++    V +T+ G+  ++ ++  R D
Sbjct: 180 ADAKHITQE-----------------LPAYDDAGNTWTMRVEFTQDGEHNYKYTVKMRND 222

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                 F           V+FD V      +    I FN  T      + ID SK T   
Sbjct: 223 SKKETEFTEVQGAGG--NVTFDAVGNPDPVNPEANIPFNGGT------VKIDFSKLTNHP 274

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  + ++G      KD  ++  GYV + Y DG+     +LA+  +P+E  L     
Sbjct: 275 TEKTIAVTNVDGRPAATVKDCFITDGGYVMVKYSDGSMKAAGQLAVGMLPNEGGLMKTGN 334

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             +  T  +G +++G  G N  G++  GA E ANVD++ E  +L+  QR +  N+KV + 
Sbjct: 335 GNFTATNTTGILALGVSGQNGAGKVRGGAQEGANVDLSVEFVDLMLYQRGFQGNAKVIKI 394

Query: 409 GSDFMDILISLKR 421
             + +  +++L R
Sbjct: 395 SDEVLTEVVNLIR 407


>gi|228945356|ref|ZP_04107711.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228814328|gb|EEM60594.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 437

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 119/459 (25%), Positives = 196/459 (42%), Gaps = 62/459 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +KN +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKNGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPD-------------------KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDV 210
           +N   +  +                   KT K N  D +   K     Y T   SV  D 
Sbjct: 180 RNQNALAHEFTVFDAEGNSLTLRVNIKQKTTKEN-VDGKEVEKPVPGEY-TYTVSVRNDS 237

Query: 211 YYTK--------TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHK 262
              K        TG+K  +       + T+ +            V  DPVTG +      
Sbjct: 238 KNEKEFKPVEGMTGEKNLKFDTLGNLKETDEA------------VQKDPVTGEITKGGSV 285

Query: 263 AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD 322
            I F          +T+D+S  T    G     +E+ G       D+S+S  G+V + Y 
Sbjct: 286 QIPFGSG-------LTLDLSGLTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMKYS 338

Query: 323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETAN 382
           DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++N
Sbjct: 339 DGSMKVVGQLAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSN 398

Query: 383 VDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           VD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 399 VDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|325289233|ref|YP_004265414.1| fagellar hook-basal body protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964634|gb|ADY55413.1| fagellar hook-basal body protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 447

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 120/459 (26%), Positives = 216/459 (47%), Gaps = 52/459 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY----VSG 58
           ++ ++ +A+SG+ A   ++  + +NIANV+TV YK + + FS ++  + S++      SG
Sbjct: 1   MMRALFSAVSGLQAHQKKMDVIGNNIANVNTVAYKASRVTFSDILSQTLSSATGADSTSG 60

Query: 59  -----------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK-GRDNVNCLTRAG 106
                      G+ I + D +   GS   T ++TDL+I G GFFIVK G       TRAG
Sbjct: 61  RGGSNAKQIGLGVGIGSIDTLMTAGSTESTGNSTDLSIDGDGFFIVKNGSTGTYMFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYP--LKNASAPLIVNSFQGLERINVKHAE-------LSAM 157
           +F I++ G L    G  + G+     N       ++   +E IN+   E       L A 
Sbjct: 121 NFSIDDSGNLVTSDGLNVYGWLNYTVNTDGTYTFDTDSEVEAINLYSDEDNGNKQILKAQ 180

Query: 158 PTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD 217
            T    +S NLD   + +    +   +  D E  + ++   YD+LG+     V +TK   
Sbjct: 181 ATANVSLSGNLDAGESAVGSGLSDIGS-SDPEAQYTTTMTVYDSLGNEHELTVSFTKC-- 237

Query: 218 KKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT------- 270
               V     D  T  ++ Y+VA  ++ + +    +GYL   S+  +  +D++       
Sbjct: 238 ---YVDASGTDPVT--TWYYSVAA-DSGDAALTDASGYLQFDSNGKLVTDDSSYSPTATM 291

Query: 271 -------SGIDQ-QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD 322
                  SG  + +I +D S  +  A     +   ++G+  G  +D S+  +G +  +Y 
Sbjct: 292 TVTPSSASGAGEYEIELDFSNLSTSADDGSVETKGVDGYPSGTLEDISIDSNGIILGVYS 351

Query: 323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETAN 382
           +G   P+  +A+A   +   L     N Y+ T +SG+ + G   +   G + SG LE +N
Sbjct: 352 NGIEQPLGMIALARFANPSGLLKTGSNYYVATANSGEFTNGVMAN---GALSSGTLEMSN 408

Query: 383 VDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           VD+++E +++I  QR Y  NS++  T  + ++ +I +KR
Sbjct: 409 VDLSTEFSQMITTQRGYQANSRMITTADEMLETIIEMKR 447


>gi|229144365|ref|ZP_04272771.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-ST24]
 gi|228639152|gb|EEK95576.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-ST24]
          Length = 437

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 116/456 (25%), Positives = 199/456 (43%), Gaps = 56/456 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R++ N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
           +N   ++ +                 F  +D  G+S+   V   K    K  V     ++
Sbjct: 180 RNQNALSHE-----------------FTVFDEEGNSLTLRVNI-KQKTTKETVDGKEVEK 221

Query: 230 STNNSFPYNVAPLNTV--EVSFDPVTGYLANSSHK------------AISFNDNTSGI-- 273
                + Y V+  N    E  F PV G     + K            A+  N  T  I  
Sbjct: 222 PVPGEYTYTVSVRNDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKNPVTGEITK 281

Query: 274 --------DQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                    + +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+
Sbjct: 282 GGTVKIPFGKGLTLDLSGLTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMRYSDGS 341

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
              + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD+
Sbjct: 342 MKVVGQLAVATFPNSGGLMKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAKESSNVDL 401

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           + E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 402 SVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|30019797|ref|NP_831428.1| flagellar hook protein FlgE [Bacillus cereus ATCC 14579]
 gi|229043508|ref|ZP_04191218.1| Flagellar hook protein FlgE [Bacillus cereus AH676]
 gi|229127079|ref|ZP_04256078.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-Cer4]
 gi|229149956|ref|ZP_04278184.1| Flagellar hook protein FlgE [Bacillus cereus m1550]
 gi|296502353|ref|YP_003664053.1| flagellar hook protein FlgE [Bacillus thuringiensis BMB171]
 gi|29895342|gb|AAP08629.1| Flagellar hook protein flgE [Bacillus cereus ATCC 14579]
 gi|228633637|gb|EEK90238.1| Flagellar hook protein FlgE [Bacillus cereus m1550]
 gi|228656432|gb|EEL12271.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-Cer4]
 gi|228725886|gb|EEL77133.1| Flagellar hook protein FlgE [Bacillus cereus AH676]
 gi|296323405|gb|ADH06333.1| flagellar hook protein FlgE [Bacillus thuringiensis BMB171]
          Length = 437

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 114/463 (24%), Positives = 197/463 (42%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R++ N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-------------- 215
           +N   ++ +                 F  +D  G+S+   V   +               
Sbjct: 180 RNQNALSHE-----------------FTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKP 222

Query: 216 --GDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFD---------------PVTGYLAN 258
             G+  + VS+ R D      F           + FD               PVTG +  
Sbjct: 223 VPGEYTYTVSV-RNDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKNPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F        + +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGTVKIPFG-------KGLTLDLSGLTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MRYSDGSMKVVGQLAVATFPNSGGLMKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|228958033|ref|ZP_04119769.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228801658|gb|EEM48539.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 437

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 114/463 (24%), Positives = 197/463 (42%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R++ N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-------------- 215
           +N   ++ +                 F  +D  G+S+   V   +               
Sbjct: 180 RNQNALSHE-----------------FTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKP 222

Query: 216 --GDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFD---------------PVTGYLAN 258
             G+  + VS+ R D      F           + FD               PVTG +  
Sbjct: 223 VPGEYTYTVSV-RNDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKNPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F        + +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGTVKIPFG-------KGLTLDLSDLTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MRYSDGSMKVVGQLAVATFPNSGGLMKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|154252984|ref|YP_001413808.1| hypothetical protein Plav_2542 [Parvibaculum lavamentivorans DS-1]
 gi|154156934|gb|ABS64151.1| protein of unknown function DUF1078 domain protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 454

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 128/467 (27%), Positives = 216/467 (46%), Gaps = 59/467 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M   GSM TA++G+ AQS+ +  +SDNIAN  T+G+KRT   F  +V  STS +++ G +
Sbjct: 1   MSFFGSMTTAITGIRAQSSALGHISDNIANSQTIGFKRTDTNFQDIVTASTSRNHLPGAV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR----------DNVNCLTRAGDFHI 110
             +     + QGS+  +   T +AI G GFF+V  R          DNVN  TR GDF +
Sbjct: 61  LAAPSFTNNVQGSIDASEVPTHMAINGSGFFVVSARVATVDGNPVFDNVNYYTRRGDFSM 120

Query: 111 NNEGFLENVAGGVL--------LGYPLKNASAPLIVN----SFQGLERINVKHAELSAMP 158
           +  G+L N  G  L         G P+ +  + + +N    + +    I+ K A L A P
Sbjct: 121 DKYGYLVNGGGYTLQGLAIDPVTGNPVGDTPSRIQINRDFLAARTTSTISYK-ANLPAWP 179

Query: 159 TTTGF---ISNNLDKNATIITP---DKTPKHNGRDAEYTHKS----SFAAYDTLGSSVVY 208
            T      I+N+        TP   D +      +  +   S    +   YD LG+    
Sbjct: 180 KTVNADPAIANSELLTVGRFTPALADLSVISAANEDIFLDNSLSGGAVTGYDELGAPANV 239

Query: 209 DVYYTKT-----GDKKWEVSIFRQDQSTNNSFPY-NVAPLNTVEVSFD---PVTGYLANS 259
              + K      G   W +     D +T  +  + NV      + +FD    +T  + ++
Sbjct: 240 QFRWAKIDNEDGGGDTWNLFYKTSDSATGATDKWVNVGQ----DYAFDGQGRLTPAVDST 295

Query: 260 SHKAISFNDNTSGIDQQITID--ISKTTQLA---GGFIPQKSEINGHAPGKPKDFSVSKD 314
           +   ++ N  + G    +T+D   S  TQ     G     + + NG+  G+    +VS++
Sbjct: 296 TITGLTVNGVSLG---NVTLDHGASNVTQFEDDNGTVKTTELDQNGYPSGELVSIAVSEN 352

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +   Y +G  V + ++++AT  + D LK  DG  +  T++SG+  +G       G+I 
Sbjct: 353 GRITGTYSNGKTVDLAQVSLATFNASDKLKKLDGTAFAATQESGEPMLG-----GGGDII 407

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           + A E +NVDIA E ++LI  Q+ Y   +++  T  + +   +++KR
Sbjct: 408 ASAREASNVDIADEFSKLIVTQQAYTAGTRIVTTADELIRETLNMKR 454


>gi|83576781|gb|ABC23332.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 472

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 142/456 (31%), Positives = 210/456 (46%), Gaps = 50/456 (10%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-GLEISTKDMI 68
           A+S M+AQS+ VSA+S+N+AN  T+GYK +  +F SLV  + S S  +G G+  S    +
Sbjct: 23  AVSAMNAQSSSVSAISNNLANSSTIGYKTSNASFYSLVTGTGSTSNFTGAGVVASATQNV 82

Query: 69  SEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVAGGVLLG 126
             QG ++ T + TDLA+ GKG FIV  R   N L  TRAGDF+ N +G L N     L G
Sbjct: 83  INQGVIVGTQNVTDLAVDGKGMFIVTDRSGSNELYYTRAGDFYPNADGDLVNSNNYYLQG 142

Query: 127 YPLKNASAPLI--VNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           YP      PL    NS   LE IN+  A  +A  T+   I   L   AT       P   
Sbjct: 143 YPTDRNGVPLTNTGNSGASLETINLAGATGAAKATSEMSIQAVLPAQATAGDSTAVPPV- 201

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS---------- 234
              A YT  S    YD+LG +    V +TK  D KW ++++    S++ +          
Sbjct: 202 ---AAYTSSSDVEIYDSLGVAHTMTVKWTKMSDTKWTMTLYDPKLSSDMTGDATGAISST 258

Query: 235 ------FPYNVAPLNT-----VEVSFDPVTGYLANSSHKAISFN-DNTSGIDQQITIDIS 282
                  P N  P  T     V+V F    G L   S  A+    D ++G    I+ +I+
Sbjct: 259 TTGVTDVPANAGPPATSHGIAVDVEFTD-QGLLKTPSVLALKITPDASNGTGAAIS-EIA 316

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPK-DF----------------SVSKDGYVDIIYDDGT 325
                AG      +  N  + GKP  D                 ++SK G V   + +G 
Sbjct: 317 LNLGTAGKANGLSTYSNEDSDGKPAVDLKKVVQDGVTYGTYYSNTISKAGLVYANFTNGI 376

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
             PIY++ +A   + + L+   G  Y  T  SG  +    G    G + SG++E++ VD 
Sbjct: 377 SYPIYQVPLAMFSNVNGLEAVSGTAYSATVKSGTPTYVTAGTGGSGGVSSGSVESSTVDT 436

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           A+E ++LI +Q+ Y+  +++  +  +    LIS KR
Sbjct: 437 AAEFSKLIVSQQAYSAATQIISSNQEMFQNLISAKR 472


>gi|330961196|gb|EGH61456.1| flagellar hook protein FlgE [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 442

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 128/453 (28%), Positives = 199/453 (43%), Gaps = 52/453 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYK--RTAIA--FSSLVFPSTSNSYVSGGLE 61
           S    +SG+ A +  +    +NIANV T G+K  RT  A  ++  +  ++  S V  G+ 
Sbjct: 2   SFNIGLSGLYAANKSLDVTGNNIANVATTGFKSSRTEFADQYAQSIRGTSGKSSVGSGVM 61

Query: 62  ISTKDMISEQGSLMH-TASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +       QGSL   TA++ DLAI G GFF++   +     TRAG FH + EGF+ N  
Sbjct: 62  TAAVSQQFSQGSLTTGTANSLDLAINGDGFFMLS-NNGEKLYTRAGAFHTDKEGFVVNST 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY + +A+  ++  +   L R++  + E    P  T  I+N+ + N+T   P   
Sbjct: 121 GMKLQGYNV-DANGDVVTGALGNL-RVDSSNLE----PKATSTITNSANLNSTTALPSVA 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y  K S   YDT G++   D Y+ KTG   W +      +S ++  P    
Sbjct: 175 TFDATDTKSYNTKYSTPTYDTQGNAHTLDQYFVKTGTNTWSMYSLMDGRSISD--PTTTT 232

Query: 241 PLNTVEVSFDPVTGYLANSSHKAI---------------SFNDNTSGID----------- 274
           P +  +++FD  +G L  ++  A+               S N+   G+            
Sbjct: 233 P-DKNDLTFDS-SGNLVTTAGGAVPTDSANVKFNADGTFSVNNWVPGVQVGTGTTATWAA 290

Query: 275 ------QQITIDISKTTQLAG--GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
                   I +D+S  TQ A   G + Q  + NG+A G+    +V + G +   Y +G  
Sbjct: 291 NGATGAASIKLDMSDITQTASVSGLLRQ--DQNGYATGQLSAMNVDRTGNLFATYTNGQS 348

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             I + ++ +  +   L    G  +  T DSG    G P     G I   ALE +NVD+ 
Sbjct: 349 KTIGQTSLTSFANVQGLAQAGGTNWRETFDSGVPVSGAPQSGTLGYITGQALEESNVDLT 408

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            EL  LI+AQ NY  N+K   T S  M   I +
Sbjct: 409 MELVNLIKAQSNYQANAKTISTQSTIMQTTIQM 441


>gi|308050372|ref|YP_003913938.1| flagellar hook-basal body protein [Ferrimonas balearica DSM 9799]
 gi|307632562|gb|ADN76864.1| flagellar hook-basal body protein [Ferrimonas balearica DSM 9799]
          Length = 468

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 123/479 (25%), Positives = 217/479 (45%), Gaps = 76/479 (15%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-SNSYVSGGLEIST 64
           S   ++SG++A    ++  S+NIANV+T+G+K +   F+ +   S  +NS  + G  ++T
Sbjct: 2   SFNISLSGLNAAQKDLNTTSNNIANVNTIGFKESRAEFADVYNNSLFTNSKTNVGAGVAT 61

Query: 65  KDMISE--QGSLMHTASNTDLAIQGKGFFI----VKGRDNVNCLTRAGDFHINNEGFLEN 118
             +  +  QG+L  T +  DLAI G GFF+    + G+D     TRAG F +N+  F+ +
Sbjct: 62  AQIAQQFHQGALSFTNNALDLAINGNGFFVTNSELGGQDF--SYTRAGAFKLNDSNFMVD 119

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  L+  P         VN+   ++ +++   +   +P T G  +   D N ++  P 
Sbjct: 120 SQGNYLMALP---------VNADGSVQSVSLSTTKPVQIPQTAGQPAATSDINMSMNLPA 170

Query: 179 KTPKHNGRDAE------YTHKSSFAAYDTLGSSVVYDVYYTK----------------TG 216
              + N  + +      Y   +S   YD+LG   +   Y+ K                T 
Sbjct: 171 NDVEMNPANFDPTDPTTYNTATSVTIYDSLGEPHIQTTYFVKPTGGSLNNNNQWVCFTTV 230

Query: 217 DKK----WEVSIFRQD-----QSTNNSFPYNVAPLNTVE--------VSFDPVTGYLANS 259
           D +    W+V+   +D     Q TN     +V   N V         +SFD V GY+ + 
Sbjct: 231 DNQPVDIWDVAGGAKDSGQWGQDTNGDGVADVTN-NAVGASGQTGFVMSFDDVGGYIGSD 289

Query: 260 ----SHKAISFNDNTS------------GID--QQITIDISKTTQLAGGFIPQKSEINGH 301
                 +A+  +D +S            G D  Q++T+  +  TQ A  F   +   +G 
Sbjct: 290 PALIQTQALGLDDPSSTTPGDGAGVIGPGADGSQRLTLKFNNPTQYAAPFEVTELSQDGA 349

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+  +  V+ +G ++  Y +GT+  + ++A+A   +E  L      ++  + DSG+  
Sbjct: 350 TVGRLTNVEVTAEGLINATYSNGTQQALGKVALARFSNEQGLTQIGNTSWKQSNDSGEPL 409

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G P     G I S ALE +NVD+ +EL +LI AQRN+  NS+     +     ++ ++
Sbjct: 410 VGEPNVGAFGSIRSAALEQSNVDLTTELVDLISAQRNFQANSRALDVSNQLSQNILQIR 468


>gi|322432989|ref|YP_004210238.1| flagellar hook-basal body protein [Acidobacterium sp. MP5ACTX9]
 gi|321165216|gb|ADW70920.1| flagellar hook-basal body protein [Acidobacterium sp. MP5ACTX9]
          Length = 412

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 116/424 (27%), Positives = 191/424 (45%), Gaps = 59/424 (13%)

Query: 11  MSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLEISTKD 66
           +SG+ A  +++ AVS+N+AN+DTVG+K   + FS +   S+    SN  V  GL ++   
Sbjct: 8   LSGLIASQSQLQAVSNNLANLDTVGFKDQNVNFSDVFAQSSLNNGSNDPVQTGLGVNASQ 67

Query: 67  MISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
             S+   G++  T   +++A+ G GFF+ K        TRAGDF  N+ G L   +G ++
Sbjct: 68  TTSDFTDGAVSATGIASNMALTGNGFFVTKTATGATAYTRAGDFTKNSSGQLVTPSGDLV 127

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNNLDKNATIITPDKTPKH 183
           +GYP  N     +VN+   L+ I +    +     TT F IS NL+ +A + +   +P  
Sbjct: 128 MGYPAANG----VVNTSGELQPIQIGTGTVIPASATTKFTISANLNSSAAVGSTFASPTP 183

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI------------------F 225
                          YD+LG +    V YTKTG   W  S+                   
Sbjct: 184 --------------VYDSLGDAHTLTVNYTKTGTNTWSYSVDLPTADTGAATTTVASGTL 229

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
             D S N + P     +N   ++              A S N   +  D      +++T+
Sbjct: 230 NFDTSGNLTSPTGSVAINVPTLT------------DGAASMNFAWNLTDSSGNPTLTQTS 277

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDD-GTRVPIYRLAIATVPSEDNLK 344
            ++       S  NG+A G    +S++ DG V+  + +    V + ++A+A+  +   L 
Sbjct: 278 LVSAN---STSTQNGNASGTLTGYSIAADGTVEGTFSNISNPVALGQVAVASFANTQGLL 334

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
               N Y  T  SG  S+G       G I  G++E++NVD+A+E  ++I AQ+ Y  N+K
Sbjct: 335 RTGNNDYQATVGSGAASVGTAETGGRGVITGGSVESSNVDVAAEFAKMIVAQQAYQANAK 394

Query: 405 VFQT 408
              T
Sbjct: 395 TVTT 398


>gi|77463652|ref|YP_353156.1| flagellar hook protein FlgE [Rhodobacter sphaeroides 2.4.1]
 gi|77388070|gb|ABA79255.1| flagellar hook protein FlgE [Rhodobacter sphaeroides 2.4.1]
          Length = 423

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 123/449 (27%), Positives = 199/449 (44%), Gaps = 62/449 (13%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+  VF S+    S + V  G++
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFAD-VFNSSPYSISRTAVGSGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL------TRAGDFHINNEGF 115
                M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG 
Sbjct: 61  TLRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGV 120

Query: 116 LENVAGGVLLGYPLK----------NASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS 165
             N +G  LL +P+            ++ PL +    G           S + T+T  +S
Sbjct: 121 AINASGQKLLAWPVSVEGDALSQVPGSATPLTIPLTMG-----------SPVGTSTVALS 169

Query: 166 NNLDK-NATIITPDKTPKHNGRDAE----YTHKSSFAAYDTLGSSVVYDVYYTKTGDKK- 219
            +L   NA + T    P     D      Y   ++   +D  G++V    Y+ KT +   
Sbjct: 170 VDLPTDNAMLGTQAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTA 229

Query: 220 ------WEVSIFRQDQSTNNSFPYNVAPLNTVE--VSFDPVTGYLANSSHKAISFNDNTS 271
                 W V +    +           PL   +  ++FD  TG L+  +  A+SF   T+
Sbjct: 230 GNPQTDWAVRLVVAGE-----------PLTPAQGDLTFD-ATGALSGGT-GALSF---TA 273

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                 T+D+++T      F       +G +        V   G V   Y  G+ V + +
Sbjct: 274 ASGSSYTLDLTETQLADRSFEVNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQ 333

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + + T  +   L+    + +  T DSG    G  G +  G I +GALE ANVD+  EL  
Sbjct: 334 VVLVTFANPQALRQLGASGFAATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVH 393

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           LI AQRNY  ++K  +T +  M  +++++
Sbjct: 394 LITAQRNYQASAKAMETSNSLMQTIMNIR 422


>gi|21231397|ref|NP_637314.1| flagellar hook protein FlgE [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768550|ref|YP_243312.1| flagellar hook protein FlgE [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991641|ref|YP_001903651.1| flagellar hook protein FlgE [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113063|gb|AAM41238.1| flagellar biosynthesis, hook protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573882|gb|AAY49292.1| flagellar biosynthesis, hook protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733401|emb|CAP51602.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 407

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 113/424 (26%), Positives = 200/424 (47%), Gaps = 27/424 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS----NSYVSGGLE 61
           +  T++SG++A +  ++  S+NIANV+T G+K +   F+ + F STS     + V  G+ 
Sbjct: 2   AFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADM-FQSTSYGLSRNAVGSGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G
Sbjct: 61  VSNVAQQFSQGNIDPTGRSLDLAISGEGFFAVS-SNGAKMYTRAGNFQTDANGYVINPQG 119

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L  +    +     V     L+ +       S   T+T  ++  L  NA+   P  TP
Sbjct: 120 ARLQVFAPNPSGNGFDVGRLSDLQLLTTDSPPKS---TSTVNLAFTLPGNAS--APTVTP 174

Query: 182 KHNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNV 239
            +   D  Y+H +     YD+LG S V   Y+ KT +  +W+V  +    +        V
Sbjct: 175 FNPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVHNYVDGSA--------V 226

Query: 240 APLNTVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
               T++ S    TG L   ++  ++   F  +T      + +++S +TQ    F  + +
Sbjct: 227 GAPTTLQFS---DTGSLTTPANGIVAMDPFTPSTGAGVLSMQLNVSGSTQYGEAFALRDT 283

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+A GK  + S+   G V   Y +G    + ++A+ +  +   L+    N +  +  
Sbjct: 284 RQDGYASGKLNEISIDTSGVVFARYSNGADKALGQVALNSFVNPQGLQSQGNNMWAESYT 343

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG   +G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +
Sbjct: 344 SGAARVGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTI 403

Query: 417 ISLK 420
           I+++
Sbjct: 404 INIR 407


>gi|126462484|ref|YP_001043598.1| flagellar basal body FlaE domain-containing protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126104148|gb|ABN76826.1| flagellar basal body FlaE domain protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 423

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 123/449 (27%), Positives = 199/449 (44%), Gaps = 62/449 (13%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+  VF S+    S + V  G++
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFAD-VFNSSPYSISRTAVGSGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL------TRAGDFHINNEGF 115
                M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG 
Sbjct: 61  TLRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGV 120

Query: 116 LENVAGGVLLGYPLK----------NASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS 165
             N +G  LL +P+            ++ PL +    G           S + T+T  +S
Sbjct: 121 AINASGQKLLAWPVSVEGDALSQVPGSATPLTIPLTMG-----------SPVGTSTVALS 169

Query: 166 NNLDK-NATIITPDKTPKHNGRDAE----YTHKSSFAAYDTLGSSVVYDVYYTKTGDKK- 219
            +L   NA + T    P     D      Y   ++   +D  G++V    Y+ KT +   
Sbjct: 170 VDLPTDNAMLGTQAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTA 229

Query: 220 ------WEVSIFRQDQSTNNSFPYNVAPLNTVE--VSFDPVTGYLANSSHKAISFNDNTS 271
                 W V +    +           PL   +  ++FD  TG L+  +  A+SF   T+
Sbjct: 230 GNPQTDWAVRLVVAGE-----------PLTPAQGDLTFD-ATGALSGGT-GALSF---TA 273

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                 T+D+++T      F       +G +        V   G V   Y  G+ V + +
Sbjct: 274 ASGNSYTLDLTETQLADRSFEVNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQ 333

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           + + T  +   L+    + +  T DSG    G  G +  G I +GALE ANVD+  EL  
Sbjct: 334 VVLVTFANPQALRQLGASGFAATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVH 393

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           LI AQRNY  ++K  +T +  M  +++++
Sbjct: 394 LITAQRNYQASAKAMETSNSLMQTIMNIR 422


>gi|291617020|ref|YP_003519762.1| FlgE [Pantoea ananatis LMG 20103]
 gi|291152050|gb|ADD76634.1| FlgE [Pantoea ananatis LMG 20103]
          Length = 415

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 112/424 (26%), Positives = 192/424 (45%), Gaps = 19/424 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+ A S+ +  + +NIAN  T G+K + IAF+ +     + S V  G +++  
Sbjct: 2   SFSQAVSGLGAASSNLDVIGNNIANSATAGFKSSTIAFADMF----AGSNVGLGTKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS   T+   D+A+ G GFF +         +R G F ++    L N  G  + 
Sbjct: 58  IQNFNDGSTTTTSRGLDVALSGNGFFRLTNSAGAVSYSRNGQFTLDQNRNLVNTQGLNVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK-NATIITPDKTPKHN 184
           GYP   +  P  + S      I +   ++ A  TTT   +N + K N+T    D T    
Sbjct: 118 GYPA--SGVPPTIQSGANPVAIKIPTTQMPANATTT---ANQVAKLNSTSAALDDTKFSA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN---NSFPYNVAP 241
                Y+ K++   YDT G+S   D+Y+ KT D  W++        +N       YN   
Sbjct: 173 TDPTTYSAKNTITMYDTQGNSHSLDLYFVKTADNTWKIHGIDSTAGSNVGNYQMSYNANG 232

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITID-ISKTTQLAGGFIPQKS 296
             T   S D  TG +   S  A +      G++      + ++ +    Q  G      +
Sbjct: 233 QLTGVSSLD-ATGNVVAGSTTASTATVTIPGVNGANGTTVALNFVGSLQQNTGATTFGNA 291

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+APG    ++++ DG +   Y +     + ++ +A+  + + LK    N +  T  
Sbjct: 292 TQNGYAPGDLTSYAINNDGTITGSYSNQRTQLLGQIVLASFSNPEGLKSQGDNVWAETNA 351

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG  ++G       G + +GALE++NVD++ EL  +I AQRNY  N++  +T    ++ L
Sbjct: 352 SGQAAVGLANTGTFGSLTAGALESSNVDMSKELVNMIVAQRNYQANAQTIKTQDQILNTL 411

Query: 417 ISLK 420
           ++L+
Sbjct: 412 VNLR 415


>gi|52841451|ref|YP_095250.1| flagellar hook protein FlgE [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628562|gb|AAU27303.1| flagellar hook protein FlgE [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 437

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 117/443 (26%), Positives = 194/443 (43%), Gaps = 37/443 (8%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEIS 63
             TA+SG+ A +  +  + +NIAN  T+G+K +   F+ +   S      + V GG+++S
Sbjct: 3   FNTALSGIQASTRDLEVIGNNIANSATIGFKGSRAEFADIYSSSAYGSGSNAVGGGVKLS 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                   G+L  + +  DLA+ G GFFI+  +      TRAG F +NNE ++ N     
Sbjct: 63  RVHQSFATGTLSTSNNTLDLAVNGSGFFILSDQG-AKIYTRAGQFKLNNENYIVNANNQR 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L G    +  A   +    G  RIN   A ++   ++   +  NL+  +     D     
Sbjct: 122 LTGLLTDSNGA---ITGASGDLRINT--ANITPRASSNVSVGVNLNSQSKAPNVDWVGGA 176

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG----------------DKKWEVSIFRQ 227
           +     Y + +S   YD+LG+S V  +Y+                    + +W V+ F+ 
Sbjct: 177 SPATDTYNNVTSSTIYDSLGNSHVLSMYFIHADSTALAGSPNAASPAGTENQWYVA-FQI 235

Query: 228 D----------QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQI 277
           D          Q+TNN F  N     +    FD     L N+    +SFN N       +
Sbjct: 236 DNQNVPPNVGAQNTNNLFRANFNSDGSFAGVFDTSNAALPNN-LIPLSFNLNNGSSPLNL 294

Query: 278 TIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
            ID+S +TQ    F  Q +  NG+  G      +   G +   Y +G  + + ++ +A  
Sbjct: 295 NIDLSDSTQFGSPFAVQSAYNNGYTTGSLAGLDIDDSGMIYGRYTNGQSLAMGQIQLANF 354

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
              ++L+     ++  T  SG   I  PG    G I SG LE +NVD+  EL +LI AQR
Sbjct: 355 ADPESLQNIGNTSWAETTASGQPLISAPGSGGLGLINSGRLEESNVDLTGELVKLINAQR 414

Query: 398 NYAVNSKVFQTGSDFMDILISLK 420
           N+  N++  +TG      +I+++
Sbjct: 415 NFQANAQTIRTGDAITQTIINIR 437


>gi|196039080|ref|ZP_03106387.1| putative flagellar hook protein FlgE [Bacillus cereus NVH0597-99]
 gi|196030225|gb|EDX68825.1| putative flagellar hook protein FlgE [Bacillus cereus NVH0597-99]
          Length = 437

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 116/450 (25%), Positives = 196/450 (43%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAE---YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    T + +     T  +    +V     G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSV-R 234

Query: 227 QDQSTNNSFPYNVAPLNTVEVSF---------------DPVTGYLANSSHKAISFNDNTS 271
            D      F           + F               DPVTG +       I F     
Sbjct: 235 NDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|190574263|ref|YP_001972108.1| flagellar hook protein FlgE [Stenotrophomonas maltophilia K279a]
 gi|190012185|emb|CAQ45808.1| putative flagellar hook protein [Stenotrophomonas maltophilia
           K279a]
          Length = 407

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 109/420 (25%), Positives = 190/420 (45%), Gaps = 27/420 (6%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLEISTK 65
           ++SG++A ++ +S  ++N+ANV+T G+K +   F+ L F +T    S + V  G+ +S  
Sbjct: 6   SLSGINAANSDLSVTANNVANVNTTGFKESRAEFADL-FSATGYGLSKNAVGSGVRVSNV 64

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               +QG    T  + D+AI G+GFF +   +     +RAG+F  +  G++ N  G  L 
Sbjct: 65  AQQFKQGHNEQTGRSLDMAISGEGFFTMN-MNGTRVYSRAGNFQTDASGYVVNPQGARLQ 123

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
            +                L+ +              GF      K  T+ T D T  +  
Sbjct: 124 VFAPNADGTNFDAGRMVDLQLLTTDSPPKQTSEVKVGFTLPANAKQPTVTTFDPTDSN-- 181

Query: 186 RDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVAPLN 243
               Y H S     YD+LG S +   Y+ K  +  +W V  +   Q      P       
Sbjct: 182 ---SYNHSSGGITVYDSLGVSHIQVSYFVKGANPNEWTVRNYVDGQPAGAPTP------- 231

Query: 244 TVEVSFDPVTGYLANSSHKAIS---FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
              V+FD  +G L   +   +S   F   T      +T+D+S +TQ    F  + ++ +G
Sbjct: 232 ---VTFDN-SGKLTAPADGKVSLGTFTPTTGAGVLNMTLDVSGSTQYGEKFALRNTQQDG 287

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +A GK  + +VS+ G V   Y +G   P+ ++A+ T  +   L+    N ++ T  SG  
Sbjct: 288 YAAGKLNEITVSETGVVYARYSNGADKPLGQVALTTFNNPQGLESKGNNLWVDTFSSGTP 347

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G P  +  G+I +G+LE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 348 RTGMPDTSNLGKIQAGSLEASTVDLTEQLVNMITAQRNFQANAQMITTQDQITQTVINIR 407


>gi|295097203|emb|CBK86293.1| fagellar hook-basal body proteins [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 404

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 107/422 (25%), Positives = 190/422 (45%), Gaps = 26/422 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A +  +  V +NIAN  T G+K  ++AF+  +F  T+      GL +   
Sbjct: 2   SFSQGLSGLNAAAKALDVVGNNIANSQTAGFKAGSVAFAD-IFAGTT------GLGVQVA 54

Query: 66  DMISEQGSLMHTASNT--DLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
            +    G    TA N+  D+ +QGKGFF +          R G F  +  G + N   G+
Sbjct: 55  GVTQNFGDGGLTAGNSSLDMGLQGKGFFRMVSEGGAVYYGRNGQFKQDQNGNIINSTNGL 114

Query: 124 LL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY  +    P  +     +  I +   ++    +T G ++ NL  + T I  D    
Sbjct: 115 YLTGY--QATGTPPTIAPGAPVGPIRIPTEDMPPAASTAGSLTGNLKSDDTTIITDSFDY 172

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
            + +   Y ++S   A DTLG+     VY+ +T   +W+   + +D++   +       +
Sbjct: 173 SDPK--TYNYQSQIEATDTLGNKHTVKVYFVQTAAGEWKA--YARDETAPGT-----PDV 223

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ----ITIDISKTTQLAGGFIPQKSEI 298
            ++++ FD   G +  ++  +     N +  +      I +D+S  T+ A   + +   I
Sbjct: 224 TSLDLKFDS-NGNMDTAAMASTKMTINGAAFNGSAPLSIDMDLSSLTRRATDSLVKVDTI 282

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G APGK + F +   G V   Y +G R  + ++ +A   +   L     N +  T  SG
Sbjct: 283 DGQAPGKYQSFVIGDSGEVVATYSNGQRQTVAQIVLADFANSGGLAAEGNNVWSETPQSG 342

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
              +G  G    G I    LE +NVD+  E+  +I  QRNY  NS+  +T S+ +  L++
Sbjct: 343 QPFLGTSGSGSFGTINGNMLEQSNVDLGQEMVNMIVYQRNYQSNSQTIKTQSELLQTLVN 402

Query: 419 LK 420
           L+
Sbjct: 403 LR 404


>gi|90577344|ref|ZP_01233155.1| flagellar hook protein [Vibrio angustum S14]
 gi|90440430|gb|EAS65610.1| flagellar hook protein [Vibrio angustum S14]
          Length = 408

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 119/421 (28%), Positives = 192/421 (45%), Gaps = 44/421 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIST- 64
           S   A+SG+DA + +++ +S+NIANV T G+K +   FS++      N   +GG+E++  
Sbjct: 2   SFDIALSGLDATNVQLNTISNNIANVSTSGFKESRTEFSAVY-----NGMQAGGVEVAAI 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                + GS+  T    DLAI G GFF+ K        TR+G F+ + +  + +  G  L
Sbjct: 57  SQNFDKTGSITGTGRPLDLAISGSGFFVTKDHTGQTLYTRSGVFNSDKDNNIVSNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQG--LERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP- 181
            GY +         N+ Q   ++ + +  A L A  T       NLD  +++I P   P 
Sbjct: 117 QGYTVD------ANNNLQAGAVDNLKITTASLQAKATDDLAFVANLDARSSVINPATNPF 170

Query: 182 KHNGRDA---EYTHKSSFAAYDTLGSSVVYDVYYTK----------TGDKKWEVSIFRQD 228
             N  D+    YT K     YD+LG+      Y++K          T   +W+V++    
Sbjct: 171 DPNATDSFNSSYTSK----VYDSLGNPHTVTQYFSKREEYDPNSPNTTANRWDVNVVVDG 226

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQL 287
              N         + T E+ F+      + ++  A++FN   +G D   I IDI+ TTQ 
Sbjct: 227 DDAN---------ITTEEIIFNTDGTLQSPTAPFAVNFNP--AGADAANINIDIAGTTQF 275

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F    +  NG+  G+     V  +G V   Y +G      ++ +A   +   L   +
Sbjct: 276 GADFGVSTNAPNGYTSGELAGVRVEDNGMVFATYTNGQSQLQGQVMLADFANPQGLVKTN 335

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           G +++ +  SG    G P     G + +GALE +NVD+ SEL  L+ AQRNY  N+K   
Sbjct: 336 GTSWIQSFSSGAPVNGAPSTGTLGGLVAGALEGSNVDLTSELVSLMTAQRNYQANAKTIS 395

Query: 408 T 408
           T
Sbjct: 396 T 396


>gi|228914332|ref|ZP_04077947.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228845326|gb|EEM90362.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 437

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 115/450 (25%), Positives = 196/450 (43%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAE---YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    T + +     T  +    +V     G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSV-R 234

Query: 227 QDQSTNNSFPYNVAPLNTVEVSF---------------DPVTGYLANSSHKAISFNDNTS 271
            D      F           + F               DPVTG +       I F     
Sbjct: 235 NDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   +G  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGVGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|126444045|ref|YP_001061246.1| flagellar hook protein FlgE [Burkholderia pseudomallei 668]
 gi|134280998|ref|ZP_01767708.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia pseudomallei 305]
 gi|167725930|ref|ZP_02409166.1| flagellar hook protein FlgE [Burkholderia pseudomallei DM98]
 gi|167905090|ref|ZP_02492295.1| flagellar hook protein FlgE [Burkholderia pseudomallei NCTC 13177]
 gi|254182894|ref|ZP_04889487.1| flagellar hook protein FlgE [Burkholderia pseudomallei 1655]
 gi|254299686|ref|ZP_04967135.1| flagellar hook protein FlgE [Burkholderia pseudomallei 406e]
 gi|125657218|gb|ABN48706.1| flagellar hook protein FlgE [Burkholderia pseudomallei]
 gi|126223536|gb|ABN87041.1| flagellar hook protein FlgE [Burkholderia pseudomallei 668]
 gi|134248020|gb|EBA48104.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia pseudomallei 305]
 gi|157809637|gb|EDO86807.1| flagellar hook protein FlgE [Burkholderia pseudomallei 406e]
 gi|184213428|gb|EDU10471.1| flagellar hook protein FlgE [Burkholderia pseudomallei 1655]
          Length = 395

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 184/419 (43%), Gaps = 35/419 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +++++ +S NIAN +T G+K     F+++V  + +N    G +  S  
Sbjct: 2   SFNIALSGINAINSQLNTISHNIANANTYGFKAGRANFATMVAGTQANGTYIGSITQS-- 59

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             +  +G  + T    D AI G GFF+ K  D     TR G F  + +G++ +  G    
Sbjct: 60  --VGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSMLFTRFGYFQRDADGYIVDGFGRRAQ 117

Query: 126 GYPLKNASAPLIV-------NSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
           GY    A   + V        +   LE +    A+ +A          N DK+       
Sbjct: 118 GYGASGAYGDIRVPTDTEPAKASDSLEYVGNLSADWAAPKNP------NFDKD------- 164

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
                   D  + H  +   YD+LG   +   Y+ K      +V  +    + +      
Sbjct: 165 -------DDTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVIAYY---AMDGEIVGG 214

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
             P+ TV + FD      A +S   +            I ++ + TTQ+AG      +  
Sbjct: 215 NTPVQTV-LQFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGETTTTVNRD 273

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+A G P +  + +DG V + Y +G +  +  LA+AT  ++D L       +  +  SG
Sbjct: 274 NGYAAGVPGEVMLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLSAVGDTAWRASAASG 333

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           +  IG  G    G++ +G+LE +N D+  EL +++ AQRNY  NSKV  T +  M  L+
Sbjct: 334 NPLIGSAGSGALGKVVAGSLELSNADVTQELVDMMSAQRNYQANSKVLSTENQMMQALM 392


>gi|49480337|ref|YP_035873.1| flagellar hook protein FlgE [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|49331893|gb|AAT62539.1| flagellar hook protein [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 437

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 114/463 (24%), Positives = 194/463 (41%), Gaps = 70/463 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-------------- 215
           +N   ++ +                 F  +D  G+S+   V   +               
Sbjct: 180 RNQNALSHE-----------------FTVFDAEGNSLTLRVNIKQKTTKETVDGKEVENP 222

Query: 216 --GDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSF---------------DPVTGYLAN 258
             G+  + VS+ R D      F           + F               DPVTG +  
Sbjct: 223 VPGEYTYTVSV-RNDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITK 281

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
                I F          +T+D+S  T    G     +E+ G       D+S+S  G+V 
Sbjct: 282 GGSVQIPFGSG-------LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVM 334

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
           + Y DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A 
Sbjct: 335 MKYSDGSMKVVGQLAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAK 394

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E++NVD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 395 ESSNVDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|167037660|ref|YP_001665238.1| hypothetical protein Teth39_1248 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116075|ref|YP_004186234.1| flagellar hook-basal body protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856494|gb|ABY94902.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929166|gb|ADV79851.1| flagellar hook-basal body protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 417

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 121/440 (27%), Positives = 207/440 (47%), Gaps = 44/440 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV  +   N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVS-KGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            +++G L    G  +LG+   +      VN+  G L  I++K+ + +    TT   I  N
Sbjct: 120 FDSQGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISLKNWSSIDPAATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           ++ +  I         NG         +   YD+ G S +  + +TK     W  S+   
Sbjct: 177 INASTEI---------NG-----AISYNILVYDSQGGSHIATITFTKNDATTWNWSVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKA---ISFNDNT---SGIDQQITIDI 281
           D + ++     V    T+    D      AN    A   ++FN NT   S     +++D+
Sbjct: 223 DPAISS-----VDGSGTLTFGADGRILPDANGVRIANGTLNFNMNTAVTSATIGPVSLDL 277

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S+ T  +     ++   +G+  G  +  ++ K G V  IY +G R  I ++AIA   +  
Sbjct: 278 SRLTMFSSETDLRELSKDGNEAGSLESINIDKYGVVSGIYSNGRRQVIGQIAIADFQNPM 337

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+      ++ T +SG+  IG  G +  G I  G LE +NVD+A+E T++I  QR +  
Sbjct: 338 GLEKVGNTMFINTVNSGEPMIGAAGTDTRGSINPGTLEMSNVDLANEFTDMIVTQRGFQA 397

Query: 402 NSKVFQTGSDFMDILISLKR 421
           N++V     + +  L+++KR
Sbjct: 398 NARVITASDEILQDLVNMKR 417


>gi|74101658|gb|AAZ99748.1| FlgEL [Aeromonas hydrophila]
          Length = 397

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 105/415 (25%), Positives = 186/415 (44%), Gaps = 25/415 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS-T 64
           S    +SG+ A +  +S +S+N+AN  T G+K +   F+++          +GG+E++  
Sbjct: 2   SFSIGLSGLRAVNQELSVISNNVANASTAGFKSSRAEFAAIY-----GGGQAGGVEMNNV 56

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                  G +  T    DLAI G GFF++K  +     TRAG F  +   +L   +G  L
Sbjct: 57  SQNFDRNGDVTRTGRGLDLAISGSGFFVLKDSNGQTSYTRAGMFQRDPNNYLTTASGTRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY   +A    + +   G   I VK   L A  +       NL  +A++I     P   
Sbjct: 117 QGYTTNDAGE--LQSGVVG--DIQVKAGSLPAKASDKLEFVANLKADASVIDQTAHPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
            +   +++  S   YD+LG       Y+ KT D  W+V+           + +N     +
Sbjct: 173 AKSDSFSYSQSSKVYDSLGVEHTVTQYFVKTADNTWQVN-----------YAFNGTKTGS 221

Query: 245 -VEVSFDPVTGYLANSSHKAISFNDNTSGIDQ-QITIDISKTTQLAGGFIPQKSEINGHA 302
            V + F+   G L + +   +  N    G ++  +++D+++ +Q A  F   +++ NG+A
Sbjct: 222 PVTMEFN-TNGTLKSPTTSPV-LNLTPPGAEKIALSVDVARVSQYASDFNATRNQSNGYA 279

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G      V  DG V   + +G  +   ++ +A   + + L   +  T+  +  SG   +
Sbjct: 280 AGDLTGVKVDADGGVYATFTNGQSLLQGQVVMANFTNPNGLMQTNNTTWQQSFSSGQPVL 339

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G PG    G + +GA E++NVD+  EL  L+ +QRNY  N+K   +      +L 
Sbjct: 340 GAPGTGTMGSLTAGAYESSNVDLTGELVSLMTSQRNYQANAKTISSADKMTQVLF 394


>gi|332558508|ref|ZP_08412830.1| FlgE [Rhodobacter sphaeroides WS8N]
 gi|12057218|gb|AAF14370.2|AF133240_4 flagellar hook protein FlgE [Rhodobacter sphaeroides]
 gi|332276220|gb|EGJ21535.1| FlgE [Rhodobacter sphaeroides WS8N]
          Length = 423

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 123/451 (27%), Positives = 196/451 (43%), Gaps = 66/451 (14%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+  VF S+    S + V  G++
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFAD-VFNSSPYSISRTAVGSGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL------TRAGDFHINNEGF 115
                M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG 
Sbjct: 61  TLRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGV 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
             N +G  LL +P+              +E   +     SA P T      +    +T+ 
Sbjct: 121 AINASGQKLLAWPVS-------------VEGDALSQVPGSATPLTIPLTMGSPVGTSTVA 167

Query: 176 TPDKTPKHN---GRDAEYTHKSSF--------AA------YDTLGSSVVYDVYYTKTGDK 218
                P  N   GR A     ++F        AA      +D  G++V    Y+ KT + 
Sbjct: 168 LSVDLPTDNAMLGRQAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANP 227

Query: 219 K-------WEVSIFRQDQSTNNSFPYNVAPLNTVE--VSFDPVTGYLANSSHKAISFNDN 269
                   W V +    +           PL   +  ++FD  TG L+  +  A+SF   
Sbjct: 228 TAGNPQTDWAVRLVVAGE-----------PLTPAQGDLTFD-ATGALSGGT-GALSF--- 271

Query: 270 TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
           T+      T+D+++T      F       +G +        V   G V   Y  G+ V +
Sbjct: 272 TAASGNSYTLDLTETQLADRSFEVNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAM 331

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASEL 389
            ++ + T  +   L+    + +  T DSG    G  G +  G I +GALE ANVD+  EL
Sbjct: 332 GQVVLVTFANPQALRQLGASGFAATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEEL 391

Query: 390 TELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             LI AQRNY  ++K  +T +  M  +++++
Sbjct: 392 VHLITAQRNYQASAKAMETSNSLMQTIMNIR 422


>gi|302338085|ref|YP_003803291.1| fagellar hook-basal body protein [Spirochaeta smaragdinae DSM
           11293]
 gi|301635270|gb|ADK80697.1| fagellar hook-basal body protein [Spirochaeta smaragdinae DSM
           11293]
          Length = 460

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 116/466 (24%), Positives = 208/466 (44%), Gaps = 58/466 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----------- 54
           S+   +SG+     R+  + +NI+NV+TVG+K+  + F  L+  + S +           
Sbjct: 3   SLYAGVSGLQNHQTRMDVIGNNISNVNTVGFKKGRVNFQDLLSQTMSGAARPTDEVGGVN 62

Query: 55  --YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINN 112
              V  G+ +++ D +  QGSL  T   TD+AIQG GFFI +  D     TRAG F ++ 
Sbjct: 63  PKQVGLGMNVASIDTVHTQGSLQTTGIMTDIAIQGDGFFIERSGDK-EFYTRAGAFGLDE 121

Query: 113 EGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVK-HAELSAMPTTTGFISNNLDK 170
            G L N + G+ + G+  ++      +N+   +E + +   ++  A  T    ++ NLDK
Sbjct: 122 NGTLVNPSNGLRVQGWMAQDVDGRTFINTATDVEDLVIPVGSKDPARATGEVDLACNLDK 181

Query: 171 NATIITPDKTPKHNGRD--AEYTHKSSFAAYDTLGSSVVYDVYYTKTG--DKKWEVSIF- 225
              +I     P   G    AE T       YD+ G   V  + +T+    + +W+ S+  
Sbjct: 182 RTPLI-----PAGAGDADVAEGTWSIDKTIYDSFGEEHVLRINFTRVAGTENQWQGSVTV 236

Query: 226 --RQDQSTNNSFPYNVA--PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
               +  TN       A    NT  V FD +    A    +    ++ T  ++  +  D+
Sbjct: 237 DPDAEAPTNTLVDIGEANNDTNTFVVEFDNLGTLQAAVDGQGDRIDNGTLQVN--VAFDV 294

Query: 282 SKTTQLAGGFIPQKSEIN--------------------------GHAPGKPKDFSVSKDG 315
           +  T  AG  + Q   +N                          G+  G  + F + + G
Sbjct: 295 AGATPEAGAPVRQDMVLNLGDVGSVVDTITQFAEKSSTKAFKQDGYGMGYLESFKIDQSG 354

Query: 316 YVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFS 375
            +  +Y +G    + ++A+A+  +   L+    +T++ + +SG+  IG  G    G++ +
Sbjct: 355 VITGVYSNGANRTLGQVALASFTNPGGLEKAGESTFVVSNNSGEARIGESGVAGKGKLIA 414

Query: 376 GALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           GALE +NVD+A + T++I  QR +  NS+   T    +  L++LKR
Sbjct: 415 GALEMSNVDLAEQFTDMIVTQRGFQANSRTITTSDQMLQELLTLKR 460


>gi|167040321|ref|YP_001663306.1| hypothetical protein Teth514_1684 [Thermoanaerobacter sp. X514]
 gi|300914405|ref|ZP_07131721.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X561]
 gi|307724359|ref|YP_003904110.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X513]
 gi|166854561|gb|ABY92970.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter sp. X514]
 gi|300889340|gb|EFK84486.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X561]
 gi|307581420|gb|ADN54819.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X513]
          Length = 417

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 121/440 (27%), Positives = 207/440 (47%), Gaps = 44/440 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV  +   N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIVS-KGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            +++G L    G  +LG+   +      VN+  G L  I++K+ + +    TT   I  N
Sbjct: 120 FDSQGDLVTPDGYKVLGWMSTDGKT---VNTDTGNLVPISLKNWSSIDPAATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           ++ +  I         NG         +   YD+ G S +  + +TK     W  S+   
Sbjct: 177 INASTEI---------NG-----AISYNILVYDSQGGSHIATITFTKNDATTWNWSVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKA---ISFNDNT---SGIDQQITIDI 281
           D + ++     V    T+    D      AN    A   ++FN NT   S     +++D+
Sbjct: 223 DPAISS-----VDGSGTLTFGADGRILPDANGVRIANGTLNFNMNTAVTSATIGPVSLDL 277

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S+ T  +     ++   +G+  G  +  ++ K G V  IY +G R  I ++AIA   +  
Sbjct: 278 SRLTMFSSETDLRELSKDGNEAGSLESINIDKYGVVSGIYSNGRRQVIGQIAIADFQNPM 337

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+      ++ T +SG+  IG  G +  G I  G LE +NVD+A+E T++I  QR +  
Sbjct: 338 GLEKVGNTMFINTVNSGEPMIGAAGTDTRGSINPGTLEMSNVDLANEFTDMIVTQRGFQA 397

Query: 402 NSKVFQTGSDFMDILISLKR 421
           N++V     + +  L+++KR
Sbjct: 398 NARVITASDEILQDLVNIKR 417


>gi|111115108|ref|YP_709726.1| flagellar hook protein FlgE [Borrelia afzelii PKo]
 gi|216263795|ref|ZP_03435789.1| flagellar hook protein FlgE [Borrelia afzelii ACA-1]
 gi|110890382|gb|ABH01550.1| flagellar hook protein [Borrelia afzelii PKo]
 gi|215979839|gb|EEC20661.1| flagellar hook protein FlgE [Borrelia afzelii ACA-1]
          Length = 442

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 110/449 (24%), Positives = 204/449 (45%), Gaps = 39/449 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDVRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++  D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVAAIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGGNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +     R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPVIQEGASSADIARGTWVVNKS---LYDSFGNVSVLELRVVKDPNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKAISFN---DNTSGIDQQITID 280
              +Q++N +  + N   L     S +       +     I+FN    N   + +Q T++
Sbjct: 237 INGEQNSNFTLGFDNEGAL----ASLNGQPSQKGDVLQIPITFNVLGANVGEVGEQQTVN 292

Query: 281 IS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
           +            TQ A     +    +G+  G  +++ + ++G +  IY +G R  + +
Sbjct: 293 LKLGTVGSYTDSITQFADASSTKAIIQDGYGMGYMENYEIDQNGIIVGIYSNGIRRDLGK 352

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A+  +   L       ++ T +SG   IG  G    G+I SG LE ANVD+A + T+
Sbjct: 353 IALASFMNPGGLAKSGDTNFVETSNSGQARIGETGLAGLGDIRSGVLEMANVDLAEQFTD 412

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +I  QR +  N+K   T    +  L+ LK
Sbjct: 413 MIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|327393471|dbj|BAK10893.1| flagellar hook protein FlgE [Pantoea ananatis AJ13355]
          Length = 415

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 111/424 (26%), Positives = 192/424 (45%), Gaps = 19/424 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+ A S+ +  + +NIAN  T G+K + IAF+ +     + S V  G +++  
Sbjct: 2   SFSQAVSGLGAASSNLDVIGNNIANSATAGFKSSTIAFADMF----AGSNVGLGTKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS   T+   D+A+ G GFF +         +R G F ++    L N  G  + 
Sbjct: 58  IQNFNDGSTTTTSRGLDVALSGNGFFRLTNSAGAVSYSRNGQFTLDQNRNLVNTQGLNVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK-NATIITPDKTPKHN 184
           GYP   +  P  + +      I +   ++ A  TTT   +N + K N+T    D T    
Sbjct: 118 GYPA--SGVPPTIQTGANPVAIKIPTTQMPANATTT---ANQVAKLNSTSAALDDTKFSA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN---NSFPYNVAP 241
                Y+ K++   YDT G+S   D+Y+ KT D  W++        +N       YN   
Sbjct: 173 TDPTTYSAKNTITMYDTQGNSHSLDLYFVKTADNTWKIHGIDSTAGSNVGNYQMSYNANG 232

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGID----QQITID-ISKTTQLAGGFIPQKS 296
             T   S D  TG +   S  A +      G++      + ++ +    Q  G      +
Sbjct: 233 QLTGVSSLD-ATGNVVAGSTTASTATVTIPGVNGANGTTVALNFVGSLQQNTGATTFGNA 291

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+APG    ++++ DG +   Y +     + ++ +A+  + + LK    N +  T  
Sbjct: 292 TQNGYAPGDLTSYAINNDGTITGSYSNQRTQLLGQIVLASFSNPEGLKSQGDNVWAETNA 351

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG  ++G       G + +GALE++NVD++ EL  +I AQRNY  N++  +T    ++ L
Sbjct: 352 SGQAAVGLANTGTFGSLTAGALESSNVDMSKELVNMIVAQRNYQANAQTIKTQDQILNTL 411

Query: 417 ISLK 420
           ++L+
Sbjct: 412 VNLR 415


>gi|317492428|ref|ZP_07950857.1| fagellar hook-basal body protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919767|gb|EFV41097.1| fagellar hook-basal body protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 414

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 109/425 (25%), Positives = 199/425 (46%), Gaps = 30/425 (7%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A ++ +  + +NIAN  TVG+K  ++ F+ +     + S V  G+++++     
Sbjct: 6   AVSGLNAAASNLDVIGNNIANSQTVGFKSGSVTFADMF----AGSKVGLGVKVASVQQDF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
             G    T    D+AI G GFF ++  +     +R G F  N + FL N  G  L GYP 
Sbjct: 62  TDGITTTTNRGLDVAISGNGFFRMQDANGGVYYSRNGQFTKNQDNFLTNAQGVFLTGYPA 121

Query: 130 KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAE 189
             A +P  +        I +    + A  +++G +S NL+ +  +  P  +P        
Sbjct: 122 --AGSPPTIQQGAQPSPIQIPTGMMPAKASSSGNMSMNLNSSHEV--PKNSPFKVDDVDS 177

Query: 190 YTHKSSFAAYDTLGSSVVYDVYYTK----------TG-DKKWEVSIFRQDQSTNNSFPYN 238
           YT+ +S   YD+LG++   ++Y+ K          TG    W V       S +++    
Sbjct: 178 YTYATSITTYDSLGNTHNMNLYFVKGAPVAATPPATGMTTPWTV------YSVDSAAAAG 231

Query: 239 VAPLNTVEVSFDPVTGYLAN-SSHKAISFNDNTSGIDQQITIDISKTTQLAGG--FIPQK 295
            AP N  ++ FD   G L N  +  A++   N     Q   +  + + Q   G   +  K
Sbjct: 232 TAPQNAGKLEFDQ-NGTLQNPGTPLALNMAANNGAPAQNFNLTFTGSMQQNTGKDGVTAK 290

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           S+ +G+A G+   + ++ DG +   Y +     + ++ +A   + + L+    N +  + 
Sbjct: 291 SQ-DGYAAGEMTGYQINDDGTITGTYSNQQTQLLAQIVMANFANPEGLQSEGNNMWKESA 349

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG   +G  G +  G + SGA+E +NVD++ EL  +I AQRNY  N++  +T    +  
Sbjct: 350 TSGQAIVGVAGASGLGALTSGAVEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILQT 409

Query: 416 LISLK 420
           L++L+
Sbjct: 410 LVNLR 414


>gi|134095097|ref|YP_001100172.1| flagellar hook protein FlgE [Herminiimonas arsenicoxydans]
 gi|133739000|emb|CAL62048.1| Flagellar hook protein FlgE [Herminiimonas arsenicoxydans]
          Length = 418

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 107/440 (24%), Positives = 201/440 (45%), Gaps = 48/440 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +  +SG++A S  + A+ +N+AN  TVG+K++ + F+ +   + S S    +  G +I
Sbjct: 2   SFQQGLSGLNAASKSLEAIGNNVANSGTVGFKQSQVQFADIYASTLSGSGAAQIGIGTQI 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +  QG++  + +  D+AI G GFF +     +    R G F ++ EGF+++ +G 
Sbjct: 62  ARVAQLFSQGNITASNNPLDMAINGDGFFRMSSGGTI-SYARNGQFELSKEGFIQSASGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY + +A+  + + +      + +  A+L+   TT   +   LD    ++    +  
Sbjct: 121 RLTGY-MADANGVVAIGA---PAELKINKADLAPEATTKYELKLTLDSRKNVL---NSAN 173

Query: 183 HNGRD-AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN--- 238
            N  D   +   +S   YD+LG+S +   +Y KT   +W+V       +TN+  P     
Sbjct: 174 FNPDDPTTFNDSTSVPVYDSLGNSHILRTFYVKTAGGEWDVF------ATNDGVPIGYDP 227

Query: 239 --------VAPLNTVE----------VSFDPVTGYLANSSHKAISFNDNTSGIDQQITID 280
                      L T++          +   P+   +  S+     FN         I ID
Sbjct: 228 AAVPPANAPVALGTMQFGPGGVLIPSIPPTPLVVPMDVSTGATTPFN---------IVID 278

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
            + T Q A  F   K   +G  PG    F+V+ DG +   Y +G    + ++ +++  + 
Sbjct: 279 HTGTQQFAQSFGVNKQLPDGFPPGTLTAFNVASDGSIVGRYSNGKVNVLGQVILSSFANP 338

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
           + L+    N ++ T +SG      PG +  G + S  +E +NVD+ +EL  +I AQR Y 
Sbjct: 339 NGLQNIGDNQWVETAESGVALTSAPGSSGLGSVQSARIEESNVDLTAELVNMITAQRYYQ 398

Query: 401 VNSKVFQTGSDFMDILISLK 420
            N++  +T    +  L++L+
Sbjct: 399 ANAQTIKTQDQILQTLVNLR 418


>gi|297617147|ref|YP_003702306.1| fagellar hook-basal body protein [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144984|gb|ADI01741.1| fagellar hook-basal body protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 487

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 130/496 (26%), Positives = 215/496 (43%), Gaps = 86/496 (17%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM   +SG+     R+  + +NIANV+TVGYK++   F    + +            
Sbjct: 1   MMRSMYAGVSGLRTHQLRMDVIGNNIANVNTVGYKKSRAIFKDAFYQAIRGGSAPTGARG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+++S+ D+I+  GS   T  NTDLAI G G+FI++        TRAG F 
Sbjct: 61  GTNPQAIGLGVQLSSVDVIATPGSAQTTGKNTDLAIDGNGYFILE-SGGERYYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLLGY-PLKNASAPLIVNSFQGLERINVKHA----ELSAM----PTT 160
            +  G      G  ++GY P K+ S   I +S  G  +I++       ++SA+    P  
Sbjct: 120 FDVLGNYVASGGLHVMGYMPSKDDSGNWITDS-SGKRKIDITTGLVPIDISALQSTEPKA 178

Query: 161 TGFI--SNNLDKNATIITP----DKTPKH-----NGRDAEYTHKSSFAAYDTLGSSVVYD 209
           T  I  S N D   + + P    D+T        +G D++ T K     YDTLG+  V  
Sbjct: 179 TTLIRFSGNFD---STLEPEYVWDETSSSFVDNPDGADSKITSKE---FYDTLGNKRVQY 232

Query: 210 VYYTKTGDKK---------WEVSIFRQDQSTNNSFPYNVAPLNTVE---VSFDPVTGYLA 257
             + K  ++             SI+R   S++   P   A  +  E   + FD   G L 
Sbjct: 233 FKFEKVMERDNVDIGNGETMNGSIWRVRASSDPDCPNPTASDSKSEDYYLFFDE-KGKLI 291

Query: 258 NSSHK--------------------------------AISFNDNTSGIDQQITIDISKTT 285
            + H                                  I + +N     Q IT++ S  T
Sbjct: 292 RAKHDNGTTGASSSDWQEPDVTAMTFAATDDPSSQSITIHYVNNGVPTQQPITLNFSYLT 351

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q    F       +G+  G  +  ++ ++G +  +Y +G    + R+A+A   +   L  
Sbjct: 352 QYNATFTGWAEYQDGYTKGDLRSITIDQNGVILGVYSNGITDNLARVALAVFQNPAGLLA 411

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
             GN +  + +SGD  +G PG    G I  G+LE +NVD++ E T++I  QR +  NS++
Sbjct: 412 KGGNLFQVSNNSGDPKVGAPGEEAMGAILPGSLEMSNVDLSEEFTDMIVTQRGFQANSRI 471

Query: 406 FQTGSDFMDILISLKR 421
             T  + +  L++LKR
Sbjct: 472 ITTSDEMLQELVNLKR 487


>gi|330975976|gb|EGH76042.1| flagellar hook protein FlgE [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 442

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 125/451 (27%), Positives = 198/451 (43%), Gaps = 48/451 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFS----SLVFPSTSNSYVSGGLE 61
           S    + G+ A +  +    +NIANV T G+K +   F+      +  ++ N+ V  G+ 
Sbjct: 2   SFNIGLCGLYAANKSLDVTGNNIANVATTGFKSSRAEFADQYAQSIRGTSGNTNVGSGVR 61

Query: 62  ISTKDMISEQGSLMH-TASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +       QGSL   TA++ DLAI G GFF++   +     TRAG FH + EG++ N +
Sbjct: 62  TAAVSQQFSQGSLTTGTANSLDLAINGDGFFMMS-NNGEKLYTRAGAFHTDKEGYVVNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
              L GY + +A+  ++  +   L R+N  + +    P  T  I+N+ + N+T   P   
Sbjct: 121 NMKLQGYNV-DANGSVVTGALSDL-RVNASNLD----PKATSTITNSANLNSTTPLPTVA 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y +K S   YDT G++   D Y+ KTG   W +      +S ++  P + A
Sbjct: 175 TFDATDTKSYNNKYSTPTYDTQGNAHTLDQYFVKTGTNTWSMYSLMDGRSISD--PTSTA 232

Query: 241 PLNTVEVSFDPVTGYLANSSHKA-------ISFN-DNTSGIDQ----------------- 275
           P +  +++FD  +G L  ++  A       I FN D T  ++                  
Sbjct: 233 P-DKNDLTFDS-SGNLVTTAGAAVPTDSANIKFNADGTFAVNNWVPGVQVGTGTTATWAA 290

Query: 276 -------QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVP 328
                   I +D+S TTQ A      K + NG+A G+    +V   G +   Y +G    
Sbjct: 291 NGAAGAASIKLDMSSTTQTASVSGLLKQDQNGYATGQLSGMNVDSSGNLFATYTNGKSQV 350

Query: 329 IYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASE 388
           I + ++ +  +   L    G  +  T  SG    G P     G I   ALE +NVD+  E
Sbjct: 351 IGQTSLTSFANVQGLAQAGGTNWRETFASGVPVSGAPQSGTLGYITGQALEESNVDLTME 410

Query: 389 LTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L  LI+AQ NY  N+K   T S  M   I +
Sbjct: 411 LVNLIKAQSNYQANAKTISTQSTIMQTTIQM 441


>gi|149182512|ref|ZP_01860985.1| flagellar hook protein [Bacillus sp. SG-1]
 gi|148849772|gb|EDL63949.1| flagellar hook protein [Bacillus sp. SG-1]
          Length = 396

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 120/438 (27%), Positives = 202/438 (46%), Gaps = 65/438 (14%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS------------ 54
           M + +SGM     ++  + +NIANV+T G+K+  + F   +  + S +            
Sbjct: 1   MYSGISGMKNFQTKLDVIGNNIANVNTYGFKKGRVTFKDTMNQTISGASAAQEARGGRNP 60

Query: 55  -YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE 113
             V  G  +ST D I  Q SL  T    DLAI G G+F+VK  D     +RAG+F++++ 
Sbjct: 61  MQVGLGSTLSTIDTIHTQSSLQSTGRPLDLAINGDGYFVVKQGD-AQFYSRAGNFYLDDN 119

Query: 114 GFLENVAGGVLLGYPLKNASAPLIVNSFQG--LERINVK-HAELSAMPTTTGFISNNLDK 170
           G L N  G              + V S++   L+ I V  +A+L A  T +  +  NL  
Sbjct: 120 GTLVNGDG--------------MKVQSYENGVLQDIKVNVNAQLPAKITESISMFGNLSN 165

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG--DKKWEVSIFRQD 228
           +A    P            +  + +    D  G  +  D+  T  G    KW +    Q+
Sbjct: 166 DAVGNEP------------FVQQINVVTND--GKQITLDMKLTPQGTPSTKWGMEFINQN 211

Query: 229 QSTNNSFPYNVAPLNTVEVSFD---PVTGYLANSSHKAISFNDNTSGIDQQ--ITIDISK 283
             T         PLN+     D   PV    AN  +  + + D ++GI Q   +T+D ++
Sbjct: 212 GDT---------PLNSAAYVLDFGNPVD-PAANPPNVDLPYTD-SNGITQNLNVTMDYTQ 260

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T L GG +   ++ +G+  G  + F++   G ++ +Y +G    I  LA+A   +   L
Sbjct: 261 LTNL-GGDLSAAADPDGNTAGSLESFNIGSMGEINGVYSNGEITTIGYLALAKFSNPSGL 319

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               GN++  + +SG  ++   G  + G I SG+LE +NVD++ E TE+I AQR +  N+
Sbjct: 320 TKAGGNSFQQSVNSGTPNVNVAGEGR-GTIVSGSLEMSNVDLSEEFTEMISAQRGFQANT 378

Query: 404 KVFQTGSDFMDILISLKR 421
           ++  T  + +  L++LKR
Sbjct: 379 RIITTSDEILQELVNLKR 396


>gi|326319097|ref|YP_004236769.1| fagellar hook-basal body protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375933|gb|ADX48202.1| fagellar hook-basal body protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 425

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 118/440 (26%), Positives = 193/440 (43%), Gaps = 41/440 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV---FPSTSNSYVSGGLEI 62
           S +  +SG++A S  +  +  N+AN  TVG+K +   F+ +V     S   +    G+E+
Sbjct: 2   SFQQGLSGLNAASKNLDVIGHNVANSGTVGFKASRAEFAEMVANAIGSAGGTNAGIGVEL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T ++ D+AI G GFF ++  D     TRAG+F +++ G L      
Sbjct: 62  SAVAQQFNQGNISVTGNSLDVAINGDGFFTLQQPDGSRAYTRAGNFKLDSNGQLVTNTKA 121

Query: 123 VLLGYPL------KNAS--APLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
            ++GY L      + AS  APL   SF   + I  K        TT      NLD  A  
Sbjct: 122 QVMGYALDPITGKRTASNAAPL---SFPTSKPIPAKQ-------TTAITAEFNLDARAPD 171

Query: 175 ITPDKTPKHN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN 233
              D T           T+ +S   YD+ G +    +Y+ K G   W+V     D +   
Sbjct: 172 AAGDATATPPVPATPRSTYGTSINVYDSQGVAKPVSLYFQKNGANTWDVYDKLDDATA-- 229

Query: 234 SFPYNVAPLNTVEVSFD------------PVTGYLANSSHKAISFNDNTSGI-DQQITID 280
           + P    P+   ++ FD            P TG+    + K    N N  G+ D  + I 
Sbjct: 230 TPPVVATPIG--QIKFDNSGKIVSPTATAPETGFQMPLTVKPTPPNPN--GLADYTVNIK 285

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
           +   +Q    F       +G+  G+    S+  +G V   Y +G      ++A+A+  + 
Sbjct: 286 LDGVSQYGKAFAVSNLSQDGYTAGELTGISIENNGTVMTRYSNGVTRAEGQVALASFRNT 345

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
             L     N ++ T +SG   +G P   + G + SGALE +NVD+ +EL  ++ AQR Y 
Sbjct: 346 QGLASVGSNNWVETFESGQPVLGTPTEGKFGGLRSGALEDSNVDLTAELVNMMTAQRAYQ 405

Query: 401 VNSKVFQTGSDFMDILISLK 420
            N++  +T    M  L++L+
Sbjct: 406 ANAQTIKTQDQVMSTLVNLR 425


>gi|221639495|ref|YP_002525757.1| Flagellar hook protein FlgE [Rhodobacter sphaeroides KD131]
 gi|221160276|gb|ACM01256.1| Flagellar hook protein FlgE [Rhodobacter sphaeroides KD131]
          Length = 423

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 120/445 (26%), Positives = 195/445 (43%), Gaps = 54/445 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+  VF S+    S + V  G++
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFAD-VFNSSPYSISRTAVGSGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL------TRAGDFHINNEGF 115
                M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG 
Sbjct: 61  TLRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGV 120

Query: 116 LENVAGGVLLGYPLK----------NASAPLIVNSFQGLERINVKHAELSA-MPTTTGFI 164
             N +G  LL +P+            ++ PL +    G   +      LS  +PT     
Sbjct: 121 AINASGQKLLAWPVSVEGDALSQVPGSATPLTIPLTMG-SPVGTSTVALSVDLPTDDAM- 178

Query: 165 SNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----- 219
              L + A +  P            Y   ++   +D  G++V    Y+ KT +       
Sbjct: 179 ---LGRQAAV--PPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTAGNPQ 233

Query: 220 --WEVSIFRQDQSTNNSFPYNVAPLNTVE--VSFDPVTGYLANSSHKAISFNDNTSGIDQ 275
             W V +    +           PL   +  ++FD  TG L+  +  A+SF   T+    
Sbjct: 234 TDWAVRLVVAGE-----------PLTPAQGDLTFD-ATGALSGGT-GALSF---TAASGN 277

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
             T+D+++T      F       +G +        V   G V   Y  G+ V + ++ + 
Sbjct: 278 SYTLDLTETQLADRSFEVNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQVVLV 337

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           T  +   L+    + +  T DSG    G  G +  G I +GALE ANVD+  EL  LI A
Sbjct: 338 TFANPQALRQLGASGFAATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITA 397

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QRNY  ++K  +T +  M  +++++
Sbjct: 398 QRNYQASAKAMETSNSLMQTIMNIR 422


>gi|127512279|ref|YP_001093476.1| flagellar hook protein FlgE [Shewanella loihica PV-4]
 gi|126637574|gb|ABO23217.1| flagellar basal body FlaE domain protein [Shewanella loihica PV-4]
          Length = 453

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 119/458 (25%), Positives = 200/458 (43%), Gaps = 49/458 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+T G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNTTGFKESRAEFADVYASSIFANSKTTVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
           +      +QGSL  T++  D+AI G GFF+         L  TRAG F ++ + +L N A
Sbjct: 62  AQVAQQFQQGSLQFTSNALDMAINGGGFFVTSSEVGSQDLSYTRAGAFKVDADSYLVNSA 121

Query: 121 GGVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L  +P+ K+ ++  +  S    + + +     S   T    I  NL+     + P  
Sbjct: 122 GNYLQTFPVDKDGNSTSV--SLTTTQPVKIPDTAGSPQKTDNIGIQMNLNAGEGTLDP-- 177

Query: 180 TPKHNGRDAE-YTHKSSFAAYDTLGSSVVYDVYYTK------TGDKKWEVSIFRQD-QST 231
               N  D + Y + +S   YD+LG   +   Y+ +      TG   W V+ +  D +  
Sbjct: 178 -ANFNPNDPDTYNNSTSVTMYDSLGEPHILTTYFVRPPEAAYTGTSNW-VAFYAVDGKQV 235

Query: 232 NNSFPYNVAPLNTVEVSFDPVTGYLANSSH---KAISFNDNTS----------------- 271
           + +        +T        TG   N+S      +SFND  +                 
Sbjct: 236 DLAGAAGTYGRDTTGDGVADSTGTAVNASGWKGSVLSFNDTGAYTGSDPAVITTETLGVG 295

Query: 272 -------GID--QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD 322
                  G D  Q +T++ +  TQ A  F   +   +G   G+  +  V  DG ++  Y 
Sbjct: 296 GANVLGPGTDGSQTLTLNFNSPTQYASPFEVTELSQDGTTVGRLTNVEVGADGLINASYS 355

Query: 323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETAN 382
           +G+ VP+ R+A+A   +E  L      ++  + DSG    G       G I S ALE +N
Sbjct: 356 NGSTVPLARVALARFSNEQGLTQVGNTSWKESLDSGPALAGEANSGTFGSIRSSALEQSN 415

Query: 383 VDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           VD+ +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 416 VDLTTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|86136709|ref|ZP_01055287.1| flagellar hook protein FlgE, putative [Roseobacter sp. MED193]
 gi|85826033|gb|EAQ46230.1| flagellar hook protein FlgE, putative [Roseobacter sp. MED193]
          Length = 388

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 112/410 (27%), Positives = 178/410 (43%), Gaps = 56/410 (13%)

Query: 46  LVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN----- 100
           +V  S+   Y +GG+  S   +I ++G L+ T ++TDLA+ G+G   V     +      
Sbjct: 1   MVVGSSGGRYSAGGVSASNMRLIDQRGPLVGTNNSTDLAVSGRGMLPVASLTEIEGGNGS 60

Query: 101 ---CLTRAGDFHINNEGFLENVAGGVLLGYPLKN----ASAPLIVNSFQGLERINVKHAE 153
               +T  G F  N +G+L   +G VLLG+P       +  P   ++ +GLE +     +
Sbjct: 61  PTMLMTTTGSFRTNADGYLTTNSGLVLLGWPANPDGTVSDGPR--DTAEGLEPVQYNMNQ 118

Query: 154 LSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYT 213
           L+  PTT   +  NL    T      T ++     EY        YD LGSS    + YT
Sbjct: 119 LTGEPTTNVGLGVNLPATDTEAGSAGTVRN--MTVEY--------YDNLGSSQTLGITYT 168

Query: 214 KT-----GDKKWEVSI----------------FRQDQSTNNSFPYNVAPLNTVEV-SFDP 251
            T        +W + I                F   ++   S     A +  V   ++DP
Sbjct: 169 PTVPATGTSNEWTMQITDSASGGAVIGEYTMTFNDSRTAGGSL----ASVTAVSGGAYDP 224

Query: 252 VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSV 311
            TG +       ++ +     I+  +  +    TQL+  F P     +G   G      V
Sbjct: 225 ATGSVV------VNVDGGPMEINLGMIGESDGFTQLSDTFAPASVTKDGSEVGTMVGVEV 278

Query: 312 SKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHG 371
              GYV   YD G    I+++ +  VP+ + LK  D  TYLP+ DSG   +   G    G
Sbjct: 279 DPQGYVRANYDSGASRVIFKIPLVDVPNLNGLKSLDNQTYLPSSDSGSYFLWDAGDGPTG 338

Query: 372 EIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E+ S A E +  D+A+ELT++I+ QR Y+ N+KV QT  + +    ++KR
Sbjct: 339 EVASYAQEESATDVATELTDMIKTQRAYSSNAKVIQTVDEMLQETTNIKR 388


>gi|196044997|ref|ZP_03112230.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB108]
 gi|300117326|ref|ZP_07055116.1| flagellar hook protein FlgE [Bacillus cereus SJ1]
 gi|196023999|gb|EDX62673.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB108]
 gi|298725161|gb|EFI65813.1| flagellar hook protein FlgE [Bacillus cereus SJ1]
          Length = 437

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 118/459 (25%), Positives = 196/459 (42%), Gaps = 62/459 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPD-------------------KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDV 210
           +N   ++ +                   KT K N  D +   K     Y T   SV  D 
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKEN-VDGKEVEKPVPGEY-TYTVSVRNDS 237

Query: 211 YYTK--------TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHK 262
              K        TG+K  +       + T+ +            V  DPVTG +      
Sbjct: 238 KNEKEFKPVEGMTGEKNLKFDTLGNLKETDEA------------VQKDPVTGEITKGGSV 285

Query: 263 AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD 322
            I F          +T+D+S  T    G     +E+ G       D+S+S  G+V + Y 
Sbjct: 286 QIPFGSG-------LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYS 338

Query: 323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETAN 382
           DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++N
Sbjct: 339 DGSMKVVGQLAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSN 398

Query: 383 VDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           VD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 399 VDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|253990127|ref|YP_003041483.1| flagellar hook protein FlgE [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781577|emb|CAQ84740.1| flagellar hook protein flge [Photorhabdus asymbiotica]
          Length = 404

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 118/435 (27%), Positives = 194/435 (44%), Gaps = 60/435 (13%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMIS 69
           A+SG++A +  +  + +NIAN  T G+K ++ AF+ +     + S V  G+++S  +   
Sbjct: 6   AVSGLNAAAANLDVIGNNIANAATYGFKSSSAAFADIF----AGSQVGLGVKMSGINQNF 61

Query: 70  EQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
           + G+   T    D+AI   GFF ++  D     +R G+F ++    + N+ G  L GYP 
Sbjct: 62  KDGTPTTTNRTLDMAITQGGFFRMQSSDGTIRYSRNGEFKLDENRNIINMQGMKLTGYPA 121

Query: 130 K--NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRD 187
              N  AP I       E I +    LSA  TT   ++ NL+      T   +P+     
Sbjct: 122 VSVNGGAPEIQKG-ANPEPITISQDMLSAKATTKVTMTANLNSMHKKTTGAFSPEE---A 177

Query: 188 AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST---------------- 231
             Y + +S   +D+LG+     V++ KT D +W+V    QD +                 
Sbjct: 178 DSYNYTTSVTTFDSLGNPHNVRVFFVKTNDNEWQV--HAQDSTVEGAKAASLGTLKFDGN 235

Query: 232 ------NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
                 NN F +NV  LN             +N++   I FN    G  QQ    I   +
Sbjct: 236 GKLIGDNNQFTFNVPSLNG------------SNAADITIDFN----GSKQQ---KIDADS 276

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
            LA    P++   +G+A GK   + + KDG V   Y +     + ++ +    + + L  
Sbjct: 277 ILA----PKQ---DGYAAGKFNGYRIEKDGRVIGTYSNLQSQVLGQIVLTNFANPEGLAA 329

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N ++ T  SG   IG  G    GE+ S  LE +NVD++ EL  +I AQRNY  N++ 
Sbjct: 330 QGDNVWVETGASGSSIIGIAGSGGFGELLSSTLEASNVDMSKELVNMIVAQRNYQSNAQT 389

Query: 406 FQTGSDFMDILISLK 420
            +T    +  L+S++
Sbjct: 390 IKTQDQILQTLVSMR 404


>gi|254255087|ref|ZP_04948404.1| Flagellar hook protein FlgE [Burkholderia dolosa AUO158]
 gi|124899732|gb|EAY71575.1| Flagellar hook protein FlgE [Burkholderia dolosa AUO158]
          Length = 419

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 104/412 (25%), Positives = 176/412 (42%), Gaps = 25/412 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+ A + ++  +S NIAN  T GYK     FS+    ST    + G    ST 
Sbjct: 30  SFNIALSGIKAINGQLGEISQNIANAGTYGYKAGRANFSAFYLGSTPGGVMVG----STS 85

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             ++  GSL+ T S  D A+ G GFF+ +  +     +R G F  +  G + +  G  + 
Sbjct: 86  QAMNVAGSLVSTGSGMDAALPGNGFFVTRDANGALVYSRVGRFGTDQHGNVIDYMGRKVQ 145

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY                +  +++    + A  + +   + N+  +A  + P        
Sbjct: 146 GYAAAGGGQ---------IGDLSIPGGGIPAKASESVAYAGNM--SADWVVPANGTFDKD 194

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y   SS    D+LG   V + Y+ K  D +  V      ++         AP   V
Sbjct: 195 DPQSYNRMSSQTVLDSLGREHVVNQYFVKGPDNQVTVHYTMDGEAVG-------AP---V 244

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           E++FD     ++ +   A+            + ID S TT   G     +   +GH PG 
Sbjct: 245 EMTFDEHGALISPTGKVALDLGTPAGAAALAVQIDYSGTTMFGGEATTTRRSADGHKPGT 304

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
                +++DG +++ Y +G +    +LA+AT  + D L    G  +  +  +G+   G  
Sbjct: 305 VTGVVLTEDGSLEVQYSNGEKSIAGQLAVATFQNADGLVSVSGTGWHASAAAGEALYGVA 364

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G     ++  GALE +NV++  EL  L+ AQ+NY  NSKV  T ++ +  L+
Sbjct: 365 GAGPIDKLVVGALEQSNVELTEELVNLMSAQQNYQANSKVLSTENEMVRTLM 416


>gi|83859391|ref|ZP_00952912.1| flagellar hook protein [Oceanicaulis alexandrii HTCC2633]
 gi|83852838|gb|EAP90691.1| flagellar hook protein [Oceanicaulis alexandrii HTCC2633]
          Length = 465

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 133/469 (28%), Positives = 207/469 (44%), Gaps = 52/469 (11%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSS--LVFPSTSNSYVSG 58
           M I  +M    SG+ A S+ ++A+SDNIANV+TVGYKR    F+    +       Y S 
Sbjct: 1   MSINSAMAAGASGLIANSSALAAISDNIANVNTVGYKRVDTIFTPNYKIGGGGETRYASS 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVK------GRDNVNCLTRAGDFHINN 112
           G+  +++  ++  G L    S TD+AI G GFF+V+      G  +    TR+G F  ++
Sbjct: 61  GVSSNSRLDVNSSGLLTPGVSATDMAIDGDGFFVVRPSPTAGGSSDAVLFTRSGGFQTDS 120

Query: 113 EGFLENVAGGVLLGYPLKNASAPLIVN----SFQGLERINVKHAELSAMPTTTGFISNNL 168
            G+L N AG  L  +P++   A   VN    +   LE +N+ +   +A  T++  I+ NL
Sbjct: 121 SGYLRNDAGMYLYAWPVQ---ADGTVNQNPSNVDTLEAVNLSNIGGTANATSSVRINANL 177

Query: 169 DKNATIITPDKT--PKHNGRD-AEYTHKSSFAA----YDTLGS--SVVYDVYYTKTGDKK 219
             + T      T  P  +G + A  T    F      YDT G   SV        T   +
Sbjct: 178 QASTTPSAAAATYDPTASGTNMASGTVTPDFERTIQIYDTQGGVRSVTMSFLKHATNANQ 237

Query: 220 WEVSIFRQDQS-TNNSFPYNVAPLNTVEVSFD---------PVT----------GYLANS 259
           W V +  Q  S      P     + T  V+FD         P T                
Sbjct: 238 WHVELHVQPASDVTTGAPLIDGQIATGIVAFDTNGEIVPGAPTTLPTSLPFEASDAAGAV 297

Query: 260 SHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE-------INGHAPGKPKDFSVS 312
              A+ +  +T    Q I++D+  T    GG     S        ++G   G      VS
Sbjct: 298 GAGAVRWAASTGVGAQTISLDLG-TAGTPGGITQFNSPSNLDSTVVDGAIFGAFAGVEVS 356

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
            DG++   + +G    +Y+L +ATV + + L    G ++  T DSG  ++  PG    G 
Sbjct: 357 DDGFLSARFTNGVVRRVYQLPVATVFNPNGLASVGGASFQITEDSGAFTLNAPGSGASGT 416

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           I +  +E +NVDIA+E + LI  QR Y+ +S++  T  + +   I +KR
Sbjct: 417 IAAKTVENSNVDIATEFSNLIITQRAYSASSRIITTADEMLAEAIQMKR 465


>gi|296133040|ref|YP_003640287.1| fagellar hook-basal body protein [Thermincola sp. JR]
 gi|296031618|gb|ADG82386.1| fagellar hook-basal body protein [Thermincola potens JR]
          Length = 419

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 117/439 (26%), Positives = 198/439 (45%), Gaps = 40/439 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM   +SG+     R+  + +NIANV+T+GYK+    F  ++  +            
Sbjct: 1   MMRSMFAGVSGLRNHQVRMDVIGNNIANVNTIGYKKARATFQDILSQNIRGASSPTATRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   V  G+ I+T D I  QGS   T   TD+ + G GFFIV G       TRAG+F 
Sbjct: 61  GTNPMQVGLGMTINTIDTIHTQGSSETTGKVTDMMVDGDGFFIV-GDGTNRFYTRAGNFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINV-KHAELSAMPTTTGFISNNL 168
            +  G L N +G ++ G+    A +   +++   +  I + K   +    T      NNL
Sbjct: 120 FDAVGNLINTSGLLVQGWM---ADSQGNIDTTVAISGIKIPKGQSIQPKATENATFVNNL 176

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQ 227
           D          TP            ++   YD+LG++    + + KT +  +W V +  Q
Sbjct: 177 DAGTPQYDNTVTPPVG------VVATTLEIYDSLGNAYNLPIEFRKTANSNEWSVVVDPQ 230

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKA----ISFNDNTSGI-DQQITIDIS 282
              T  +            + FD       N ++KA    I   + T+G  DQ I +D++
Sbjct: 231 GTFTAATLAVTTTS----NLIFD------GNGNYKAGDLTIDLTNFTNGANDQSIKVDLT 280

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           K TQ AG    + +  +G+A G    +++   G +   + +G    + ++A+A   +   
Sbjct: 281 KITQYAGESNVEPNFQDGYASGVLNGYAIDSSGVITGQFSNGLTKQLAQVALANFNNPAG 340

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L    GN +  + +SG+  IG  G    GEI  G LE +NVD++ E T++I  QR +  N
Sbjct: 341 LMKVGGNLFTQSNNSGNAQIGAAGTGGRGEISPGKLEMSNVDLSQEFTDMIITQRGFQAN 400

Query: 403 SKVFQTGSDFMDILISLKR 421
           S++     + +  L++LKR
Sbjct: 401 SRIITVSDEMLQELVNLKR 419


>gi|294140184|ref|YP_003556162.1| flagellar hook protein FlgE [Shewanella violacea DSS12]
 gi|293326653|dbj|BAJ01384.1| flagellar hook protein FlgE [Shewanella violacea DSS12]
          Length = 454

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 115/461 (24%), Positives = 202/461 (43%), Gaps = 54/461 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSL----VFPSTSNSYVSGGLE 61
           S   A+SG+ A    ++  ++NIANV+++G+K +   F+ +    +F + S + V GG+ 
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNSIGFKESRAEFADVYANSIF-ANSKTAVGGGVT 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFI----VKGRDNVNCLTRAGDFHINNEGFLE 117
            S       QGSL  T +  D+AI G GFF+    ++ +D+    TRAG F +N+  +L 
Sbjct: 61  TSQVAQQFHQGSLQFTNNALDMAINGGGFFVTSSELEAKDH--SFTRAGAFKVNSADYLV 118

Query: 118 NVAGGVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
           +  G  L  +P+ K+ ++  +  +     RI     + +  P  T  I+  ++ NA   T
Sbjct: 119 DSQGNYLQTFPVDKDGNSTSVSLTTTKPVRI----PDTAGSPKKTENINIQMNLNAADAT 174

Query: 177 PDKTP-KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK------TGDKKWEV------- 222
            D      N RD  Y + ++   YD+LG   +   Y+ +      TG+  W         
Sbjct: 175 LDPALFDPNDRDT-YNNSTAVTMYDSLGEPHILTTYFVRPPNAAYTGESNWAAFYAIDGQ 233

Query: 223 --------SIFRQDQSTN------NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFND 268
                    +F QD + +      N+   N        + F+    +        ++   
Sbjct: 234 QVDLAGPAGVFDQDTTGDGVADVLNTPAVNAGGWKGAVIKFNDTGAHTTTDPDPILTVQL 293

Query: 269 NTSGI---------DQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDI 319
             +G           Q +TID +  TQ A  F   +   +G   G+  +  V  DG ++ 
Sbjct: 294 GVAGAGVLGPGTDGTQTLTIDFNNPTQYASTFEVTELNQDGTTVGRLTNVEVGADGLINA 353

Query: 320 IYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALE 379
            Y +G+ V + R+A+A   +E  L      ++  + DSG    G       G I S ALE
Sbjct: 354 SYSNGSTVALARVALARFANEQGLTQVGNTSWRASLDSGLALAGEANSGTFGSIRSSALE 413

Query: 380 TANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +NVD+ +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 414 QSNVDLTTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 454


>gi|91776309|ref|YP_546065.1| flagellar hook protein FlgE [Methylobacillus flagellatus KT]
 gi|91710296|gb|ABE50224.1| protein of unknown function DUF1078-like protein [Methylobacillus
           flagellatus KT]
          Length = 410

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 107/428 (25%), Positives = 193/428 (45%), Gaps = 32/428 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           + +  +SG++A S  +  + +N+AN  TVG+K++   F+ +   S      S +  G +I
Sbjct: 2   AFQQGLSGLNAASKNIEVIGNNVANASTVGFKQSRTEFADVYANSLGGGNASKIGIGTKI 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++ ++ +  D+AI G GFF +     +   +R G F ++ +G+++N AG 
Sbjct: 62  AAITQQFTQGNISNSQNPLDVAINGNGFFRMSDNGAI-TYSRNGQFQLDKDGYIQNAAGQ 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY L N            L  + +  A++    TT+     NLD  A I+ P     
Sbjct: 121 RLTGYALANGQI-----QTGALTELRIDAADMPPRTTTSITGPLNLDSRAEILDPANFDI 175

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-------DKKWEVSIFRQDQSTNNS- 234
            +   + Y H +    +D+LG+S    +YY K+G          W V       S N S 
Sbjct: 176 DD--PSSYNHSTPIEVFDSLGNSHSVQLYYLKSGITTAPNATTTWTVM-----ASANGSQ 228

Query: 235 -FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID-QQITIDISKTTQLAGGFI 292
             P  +  +       DP        +   +S   ++ G+    +T++++ +TQ A  F 
Sbjct: 229 LMPNPIGTMVFDGSGIDPAI------TLAPLSIPLSSGGLTPMSVTLNLTGSTQFANTFN 282

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G+  G+   FS+  DG +   Y +G    + ++A+A   + + L+    N + 
Sbjct: 283 ESDLGQDGYGAGRLSSFSIGADGSILGRYSNGRSSVLGQVALANFRNLNGLQPLGDNQWA 342

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T +SG   +G       G + S  LE +NVD+ +EL  +I AQR Y  N++  +T    
Sbjct: 343 ETSESGPPIVGVANSGGLGVLQSYRLEDSNVDLTAELVNMITAQRVYQANAQTIKTEDQI 402

Query: 413 MDILISLK 420
           M  L++L+
Sbjct: 403 MQTLVNLR 410


>gi|224532235|ref|ZP_03672867.1| flagellar hook protein FlgE [Borrelia valaisiana VS116]
 gi|224511700|gb|EEF82106.1| flagellar hook protein FlgE [Borrelia valaisiana VS116]
          Length = 442

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 112/455 (24%), Positives = 205/455 (45%), Gaps = 51/455 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDTRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++  D I  QG+   T   +DL + G GFFI+K   N+   TRAG F 
Sbjct: 61  GTNPKQVGLGMNVAAIDTIHTQGAFQSTQKASDLGVSGNGFFILKEGKNL-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGF-ISNN 167
           ++++  L N A G+ + G+  ++     ++N+   +E + +   +     +T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDVEDLIIPIGDKEGARSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK--WEVSIF 225
           LDK   +I    +     R     +KS    YD+ G+  V ++   K  +    W  ++ 
Sbjct: 180 LDKRLPVIQEGASSADIARGTWVVNKS---LYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 226 -RQDQSTNNSFPY-NVAPLNTVEVSFDPVTGYLANSSHKA------ISFN---DNTSGID 274
              +Q++N +  + N   L T+              S K       I+FN    N   + 
Sbjct: 237 INGEQNSNFTLGFDNEGALATLN----------GQPSQKGDILQIPITFNVSGANVGEVG 286

Query: 275 QQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
           +Q T+++            TQ A     +    +G+  G  +++ + ++G +  IY +G 
Sbjct: 287 EQQTVNLKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGI 346

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
           R  + ++A+A+  +   L       ++ T +SG   IG  G    G+I SG LE ANVD+
Sbjct: 347 RRDLGKIALASFMNPGGLAKSGDTNFVETSNSGQARIGETGLAGLGDIRSGVLEMANVDL 406

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           A + T++I  QR +  N+K   T    +  L+ LK
Sbjct: 407 AEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLK 441


>gi|66046707|ref|YP_236548.1| flagellar hook protein FlgE [Pseudomonas syringae pv. syringae
           B728a]
 gi|63257414|gb|AAY38510.1| Flagellar basal body rod protein:Protein of unknown function
           DUF1078:Flagellar basal body FlaE [Pseudomonas syringae
           pv. syringae B728a]
          Length = 442

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 121/447 (27%), Positives = 194/447 (43%), Gaps = 40/447 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFS----SLVFPSTSNSYVSGGLE 61
           S    +SG+ A +  +    +NIANV T G+K +   F+      +  ++ N+ V  G+ 
Sbjct: 2   SFNIGLSGLYAANKSLDVTGNNIANVATTGFKSSRAEFADQYAQSIRGTSGNTSVGSGVR 61

Query: 62  ISTKDMISEQGSLMH-TASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +       QGSL   TA++ DLAI G GFF++   +     TRAG FH + EG++ N +
Sbjct: 62  TAAVSQQFSQGSLTTGTANSLDLAINGDGFFMMS-NNGEKLYTRAGAFHTDKEGYVVNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
              L GY + +A+  ++  +   L R+N  + E    P  T  I+N+ + N+T   P   
Sbjct: 121 NMKLQGYNV-DANGAVVTGALSDL-RVNASNLE----PKATTTITNSANLNSTTALPTVA 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN-------- 232
                    Y  K S   YDT G++   D Y+ KTG   W +      +S +        
Sbjct: 175 TFDATDTNSYNVKYSTPTYDTQGNAHTLDQYFVKTGTNTWSMYSLMDGRSISDPTSTTPD 234

Query: 233 -NSFPYN-----------VAPLNTVEVSFDP-----VTGYLAN---SSHKAISFNDNTSG 272
            N+  ++             P ++  + F+      VT ++      +  A ++  N + 
Sbjct: 235 KNNLTFDSSGKLVTTAGGAVPTDSANIKFNADGTFAVTNWVPGVQVGTGTAATWAANGAT 294

Query: 273 IDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRL 332
               I +D+S TTQ A      K + NG+A G+    +V   G +   Y +G    I + 
Sbjct: 295 GAASIKLDMSSTTQTASVSGLLKQDQNGYATGQLSGMNVDSSGNLFATYTNGKSQVIGQT 354

Query: 333 AIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTEL 392
           ++ +  +   L    G  +  T  SG    G P     G I   ALE +NVD+  EL  L
Sbjct: 355 SLTSFANVQGLAQAGGTNWRETFASGVPVSGAPQSGTLGYITGQALEESNVDLTMELVNL 414

Query: 393 IEAQRNYAVNSKVFQTGSDFMDILISL 419
           I+AQ NY  N+K   T S  M   I +
Sbjct: 415 IKAQSNYQANAKTISTQSTIMQTTIQM 441


>gi|301053291|ref|YP_003791502.1| flagellar hook protein [Bacillus anthracis CI]
 gi|300375460|gb|ADK04364.1| flagellar hook protein [Bacillus cereus biovar anthracis str. CI]
          Length = 437

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 118/459 (25%), Positives = 196/459 (42%), Gaps = 62/459 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPD-------------------KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDV 210
           +N   ++ +                   KT K N  D +   K     Y T   SV  D 
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKEN-VDGKEVEKPVPGEY-TYTVSVRNDS 237

Query: 211 YYTK--------TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHK 262
              K        TG+K  +       + T+ +            V  DPVTG +      
Sbjct: 238 KNEKEFKPVEGMTGEKNLKFDTLGNLKETDEA------------VQKDPVTGEITTGGSV 285

Query: 263 AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYD 322
            I F          +T+D+S  T    G     +E+ G       D+S+S  G+V + Y 
Sbjct: 286 QIPFGSG-------LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYS 338

Query: 323 DGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETAN 382
           DG+   + +LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++N
Sbjct: 339 DGSMKVVGQLAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSN 398

Query: 383 VDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           VD++ E  +L+  QR +  N+KV +   + ++ +++L R
Sbjct: 399 VDLSVEFVDLMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|71906391|ref|YP_283978.1| flagellar hook protein FlgE [Dechloromonas aromatica RCB]
 gi|71846012|gb|AAZ45508.1| Flagellar basal body rod protein:Protein of unknown function
           DUF1078:Flagellar basal body FlaE [Dechloromonas
           aromatica RCB]
          Length = 442

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 112/453 (24%), Positives = 209/453 (46%), Gaps = 50/453 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG-GLEIST 64
           + +  +SG++  S  +   S+NIAN  TVG+K  +  F+ +   S +    S  G+ +S 
Sbjct: 2   AFQQGLSGLNTSSKALDVTSNNIANASTVGFKSASTHFADVYAASLAGGGASQVGIGVSA 61

Query: 65  KDMISE--QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
             +  +  QG++  T+++ D+A+ G GFF +  +D     TR G FH+++ G++ N    
Sbjct: 62  SAIAQQFTQGNITTTSNSLDIALNGNGFFRMT-QDGAVRYTRNGQFHLDSTGYIVNDNKE 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP- 181
            L GY   +A   ++ ++  G   I V  A +S  P  TG  S+ +  +  + + DK P 
Sbjct: 121 NLTGYA-ADAQGKIVASTPSG---IKVDTAPIS--PQATGATSDGVRFSLNLNSTDKVPG 174

Query: 182 ----KHNGRD----AEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV-------SIFR 226
                  G +    + Y + ++   YDTLG++    +Y+ K+     EV         + 
Sbjct: 175 TAWTSPTGTNVPDTSTYNYSNAVTVYDTLGNAHTMTMYFVKSAPTAAEVLANPTTTGAWD 234

Query: 227 QDQSTNNSFPYNV--APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT------ 278
                + +   NV  +PL    ++FD    YLA ++   ++ N N  G+   ++      
Sbjct: 235 VHYQVDGTSEANVGGSPL---RMTFDSTGAYLAPTTPATLAVNLN--GVATNLSTPANVV 289

Query: 279 -----------IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
                      ++ + +TQ    F       +G+A G+    ++  +G +  +Y +G   
Sbjct: 290 TNSATSPLSFAMNFAGSTQYGSDFAIASKTQDGYASGQLSSLTIGDNGVIQGVYSNGQTR 349

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
            + ++ +A   + + L     N Y+ T DSG   IG P     G + SGA+E +NVD+ +
Sbjct: 350 NMAQIVLANFQNPNGLMSIGNNDYIETADSGQSMIGTPNTGTFGVLQSGAVEDSNVDLTA 409

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           EL  +I  QRNY  N++  +T    M  L++++
Sbjct: 410 ELVNMIVQQRNYQANAQSIKTQDQIMQTLVNIR 442


>gi|203287743|ref|YP_002222758.1| flagellar hook protein [Borrelia recurrentis A1]
 gi|201084963|gb|ACH94537.1| flagellar hook protein [Borrelia recurrentis A1]
          Length = 441

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 115/450 (25%), Positives = 199/450 (44%), Gaps = 42/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NI+NV+TVG+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNISNVNTVGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 +  G+ ++T D I  QGS   T   +DL I G GFFI++  DN +  TRAG F 
Sbjct: 61  GVNPKQIGLGMTVATVDTIHTQGSFQSTQKASDLGISGNGFFILRDGDN-SFYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLL-GYPLKNASAPLIVNSFQGLER--INVKHAELSAMPTTTGFISN 166
           +++   L N A G+ + G+  ++     + N+   +    I ++  E  A  T     + 
Sbjct: 120 VDSNRHLVNPANGMRIQGWMAESVGGEQVFNTSSDIRDLIIPIRDKE-GAKATEYITFAC 178

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TGDKKWEVSI 224
           NLDK   I+          R     +K+    YD+ G++ V ++   K  T    W  ++
Sbjct: 179 NLDKRLPIVQQGANEVDIARGTWVVNKT---IYDSFGNTNVVELRVLKDATAPNTWNATV 235

Query: 225 FRQDQSTNN---SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN--DNTSGIDQQITI 279
               +  +N    F    A L     S +   G   +     I+F   D  +G   + T+
Sbjct: 236 LVNGEENSNFTMGFDNEGALL-----SLNGQAGQPGDLLEFPITFGVIDANAGEGGEQTV 290

Query: 280 DIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
           ++            TQ A     +    NG+  G  +++ + ++G +  +Y +G R  I 
Sbjct: 291 NLRLGTVGSYADSITQFADASTTKAIVQNGYGMGYMENYEIDQNGVITGVYSNGIRRTIG 350

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           ++A+A+  +   L       +  T +SG   IG  G    G I SG LE ANVD+A + T
Sbjct: 351 KIALASFVNPGGLAKAGDTNFTETSNSGQARIGETGFAGLGTIRSGVLEMANVDLAEQFT 410

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ++I  QR +  N+K   T    +  L+ LK
Sbjct: 411 DMIVTQRGFQANAKTITTSDQLLQELVRLK 440


>gi|293115683|ref|ZP_05792615.2| flagellar hook protein FlgE [Butyrivibrio crossotus DSM 2876]
 gi|292808788|gb|EFF67993.1| flagellar hook protein FlgE [Butyrivibrio crossotus DSM 2876]
          Length = 440

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 123/464 (26%), Positives = 203/464 (43%), Gaps = 69/464 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVS----- 57
           ++ ++ + ++G+     ++  + +NIANV+TVG+K  ++ FS + + +T N+  +     
Sbjct: 1   MMRALYSGVAGLKTHQTKMDVIGNNIANVNTVGFKSQSVTFSDVFYQTTQNASGANAETG 60

Query: 58  -GGL------------EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTR 104
            GG              I+TK  +SE G    T++  DL I G   FIV      N  T+
Sbjct: 61  MGGTNAKQIGLGSTVSSITTK--VSESGGSQSTSNPFDLMINGDSMFIVN-NAGTNYFTK 117

Query: 105 AGDFHINNEGFLENVAGGVLLGYPLKNAS----APLIVNSFQGLERINVKHAELSAMPTT 160
           AG+F +++ G L    G  + G+           P+   +  G E    K+A   A    
Sbjct: 118 AGNFTVDSAGTLVTSQGYAVQGWKANEEGVIMKGPVTSLNLYGAEN---KYAAPEATENC 174

Query: 161 TGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW 220
           T  IS N++K           + +G ++      +   YDTLG      V  T+  D  +
Sbjct: 175 T--ISGNINK-----------EDDGFESGVGRSMNITFYDTLGYEYQVTVKVTQDPDDDY 221

Query: 221 EVSI-------------FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN 267
           + ++             F  D  T          L  V ++FD VTG LA+ +   ++ N
Sbjct: 222 KYNLVATGLTCGGKAVDFGADAQTKLE-----GLLKDVTLTFDKVTGELADPADGKVTLN 276

Query: 268 DNTSGID---QQITIDISKTTQLAG--GFIPQKSEINGHAPGK----PKDFSVSKDGYVD 318
             T GID   + + +D SK T L     F P + +  G   G+        S+ KDG + 
Sbjct: 277 TTTLGIDSLAKDVNLDFSKMTCLGTDTSFTPARGDKEGLGAGRLVGTMSGVSIQKDGIIV 336

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI-SIGFPGHNQHGEIFSGA 377
             YD+G    I ++A+A   +   L+    N +  T +SG+   IG       G    G 
Sbjct: 337 AYYDNGDSKIIAQIAVANFKNLSGLEKVGDNLFAETLNSGNFDGIGDDITEDGGYFSPGV 396

Query: 378 LETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           LE +NVD+A+E T++I  QR Y  NS++       ++ LI+LKR
Sbjct: 397 LEMSNVDLAAEFTDMITTQRGYQANSRIITVSDTLLEELINLKR 440


>gi|330811235|ref|YP_004355697.1| flagellar hook protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379343|gb|AEA70693.1| Putative flagellar hook protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 432

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 120/443 (27%), Positives = 195/443 (44%), Gaps = 42/443 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           S    +SG+ A + ++    +NIANV T G+K +   F   V+ +T     +  V  G+ 
Sbjct: 2   SFNIGLSGLYAANKQLDVTGNNIANVATTGFKSSRAEFED-VYSATKLGSGSKTVGNGVR 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           ++       QG + +T +  D+ IQG+GFF++   D     TRAG F  + EG++ N  G
Sbjct: 61  LANVSQQFGQGDVNNTGNVLDMGIQGQGFFVLS-NDGSLSYTRAGTFKTDKEGYITNSDG 119

Query: 122 -GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN--NLDKNATIITPD 178
              L GY +   +   I N      RI+  +      P+ T  +S+  NL+  AT IT  
Sbjct: 120 TSRLQGYGVD--ANGKIQNGILTDLRIDTSNLP----PSATSLVSSTINLNSTATAITAA 173

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
             P      A +T + +   YDT G+    D Y  KT    W V      ++ N + P  
Sbjct: 174 FNPSDT---ATFTKQFTTPVYDTQGNQHSMDQYMVKTAGNTWNVYTLIDGRNLNGTLPTT 230

Query: 239 V---APLNTVEVSFDP-------------------VTGYLANSSHKAISFNDNTSGIDQQ 276
               AP+ +  ++FD                    +TG++  +    + +  N +     
Sbjct: 231 TGATAPVPST-MNFDSNGKLTTVTTPPATVNSDLVLTGWVPGTVTNGV-WAANGAASAPT 288

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           ITI +  TTQ            NG+A G+  + ++   G +   + +    PI +LA+A+
Sbjct: 289 ITISMGNTTQFNADTARSIPTQNGYATGQITNLTIDGSGVLLANFSNNQTKPIGQLALAS 348

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +E  L+   G ++  T  SG      P     G I S +LE +NV++ +EL ELI+AQ
Sbjct: 349 FTNEQGLQPVGGTSWKETFASGIPGYDAPQTGTLGSIVSNSLEESNVNLTNELVELIKAQ 408

Query: 397 RNYAVNSKVFQTGSDFMDILISL 419
            NY  N+K   T S  M  +I +
Sbjct: 409 SNYQANAKTISTQSTIMQTIIQM 431


>gi|146277708|ref|YP_001167867.1| flagellar basal body FlaE domain-containing protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555949|gb|ABP70562.1| flagellar basal body FlaE domain protein [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 423

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 116/443 (26%), Positives = 193/443 (43%), Gaps = 50/443 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYVSGGLE 61
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+  VF S+    + + V  G++
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFAD-VFNSSPYSIARTAVGSGVQ 60

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL------TRAGDFHINNEGF 115
                M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N++G 
Sbjct: 61  TLRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNDKGV 120

Query: 116 LENVAGGVLLGYPLK----------NASAPLIVNSFQGLERINVKHAELSA-MPTTTGFI 164
             N +G  LL +P+             + PL +    G   +  K   ++  +PT    +
Sbjct: 121 AVNASGQKLLAWPVSVEGDALSQVPGTAVPLTIPLTMG-SPVGTKAVRMTVDLPTDDAML 179

Query: 165 SNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-------GD 217
                                    Y   ++   +D  G++V    Y+ KT        D
Sbjct: 180 GQQAAVPPAAA------FDAADPTTYAAVTAIPVFDAKGNAVEAAAYFIKTENPAAGSPD 233

Query: 218 KKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQI 277
             W V +    ++        + P    +++FD  TG LA  +  ++SF   T+GI    
Sbjct: 234 TGWAVRLVVAGET--------LTPAEG-DLAFD-ATGALAGGT-GSLSF---TTGIGTPY 279

Query: 278 TIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
           T+D++ T      F       +G +        V   G V   Y  G  V + ++ + T 
Sbjct: 280 TLDLTGTALTNRSFEVNTVNQDGKSAAALTSLEVDASGTVWAAYGAGDSVAMGQVVLVTF 339

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
            +   L+    + +  T DSG    G  G +  G I +GALE ANVD+  EL  LI AQR
Sbjct: 340 ANPQALRQLGASGFAATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITAQR 399

Query: 398 NYAVNSKVFQTGSDFMDILISLK 420
           NY  ++K  +T +  M  +++++
Sbjct: 400 NYQASAKAMETSNSLMQTIMNIR 422


>gi|330972413|gb|EGH72479.1| flagellar hook protein FlgE [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 442

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 126/451 (27%), Positives = 197/451 (43%), Gaps = 48/451 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFS----SLVFPSTSNSYVSGGLE 61
           S    +SG+ A +  +    +NIANV T G+K +   F+      +  ++ N+ V  G+ 
Sbjct: 2   SFNIGLSGLYAANKSLDVTGNNIANVATTGFKSSRAEFADQYAQSIRGTSGNTSVGSGVT 61

Query: 62  ISTKDMISEQGSLMH-TASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +       QGSL   TA++ DLAI G GFF++   +     TRAG FH + EG++ N +
Sbjct: 62  TAAVSQQFSQGSLTTGTANSLDLAINGDGFFMMS-NNGEKLYTRAGAFHTDKEGYVVNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
              L GY + +A+  ++  +   L R+N  + E    P  T  I+N+ + N+T   P   
Sbjct: 121 NMKLQGYNV-DANGAVVTGALSDL-RVNASNLE----PKATTTITNSANLNSTTALPTVA 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y  K S   YDT G++   D Y+ KTG   W +      +S ++  P + A
Sbjct: 175 TFDATDTNSYNVKYSTPTYDTQGNAHTLDQYFVKTGTNTWSMYSLMDGRSISD--PTSTA 232

Query: 241 PLNTVEVSFDPVTGYLANSSHKA-------ISFN-DNTSGIDQ----------------- 275
           P +  +++FD  +G L  ++  +       I FN D T  +                   
Sbjct: 233 P-DKNDLTFDS-SGNLVTTAGGSVPTDSANIKFNADGTFAVSNWVPGVQVGTGTTATWAA 290

Query: 276 -------QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVP 328
                   I +D+S TTQ A      K + NG+A G+    +V   G +   Y +G    
Sbjct: 291 NGATGAASIKLDMSSTTQTASVSGLLKQDQNGYATGQLSGMNVDSSGNLFATYTNGKSQV 350

Query: 329 IYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASE 388
           I + ++ +  +   L    G  +  T  SG    G P     G I   ALE +NVD+  E
Sbjct: 351 IGQTSLTSFANVQGLAQAGGTNWRETFASGVPVSGAPQSGTLGYITGQALEESNVDLTME 410

Query: 389 LTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           L  LI+AQ NY  N+K   T S  M   I +
Sbjct: 411 LVNLIKAQSNYQANAKTISTQSTIMQTTIQM 441


>gi|323705438|ref|ZP_08117013.1| fagellar hook-basal body protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535340|gb|EGB25116.1| fagellar hook-basal body protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 424

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 122/448 (27%), Positives = 202/448 (45%), Gaps = 53/448 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A    +  + +NIANV+TVG+K + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKANQAEMDVIGNNIANVNTVGFKASRMTFKEIFNQTIKGASAPQDNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +   G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFSNGGSQRTDNPTDLSIDGNGFFIVN-NGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            ++ G L    G  ++G+  ++      VN+  G L  I++K+ +  S   T T  +  N
Sbjct: 120 FDSNGDLVTPDGYKVMGWISQDGKT---VNTDTGNLSPISIKNWSSTSPASTKTIQLGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK-KWEVSIFR 226
           LD   ++          G    Y    +   YD+ G S V  + +TK  +   W  +I  
Sbjct: 177 LDAGTSV----------GSSVSY----NVTIYDSQGGSHVATIQFTKQDNAGNWNATITN 222

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFD-------------PVTGYLANSSHKAISFNDNTSGI 273
            D  TN S P  +       ++FD             PV  +    S   I+  + T G 
Sbjct: 223 FD-GTNLSTPVTIG-----TITFDSSGVIQQPAPPASPVGIFTVGVSSLPITNTNATLGD 276

Query: 274 DQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLA 333
              IT+D+SK T  +     ++   +G++ G  +  ++ + G V  IY +G    I ++A
Sbjct: 277 GTNITVDLSKLTMYSNPTDIRELSKDGNSAGSIESINIDQYGVVSGIYSNGRTQVIGQIA 336

Query: 334 IATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELI 393
           +A   +   L+      ++ T +SGD  IG       G I  G LE +NVD+A+E   +I
Sbjct: 337 LADFQNTQGLEKVGNTMFINTVNSGDPMIGAANTGTRGTIDPGTLEMSNVDLANEFANMI 396

Query: 394 EAQRNYAVNSKVFQTGSDFMDILISLKR 421
             QR +  N+KV  T  + +  L++L R
Sbjct: 397 TTQRGFEANAKVITTSDEILQDLVNLIR 424


>gi|163856435|ref|YP_001630733.1| hypothetical protein Bpet2124 [Bordetella petrii DSM 12804]
 gi|163260163|emb|CAP42465.1| flgE [Bordetella petrii]
          Length = 413

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 115/434 (26%), Positives = 196/434 (45%), Gaps = 51/434 (11%)

Query: 11  MSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISE 70
           +SG++A +  +  + +NIAN  TVG+K    +F+ +     ++S V  G+++S  +    
Sbjct: 7   LSGLNAAAQNLDVIGNNIANSGTVGFKSATASFADVY----ASSRVGLGVKVSAINQRFS 62

Query: 71  QGSLMHTASNTDLAIQG-KGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPL 129
            G++  T    D+AI G KGFF +         +R G+F ++ + +L N  G  L GY  
Sbjct: 63  VGNVTVTGGEYDIAIDGPKGFFRLTDPSGGVFYSRNGEFLVDKDFYLVNAQGYRLTGYAA 122

Query: 130 KN-ASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDA 188
               SAP+          + +    ++  PT    +  NL+ NA  I P  +P      +
Sbjct: 123 GAVGSAPV---------DLRLPQGNIAPKPTDAAGLQTNLNANADAIDPATSPFDPTLAS 173

Query: 189 EYTHKSSFAAYDTLGSS------------------VVYDVYYTKTGDKKWEVSIFRQDQS 230
            YT       YD+LG++                   VY+VYYT  G+          D +
Sbjct: 174 TYTDSVPTTVYDSLGNAHQLTQYFVKRAGDTVTNESVYEVYYTLDGEA--------MDPT 225

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISF---NDNTSGIDQ-QITIDISKTTQ 286
           T  +  +  A      ++FD   G L ++    +SF      TS  D   IT+     TQ
Sbjct: 226 TEAAGVWGGA----TTLTFD-AAGRLTSAPTVDLSFATPGGTTSPADPLAITMSYDGVTQ 280

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
               F P+ ++ NG++ G+    S++ DG +   Y +G    I  LA+A   +   L+  
Sbjct: 281 YGSDFSPKITQ-NGYSSGEYSGLSINSDGTLQANYTNGETAIIGTLALANFNNVQGLQPV 339

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N +  T  SG  ++G PG N    +   A+E +NVD++ EL  +I AQR Y  N++  
Sbjct: 340 GNNAWAETGASGQPTLGQPGTNGLATVVGQAVEASNVDMSKELVNMIVAQRTYQANAQTI 399

Query: 407 QTGSDFMDILISLK 420
           +T  + M +L++++
Sbjct: 400 KTQDEVMQVLMNMR 413


>gi|23092315|gb|AAN08640.1| FlgE [Aeromonas hydrophila]
          Length = 453

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 119/466 (25%), Positives = 198/466 (42%), Gaps = 65/466 (13%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+++G+K +   F+ +   S    + + V  G+  
Sbjct: 2   SFNNALSGVNAAQKDLNVTANNIANVNSIGFKESRAEFADVYANSIFVNAKTQVGNGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVK-GRDNVN-CLTRAGDFHINNEGFLENVA 120
                   QG+L  T ++ DLAIQG GFF+   G  N++   TRAG F ++   ++ N  
Sbjct: 62  GAVAQQFHQGALQFTNNSLDLAIQGNGFFVTSDGLTNLDRTYTRAGAFKLDENSYMVNNQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFI--------------SN 166
           G  L GY +     P  V S    + I +   + + +PT T  I              + 
Sbjct: 122 GHYLQGYEVNVDGTPKAV-SINATKPIQIP--DKAGVPTKTSTIEASFNFPSDAKPLAAG 178

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD--------- 217
           N   +A+I  P         D  Y   +S   YD+LGS  V   Y+ K  D         
Sbjct: 179 NTATDASIFDPT-------NDKSYYASTSVTIYDSLGSPHVITQYFVKEADPLNVTQPAS 231

Query: 218 -KKWEVSIFRQDQSTNNS--FPYNVA------PLNTVEVSFD-------PVTGYLANSSH 261
              W + ++   +  + S   P  +A      P     V+FD       P T     ++ 
Sbjct: 232 PTAWRMYMYEDKKPIDVSGGVPTTMAASVTTTPPLAARVTFDADGKMITPTTP----ATI 287

Query: 262 KAISFNDNTSGI-------DQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
           K I+     +GI        QQ+ + ++  TQ +  F   K   +G   G+     ++ D
Sbjct: 288 KTIALGTPGAGIITNGADGTQQVELKLTNVTQFSSPFEVNKLTQDGSTVGRLTKVEITAD 347

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G V   Y + T + +  +A+A   +   L      ++  +  SGD   G P     G I 
Sbjct: 348 GIVSATYSNATTLKVAMVAMAKFANSQGLTQVGDTSWRQSLLSGDALPGTPNSGTFGSIK 407

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           S +LE +NVD+ S+L  LI AQRN+  NS+  +  S     ++ ++
Sbjct: 408 SSSLEQSNVDLTSQLVNLITAQRNFQANSRSLEVNSSLQQTILQIR 453


>gi|212709492|ref|ZP_03317620.1| hypothetical protein PROVALCAL_00534 [Providencia alcalifaciens DSM
           30120]
 gi|212687830|gb|EEB47358.1| hypothetical protein PROVALCAL_00534 [Providencia alcalifaciens DSM
           30120]
          Length = 422

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 111/429 (25%), Positives = 197/429 (45%), Gaps = 22/429 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S  + ++ +NIAN  T G+K    +F+ +     + S V  G+ ++  
Sbjct: 2   SFSQAVSGLNAASAGLDSIGNNIANSATNGFKGATTSFADMF----AGSGVGLGVNVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G +  T   TD+AI G GFF V+ ++     +R G F  +  G L N  G V+ 
Sbjct: 58  TQNFKDGPITRTDRATDVAISGNGFFRVQDQNGDVYYSRDGQFLRDKSGNLVNNQGMVVT 117

Query: 126 GYPLK-NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP   +    + V S      +N+    + A  +    ++ NL+    +      P + 
Sbjct: 118 GYPASVDDKGNVTVQSGGVPGGMNIPTDMMDAKQSDLAKLTINLNSEDKVKAKAFDPNNP 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN-----SFPYNV 239
              A Y   ++  AYD+ G++    VY+ K  D KWEV      ++         F  N 
Sbjct: 178 DDIATYNFSTTMTAYDSQGNTHEISVYFVKKDDNKWEVHAKDASETVAKKLGELEFDGN- 236

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI----DQQITIDISKTTQLAGGFIPQK 295
             L T +V   P  G    +     +F+    G+    D  + +D+ KT Q     + + 
Sbjct: 237 GKLMTEKVVKGPNPGDPDTTVQLPTTFDFPFKGLNGANDGTLKVDLGKTRQQK---VSES 293

Query: 296 S----EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
           S    ++NG+  G+   F +  +G +   Y +  +  + ++A++   + + L    GN +
Sbjct: 294 SVSAIDVNGYPAGEYTTFKIEDNGLIVANYSNQQKRVVGQIALSAFANPNGLVSQGGNVW 353

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             +  SG+   G PG  Q G++ SGALE++NVD++ EL  +I  QRNY  N++  +T   
Sbjct: 354 AASNASGNPMDGVPGVGQFGKLTSGALESSNVDMSQELISMIVMQRNYQSNAQTIKTQDQ 413

Query: 412 FMDILISLK 420
            +  L++L+
Sbjct: 414 MLQTLVNLR 422


>gi|254502675|ref|ZP_05114826.1| conserved domain protein [Labrenzia alexandrii DFL-11]
 gi|222438746|gb|EEE45425.1| conserved domain protein [Labrenzia alexandrii DFL-11]
          Length = 477

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 134/493 (27%), Positives = 219/493 (44%), Gaps = 88/493 (17%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--PSTSNSYVSG 58
           MGI G++ +A+SG+ AQ+  +  +S N+AN  TVG+KR    FS LV    ST    VSG
Sbjct: 1   MGIYGAINSAVSGLSAQATALENISGNVANSQTVGFKRLDTTFSDLVSGGGSTQADQVSG 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIV-KGRDNVNC---------LTRAGDF 108
               +++   +  G +     +T +AI G+G+F+V +  D V+           TRAGDF
Sbjct: 61  TTYATSRATNTIGGDISSNDVDTYMAINGEGYFVVTQAADFVDGSTTFADDTFYTRAGDF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNA---------------SAPLIVNSFQGLERINVKHAE 153
            +N EG+  N +G  L G+PL  A               S PL  +S      +N + A 
Sbjct: 121 EVNKEGYFVNQSGYYLKGFPLDPATGNPVGDNPSVIQINSQPLAASS---TTTVNYQ-AS 176

Query: 154 LSAMPTTTGFISNNLDKNATIITPDKTPKHN----------GRDAEYTHKS----SFAAY 199
           L  +P TT +  N  +        +  P  N            +A++   S    S  AY
Sbjct: 177 LPRVPATTNYDPNTANSELLNDGANGAPGPNLGATEIGDTGTLEADFLASSISGGSVTAY 236

Query: 200 DTLGSSVVYDVYYTK----TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPV--T 253
           ++ GS V  +V + K     G + W  S++        +  Y V      +V+FD     
Sbjct: 237 NSNGSEVPLNVRWAKVDNTAGAEVW--SMYVDTGGEAGTSYYKVG-----DVTFDGTGQV 289

Query: 254 GYLANSSHKA---ISFNDNTSGIDQQITID-----------ISKTTQLAGGFIPQKSE-- 297
             LAN+   A   ++ +  TS    +IT+             S T   A G + Q ++  
Sbjct: 290 SALANTGATAALGVTTSGTTSFTLDEITVGGVTAGTAGNAADSITISFANGSLTQFADPD 349

Query: 298 ---------INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                     NG+A G+  + ++ + G V   Y +     +Y + +AT  +E +L+  DG
Sbjct: 350 GIATSVNLSQNGYAAGELTNIAIDESGRVIASYSNNQTRALYEIPLATFQAEQSLRRVDG 409

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             +  T DSGD  +     +  G + S ALE +N DIA E ++LI  Q+ Y+ NS++  +
Sbjct: 410 AAFAATSDSGDADL-----SGGGAVISNALELSNADIADEFSKLIITQQAYSANSRIVTS 464

Query: 409 GSDFMDILISLKR 421
             + +D  +++ R
Sbjct: 465 ADEMLDSALNMVR 477


>gi|302185583|ref|ZP_07262256.1| flagellar hook protein FlgE [Pseudomonas syringae pv. syringae 642]
          Length = 445

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 123/452 (27%), Positives = 197/452 (43%), Gaps = 47/452 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEIS-- 63
           S    +SG+ A +  +    +NIANV T G+K + I F+     S   +  SGG  +   
Sbjct: 2   SFNIGLSGLYAANKSLDVTGNNIANVATTGFKSSRIEFADQYAQSIRGT--SGGTSVGSG 59

Query: 64  -TKDMISEQ---GSLMHTASNT-DLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLEN 118
            T   +S+Q   GSL     N+ DLAI G GFF++  + + +  TRAG FH + +G++ N
Sbjct: 60  VTTAAVSQQFSQGSLTTGTGNSLDLAINGNGFFMLSNKGD-SLYTRAGAFHTDKDGYVVN 118

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
            +G  L GY + +A+  ++V S   L    V  +   A PT+   I+N  + N+T   P 
Sbjct: 119 SSGMNLQGYNV-DANGTVMVGSSGDLR---VDSSNQLASPTS--MITNTANLNSTSAIPT 172

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN----- 233
            TP        Y    S   +D+ G+    + Y+ K G   W +      ++ +N     
Sbjct: 173 VTPFDATNSKTYNDTYSTTVFDSQGNEHRMESYFAKNGTNSWTMYSLIDGRNISNPASTV 232

Query: 234 -------------------SFPYNVAPLNTVEVSFD---PVTGYL----ANSSHKAISFN 267
                              + P + +P   V V+ D    VT ++      + + A    
Sbjct: 233 PDANNLTFDSSGSLIINTGTTPTSPSPSANVAVNADGTFKVTNWVPAIQTGTGNSATWGP 292

Query: 268 DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
           +  +G+   I +D++ +TQ A          NG+A G+ KD SV   G +   Y +G   
Sbjct: 293 NGAAGVASGIQLDMTASTQTASATGRSAQAQNGYAAGQIKDMSVDASGKLFASYTNGQSK 352

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
            I ++++ +  +   L    G  +  T  SG    G P     G +   ALE +NVD+  
Sbjct: 353 VIGQVSLTSFANVQGLAPAGGTNWRETFSSGIPGTGAPQSGTLGYVTGQALEESNVDLTL 412

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           EL  LI+AQ NY  N+K   T S  M   I +
Sbjct: 413 ELVNLIKAQSNYQANAKTISTQSTIMQTTIQM 444


>gi|268589982|ref|ZP_06124203.1| flagellar hook protein FlgE [Providencia rettgeri DSM 1131]
 gi|291314700|gb|EFE55153.1| flagellar hook protein FlgE [Providencia rettgeri DSM 1131]
          Length = 419

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 115/443 (25%), Positives = 209/443 (47%), Gaps = 53/443 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S  + ++ +NIAN  T G+K    +F+ +     + S V  G+ ++  
Sbjct: 2   SFSQAVSGLNAASAGLDSIGNNIANSATNGFKGATTSFADMF----AGSGVGLGVNVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G +  T   TD+AI G GFF V+ ++     +R G F  +  G L N  G V+ 
Sbjct: 58  TQNFKDGPITRTDRATDVAISGNGFFRVQDQNGDTYYSRDGQFLRDKSGNLVNNQGMVVT 117

Query: 126 GYP----------LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           GYP          +++   P  +N     + ++ K +EL+ +           DK   + 
Sbjct: 118 GYPASVDEKGNVTIQSGGVPAGLNI--PTDMMDAKASELAKLTINLNSEDKIKDKPFDVN 175

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
            PD +       A Y   ++  AYD+ G++    VY+ K+ D +W+V  + +D   N+  
Sbjct: 176 NPDDS-------ATYNFSTTMTAYDSQGNTHEISVYFVKSADNEWKV--YAKD--ANDKV 224

Query: 236 PYNVAPLNTVEVS----------FDPVTGYLANSSHKAISFNDNTSGI----DQQITIDI 281
              +  +NT +V           FD   G L  S+    +F+ N  G+    D  + +D+
Sbjct: 225 ATQL--INTEDVDDTVVVHNKLIFDG-NGRL--SAPTDATFDFNYKGLNGANDGVLRVDL 279

Query: 282 SKTTQLAGGFIPQKS----EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
           +KT Q     + + S    ++NG+  G+   F +  +G +   Y +  +  + ++A++  
Sbjct: 280 NKTRQQK---VSESSVSAIDVNGYPAGEYTTFKIEDNGLITANYSNQQKRVVGQVALSAF 336

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
            + + L    GN +  +  SG+   G PG  Q G++ SGALE++NVD++ EL  +I  QR
Sbjct: 337 ANPNGLVSQGGNVWASSNTSGNPMDGVPGVGQFGKLTSGALESSNVDMSQELISMIVMQR 396

Query: 398 NYAVNSKVFQTGSDFMDILISLK 420
           NY  N++  +T    +  L++L+
Sbjct: 397 NYQSNAQTIKTQDQMLQTLVNLR 419


>gi|220929459|ref|YP_002506368.1| hypothetical protein Ccel_2042 [Clostridium cellulolyticum H10]
 gi|219999787|gb|ACL76388.1| protein of unknown function DUF1078 domain protein [Clostridium
           cellulolyticum H10]
          Length = 454

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 124/474 (26%), Positives = 215/474 (45%), Gaps = 75/474 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + +SG+ A   ++  + +N+ANV+T+G+K   + F  +   +            
Sbjct: 1   MMRSMFSGVSGLKAHQAKMDVIGNNVANVNTLGFKAGRVTFQEIFNQTLRGAGAPDAATA 60

Query: 51  ---TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR-DNVNCLTRAG 106
              T+   +  G+ + + D     GS   T + TDL+I G GFFIVKG   +    TRAG
Sbjct: 61  RGGTNPMQIGLGIAVGSIDNQMTGGSPQRTDNPTDLSISGDGFFIVKGSIADTFKFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGY-----------PLKNASAPLIVNSFQGLERINVKHAELS 155
           +F ++  G L +  G  + G+                +    +N +  +   N K   ++
Sbjct: 121 NFGLDKLGNLVSGDGMNVYGWTKYDTLGDGTVKFDTEAEITPINLYSDVTNGNKKI--IA 178

Query: 156 AMPTTTGFISNNLDKNATIIT-PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK 214
           A  T+    S NL+    I+  PD +      D ++T    F  YD+LG++    V + K
Sbjct: 179 AKATSYAEFSGNLNSALPILADPDDS------DPQFT--VPFTIYDSLGNAHELMVNFKK 230

Query: 215 TGD------------------KKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDP----V 252
           T D                   +W  +I   D++ N+         +  +V+F+     V
Sbjct: 231 TDDLTDIPVKLPDGTDGTEPGTEWTYTI--SDKAGNSVL------TDAGKVNFNSKGKLV 282

Query: 253 TGYLANSSHKAISF----NDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKD 308
            G       + + F    N  T  I+  IT+D  K TQ AG    + S I+G+  G    
Sbjct: 283 LGDNDAPEQRIMEFDPGQNSGTGKIN--ITLDFKKLTQYAGDNSVKPSNIDGYTTGNLVT 340

Query: 309 FSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHN 368
           F++  DG +  +Y +G + P+  +A+A   +   L+   GN ++PT +SGD + G P  +
Sbjct: 341 FNIGSDGMLTGVYSNGQQQPLGLIALAGFDNPAGLQKVGGNLFIPTTNSGDFTKGVPAGS 400

Query: 369 QH-GEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           Q  G +  G LE +NVD++ E T++I  QR +  NS++  T  + +  L++LKR
Sbjct: 401 QGVGTLSPGTLEMSNVDLSREFTDMIVTQRGFQANSRIITTSDEMLQELVNLKR 454


>gi|88704306|ref|ZP_01102020.1| Flagellar hook protein FlgE [Congregibacter litoralis KT71]
 gi|88701357|gb|EAQ98462.1| Flagellar hook protein FlgE [Congregibacter litoralis KT71]
          Length = 429

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 116/439 (26%), Positives = 201/439 (45%), Gaps = 35/439 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           +  TA+SG++A +  +  VS+NIAN  T G+K +   F+ +   S     ++ +  G+ +
Sbjct: 2   AFSTAISGINAATADLGVVSNNIANASTTGFKASRAEFADVYATSLLGAGSNAIGKGVSL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++  T ++ DLAI G GFF +     V   TRAG+F ++ EGFL +    
Sbjct: 62  AGVTQEFGQGNITFTNNSLDLAINGNGFFQLSVEGAVE-YTRAGNFQVDREGFLVSNQNA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD-KNATIITPDKT- 180
            L G+ +         +    L  I +  + +   PT+   +++NLD +  T  T   T 
Sbjct: 121 RLQGFQVDGGG-----DVTGQLGDIQIDTSLIDPNPTSNVSLTSNLDSREVTTGTGFATN 175

Query: 181 --------PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQST 231
                   P      A++   +S   +D+LG+  V  +YY KT +  ++EV      QS 
Sbjct: 176 GPYDAFAVPPTAPSPADFNATTSTTIFDSLGNPHVLSLYYVKTANPNEFEVYSLIDGQSQ 235

Query: 232 NNSFPYNVAPLN---TVEVSFDP-------VTGYLANSSHKAISFNDNTSGIDQQITIDI 281
           +        P+    T    FDP       VT +    S  A++         Q   +D+
Sbjct: 236 DPGTGTVGDPVTLQFTSNGQFDPASDTQIDVTAWTPVDSTGAVN-----GAAAQTFVVDL 290

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
            +TTQ    F       +G A G+ +   + + G     Y +G    + ++A+A+  +++
Sbjct: 291 QQTTQFGTAFAVSSVIQDGFAAGQLRGLEIDESGIAFARYTNGESRALGQIALASFNNQN 350

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+      ++ T  SG  ++G PG +  G + S ALE +NV+I  EL +LI AQRN+  
Sbjct: 351 GLQPVGDTNWVETFSSGSPNVGEPGTSGLGAVQSAALEDSNVEITQELVDLIVAQRNFQA 410

Query: 402 NSKVFQTGSDFMDILISLK 420
           N++V Q        +I+L+
Sbjct: 411 NAQVIQAEDAITQTVINLR 429


>gi|258404710|ref|YP_003197452.1| fagellar hook-basal body protein [Desulfohalobium retbaense DSM
           5692]
 gi|257796937|gb|ACV67874.1| fagellar hook-basal body protein [Desulfohalobium retbaense DSM
           5692]
          Length = 433

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 124/456 (27%), Positives = 204/456 (44%), Gaps = 58/456 (12%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV----FPSTSNSYV 56
           MG+ G++ T +S + A    ++ + +N+AN +T  +K +   FS L+      S+  S V
Sbjct: 1   MGLQGALYTGVSALGATGEAMNVIGNNLANSNTTAFKASRTLFSDLLASDVSSSSGTSQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFHINNEGF 115
             G+ +++ D +  QG    T S+TDLAI+G+GFF V   +   +  TRAG F+ N+EGF
Sbjct: 61  GTGVGLASVDTVFSQGGFNPTESSTDLAIEGEGFFKVSDPNTGADAYTRAGGFNFNDEGF 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS----AMPTTTGFISNNLDKN 171
           L N  G  + GY +         N+   L+ I   + +LS    A  T    +S NL+ +
Sbjct: 121 LVNPQGYRVQGYDVDGDG-----NTVGNLKDI---YTDLSGSVPAQETGRASLSTNLNAS 172

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
           A +     +   N         +S   YD+LG+S + +VY+TK G   W   +      T
Sbjct: 173 AEV---GASFDINDPAGTSNFSTSINVYDSLGTSHLANVYFTKAGSNAWNYHVTADVGGT 229

Query: 232 NNSFPYNVAPLNTVEVSFDPVTGYL--------------------------ANSSHKAIS 265
           N         L + ++ F   TGYL                            ++   I+
Sbjct: 230 N-------TVLKSHQIKFTS-TGYLKEVDGNSYMNEKGEIPAGQEGNNVITVKNTGNPIN 281

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
           + + + G    +  ++S   Q AG       + +G + G      V ++G V   Y +G 
Sbjct: 282 WGNGSDGHVFDVEFNLS---QYAGQSELVSKQQDGFSSGALNGIEVDQEGMVIGSYSNGE 338

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
              + +L +A   + + L     + +  T  SG  +IG PG    G I S ALE + VDI
Sbjct: 339 SKDLAKLGLAKFANNNGLAQVGNSLFEATNASGLPAIGTPGAGV-GTIRSNALEQSTVDI 397

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           A + T++I  QR Y  NS+   T  D +  +++LKR
Sbjct: 398 AKQFTDMITTQRAYQANSRTITTTDDMLQEVVNLKR 433


>gi|300870390|ref|YP_003785261.1| flagellar hook protein FlgE [Brachyspira pilosicoli 95/1000]
 gi|300688089|gb|ADK30760.1| flagellar hook protein, FlgE [Brachyspira pilosicoli 95/1000]
          Length = 441

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 116/463 (25%), Positives = 206/463 (44%), Gaps = 66/463 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  V +NI+NV+T G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLFAGVSGLQNHQTRMDVVGNNISNVNTYGFKKGRVTFKDMISQSLSGAAKPQEDRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G++++T D I  QG+L  T  NTDLAIQG+GFFI K + N +  TR G F 
Sbjct: 61  GINPQQVGLGMQVATIDTIHTQGALQVTGVNTDLAIQGEGFFIEK-KGNSSYYTRNGAFS 119

Query: 110 INNEGFLENVAGGV-LLGY--PLKNASAPLIVNSFQGLER--INVKHAELSAMPTTTGFI 164
           I+  G+L N + G  + G+   L   +  + +N+  G+E   I V   + +     T F 
Sbjct: 120 IDKNGYLVNPSNGYKVQGWNAVLNPETGMMELNTAAGVEDLIIPVGSKDPARATQNTKFF 179

Query: 165 SNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI 224
            N L KN+                  TH++    YD+ G        + +T   +W++ +
Sbjct: 180 CN-LQKNSD-----------------THQADLTIYDSTGIPRQLRATFNRTDVNRWDM-V 220

Query: 225 FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT-------------- 270
               ++T  S   +V+  + VE   +     + N +   IS +D T              
Sbjct: 221 IEIPEATEGSV--SVSAGDPVENGGNNTFQLVFNDAGSLISVSDGTNTQTEGVLMPNVSF 278

Query: 271 --SGIDQQITIDISKT----------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
             +G D ++   I+ T          TQ       +  E +G+  G  + FS    G + 
Sbjct: 279 TYTGTDGEVNQTINLTMGEVGLFNGITQFESPSTTKAIEQDGYTMGMLEGFSFDDSGQIT 338

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
            ++ +G R  + ++A+A   +   L+      ++ + +SG  +IG       G I +G L
Sbjct: 339 GVFTNGNRKTLGQVALAKFANAGGLEKAGDTLFVESNNSGAANIGVAAAEGRGSIKAGTL 398

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E +NVD++ + T++I  QR +  N++   T    +  +I+LKR
Sbjct: 399 EMSNVDLSEQFTDMIVTQRGFQANARTITTADQLLQEVIALKR 441


>gi|218678737|ref|ZP_03526634.1| flagellar hook protein FlgE [Rhizobium etli CIAT 894]
          Length = 112

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (67%)

Query: 310 SVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQ 369
           S+  DG V + Y +G    +Y++ +ATV S DNL L  GN Y     SG    GFP  N 
Sbjct: 1   SIGTDGVVSVSYANGATKSLYQIPLATVASPDNLTLMSGNVYSANGQSGVTVTGFPQTNG 60

Query: 370 HGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            G I SGALE++NVD+A ELTE+IEAQR+Y  NSKVFQTGSD MD+L++LKR
Sbjct: 61  LGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKVFQTGSDIMDVLVNLKR 112


>gi|297544701|ref|YP_003677003.1| fagellar hook-basal body protein [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842476|gb|ADH60992.1| fagellar hook-basal body protein [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 413

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 119/439 (27%), Positives = 206/439 (46%), Gaps = 46/439 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ +   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKSHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +   G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTSGGAQRTDNPTDLSIDGNGFFIVS-NGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQG-LERINVKH-AELSAMPTTTGFISNN 167
            +++G L    G  +LG+   +      VN+  G L  I++K+ + ++   TT   I  N
Sbjct: 120 FDSQGDLVTPDGYKVLGWMSTDGET---VNTDTGNLVPISIKNWSSIAPAATTQLEIGGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+ +  I   D +  +N              YD+ G S +  + +T+T    W  S+   
Sbjct: 177 LNASTEI---DGSISYN-----------ILVYDSQGGSHIATLTFTRTDASTWNWSVSSS 222

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAIS--FNDNTSGIDQQI---TIDIS 282
           D + ++     V    T+    D   G +A ++    +  FN NT+  +  I    +D+S
Sbjct: 223 DPAISS-----VDGSGTLTFGAD---GKIATNTTATGTLTFNMNTNETNATIGPVQLDLS 274

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
           + T  +     ++   NG+  G  +  ++ K G V  IY +G    I ++AIA   +   
Sbjct: 275 QLTMFSSETDLRELSKNGNEAGSLESINIDKYGVVSGIYSNGREQIIGQIAIADFQNPMG 334

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L+      ++ T +SG+  IG  G    G I  G LE +NVD+A+E  ++I  QR +  N
Sbjct: 335 LEKVGNTMFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLANEFADMIVTQRGFQAN 394

Query: 403 SKVFQTGSDFMDILISLKR 421
           +K+     + +  L+++KR
Sbjct: 395 AKIITASDEMLQDLVNMKR 413


>gi|30261751|ref|NP_844128.1| flagellar hook protein FlgE [Bacillus anthracis str. Ames]
 gi|47526975|ref|YP_018324.1| flagellar hook protein FlgE [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184583|ref|YP_027835.1| flagellar hook protein FlgE [Bacillus anthracis str. Sterne]
 gi|65319023|ref|ZP_00391982.1| COG1749: Flagellar hook protein FlgE [Bacillus anthracis str.
           A2012]
 gi|165869249|ref|ZP_02213908.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0488]
 gi|167633465|ref|ZP_02391790.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0442]
 gi|167639152|ref|ZP_02397425.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0193]
 gi|170686150|ref|ZP_02877372.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0465]
 gi|170706520|ref|ZP_02896980.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0389]
 gi|177650602|ref|ZP_02933569.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0174]
 gi|190566422|ref|ZP_03019340.1| putative flagellar hook protein FlgE [Bacillus anthracis
           Tsiankovskii-I]
 gi|227815486|ref|YP_002815495.1| putative flagellar hook protein FlgE [Bacillus anthracis str. CDC
           684]
 gi|229600977|ref|YP_002866149.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0248]
 gi|254683244|ref|ZP_05147105.1| flagellar hook protein FlgE [Bacillus anthracis str. CNEVA-9066]
 gi|254723830|ref|ZP_05185616.1| flagellar hook protein FlgE [Bacillus anthracis str. A1055]
 gi|254734597|ref|ZP_05192309.1| flagellar hook protein FlgE [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741006|ref|ZP_05198694.1| flagellar hook protein FlgE [Bacillus anthracis str. Kruger B]
 gi|254755249|ref|ZP_05207283.1| flagellar hook protein FlgE [Bacillus anthracis str. Vollum]
 gi|254759785|ref|ZP_05211809.1| flagellar hook protein FlgE [Bacillus anthracis str. Australia 94]
 gi|30255979|gb|AAP25614.1| putative flagellar hook protein FlgE [Bacillus anthracis str. Ames]
 gi|47502123|gb|AAT30799.1| putative flagellar hook protein FlgE [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178510|gb|AAT53886.1| flagellar hook protein FlgE, putative [Bacillus anthracis str.
           Sterne]
 gi|164714689|gb|EDR20207.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0488]
 gi|167512942|gb|EDR88315.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0193]
 gi|167531503|gb|EDR94181.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0442]
 gi|170128618|gb|EDS97485.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0389]
 gi|170669847|gb|EDT20588.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0465]
 gi|172083746|gb|EDT68806.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0174]
 gi|190562557|gb|EDV16524.1| putative flagellar hook protein FlgE [Bacillus anthracis
           Tsiankovskii-I]
 gi|227006608|gb|ACP16351.1| putative flagellar hook protein FlgE [Bacillus anthracis str. CDC
           684]
 gi|229265385|gb|ACQ47022.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0248]
          Length = 437

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 115/450 (25%), Positives = 195/450 (43%), Gaps = 44/450 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---- 58
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++ +T  S   G    
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 59  --------GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAGDFH 109
                   G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +  +S      I +  A +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEIDFSSRPSPIHIPMGSA-VGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAE---YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           +N   ++ + T      DAE    T + +     T  +    +V     G+  + VS+ R
Sbjct: 180 RNQNALSHEFTV----FDAEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSV-R 234

Query: 227 QDQSTNNSFPYNVAPLNTVEVSF---------------DPVTGYLANSSHKAISFNDNTS 271
            D      F           + F               DPVTG +       I F     
Sbjct: 235 NDSKNEKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEIIKGGSVQIPFGSG-- 292

Query: 272 GIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                +T+D+S  T    G     +E+ G       D+S+S  G+V + Y DG+   + +
Sbjct: 293 -----LTLDLSGLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQ 347

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           LA+AT P+   L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +
Sbjct: 348 LAVATFPNSGGLMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVD 407

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           L+  QR +  N+KV +   + ++ +++L R
Sbjct: 408 LMLYQRGFQGNAKVIKVSDEVLNEVVNLIR 437


>gi|26247216|ref|NP_753256.1| flagellar hook protein FlgE [Escherichia coli CFT073]
 gi|227886566|ref|ZP_04004371.1| flagellar hook protein FlgE [Escherichia coli 83972]
 gi|300974380|ref|ZP_07172592.1| flagellar hook protein FlgE [Escherichia coli MS 45-1]
 gi|26107617|gb|AAN79816.1|AE016759_90 Flagellar hook protein flgE [Escherichia coli CFT073]
 gi|227836770|gb|EEJ47236.1| flagellar hook protein FlgE [Escherichia coli 83972]
 gi|300410623|gb|EFJ94161.1| flagellar hook protein FlgE [Escherichia coli MS 45-1]
 gi|307553078|gb|ADN45853.1| flagellar hook protein FlgE [Escherichia coli ABU 83972]
 gi|315291070|gb|EFU50433.1| flagellar hoo