BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE
[Candidatus Liberibacter asiaticus str. psy62]
         (421 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040202|gb|ACT56998.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 421

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 421/421 (100%), Positives = 421/421 (100%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL
Sbjct: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA
Sbjct: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT
Sbjct: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA
Sbjct: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
           PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING
Sbjct: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI
Sbjct: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK
Sbjct: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420

Query: 421 R 421
           R
Sbjct: 421 R 421


>gi|315122284|ref|YP_004062773.1| flagellar hook protein FlgE [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495686|gb|ADR52285.1| flagellar hook protein FlgE [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 422

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 313/422 (74%), Positives = 362/422 (85%), Gaps = 1/422 (0%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGILG+MKTAMSGMDAQSNRVSAVSDNIANV+T+GYKRTA++FSSLVFP  +  + SGG+
Sbjct: 1   MGILGTMKTAMSGMDAQSNRVSAVSDNIANVNTIGYKRTAVSFSSLVFPPAAGCHTSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +S KDMIS QGSL+HTASNTDLAIQG+GFF+VK +   + LTR+G+F INNEGFL+N A
Sbjct: 61  AVSEKDMISSQGSLIHTASNTDLAIQGEGFFVVKDKTGTHYLTRSGNFQINNEGFLQNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G VL GYP++NA +PL++NSFQGLE INV++ E  A+PTT G I  NLDK+A ++   KT
Sbjct: 121 GYVLQGYPMRNAFSPLVLNSFQGLETINVRNFEPRAVPTTLGSIPANLDKDAKVVVRSKT 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           PK NG DAEYTHKSSF+AYDTLGS V+YD+YYTK  DKKWEVSIFRQDQS+   FPYNV 
Sbjct: 181 PKSNGGDAEYTHKSSFSAYDTLGSRVIYDLYYTKVEDKKWEVSIFRQDQSSKTIFPYNVT 240

Query: 241 PLNTV-EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
               V +VSFDPVTG+LA SS K ISF+DNTSGI   I IDISKTTQL GGFIPQ + IN
Sbjct: 241 NPLAVIDVSFDPVTGHLAESSPKEISFDDNTSGISHPIKIDISKTTQLVGGFIPQNAVIN 300

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G APGKP+DFSVSKDG +D+IYDDGTRVP+YRLAIATVPSE++LK+ DGNTYLPTRDSGD
Sbjct: 301 GQAPGKPRDFSVSKDGNIDVIYDDGTRVPVYRLAIATVPSENSLKICDGNTYLPTRDSGD 360

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           ISIG+PG++Q G++ SGALETANVDIA+ELTELIEAQRNYA NSKVFQTGSDFMDILISL
Sbjct: 361 ISIGYPGNDQRGDVLSGALETANVDIANELTELIEAQRNYAANSKVFQTGSDFMDILISL 420

Query: 420 KR 421
           KR
Sbjct: 421 KR 422


>gi|42524754|ref|NP_970134.1| hypothetical protein Bd3395 [Bdellovibrio bacteriovorus HD100]
 gi|39576964|emb|CAE78193.1| flgE [Bdellovibrio bacteriovorus HD100]
          Length = 427

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 106/436 (24%), Positives = 185/436 (42%), Gaps = 24/436 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS----TSNSYV 56
           MGIL S+ T +SGM AQ   +  + DNIAN +T+G+K +   F  ++  +       + +
Sbjct: 1   MGILSSLYTGVSGMTAQGEALGVIGDNIANANTIGFKASRAEFQDIISKNLKGIVGGNQI 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
             G++I   + I  QG++  T   TDLAI G G+F VKG D     TR G FH + EG+L
Sbjct: 61  GRGVKIGAVNPILSQGNIDATEKVTDLAISGDGYFKVKGSDG-ESYTRDGSFHFDREGYL 119

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
                  + G+        +   +      I    A + A  T    +  NLD     + 
Sbjct: 120 VTNDNQRVQGFSTDEKGNIVNKMT-----DIKFPRALIPAKATKELKLDLNLDSR---ME 171

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
           P K        +   + +    YD+ G+  +   ++ K  D++WE       +       
Sbjct: 172 PTKKFDPADPYSTSHYSTGVEMYDSQGNKHLVSFFFNKVNDREWEFKGLVDGKEITGGEE 231

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS-----------KTT 285
             ++ +   ++ F       +  +          +  DQQ+ ++              T 
Sbjct: 232 GKMSEVAAGKLMFTVDGKLDSQETTSTNFNFKGGALQDQQVKLNFGDAIKDGGKGLDGTK 291

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q            +G A G     S + +G +  +Y +G    + ++A+A   + + L  
Sbjct: 292 QYGKNSDLISWHQDGAAAGTITGLSFNDEGTLTAVYSNGQANDLAQIALAKFENPEALFK 351

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N    +RDSG  S+G PG    G++F+ +LE + VD+A+E   +I+ QR +  N+K 
Sbjct: 352 VGNNRLKESRDSGTASVGAPGAAGRGKLFAKSLERSTVDLATEFVNMIQNQRGFQANAKT 411

Query: 406 FQTGSDFMDILISLKR 421
             T  + ++ +I LKR
Sbjct: 412 ITTTDELLNEVIQLKR 427


>gi|307718606|ref|YP_003874138.1| flagellar hook protein [Spirochaeta thermophila DSM 6192]
 gi|306532331|gb|ADN01865.1| flagellar hook protein [Spirochaeta thermophila DSM 6192]
          Length = 462

 Score =  278 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 99/465 (21%), Positives = 186/465 (40%), Gaps = 49/465 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  + +NI+NV+T G+K+  + F  ++  + S +        
Sbjct: 1   MMRSLYAGVSGLQNHQIRMDVIGNNISNVNTTGFKKGRVNFHDMISQTLSGAARPTEEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ I++ D I  QGSL  T   TD+AIQG+GFFI++  D  +  TRAG F 
Sbjct: 61  GVNPKQVGLGMTIASIDTIHTQGSLQTTGVMTDVAIQGEGFFILRKGD-RSFYTRAGVFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           ++ EG+L N   G  + G+  +  +    +N+   L+ + +          TT       
Sbjct: 120 LDEEGYLVNPANGLRVQGWRAETVNGQTFINTTGSLQDLIIPVGSKDPASATTEVFLACN 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVSIFR 226
                   P           E T  +++  YD+ G+     + +TK      +W  ++  
Sbjct: 180 LDKRLPEIPPGA--GPETVREGTWVATYDIYDSFGNPHTLRIEFTKVVGEPNRWRATVTV 237

Query: 227 QDQSTNNSFP---------------------YNVAPLNTVEVSFDPVTGYLANSSHKAIS 265
              +   +                         +  +                       
Sbjct: 238 DPDAETPTNTLVDVGETNNATNTFIIQFDNLGTIQSVEDEAGDVLDAGALQVQVGFDVPE 297

Query: 266 FNDNTSGIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
                     + T +++           TQ A     +    NG+  G  + F + ++G 
Sbjct: 298 ATIPPGEAAVRQTFNLNLGQVGSVVDAVTQFAERSSTKVFRQNGYTMGYLEGFKIDQNGV 357

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           +  +Y +G   P+ ++A+AT  +   L+      +  + +SGD ++G P     G++ +G
Sbjct: 358 ITGVYSNGNNRPLGQIALATFVNPGGLEKEGETMFRVSLNSGDPNVGPPNFAGKGKLIAG 417

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ALE +NVD+A   T++I  QR +  NS+   T    +  L++LKR
Sbjct: 418 ALEMSNVDLAEAFTDMIVTQRGFQANSRTITTSDQMLQELLTLKR 462


>gi|315186381|gb|EFU20141.1| fagellar hook-basal body protein [Spirochaeta thermophila DSM 6578]
          Length = 462

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 98/465 (21%), Positives = 186/465 (40%), Gaps = 49/465 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  + +NI+NV+T G+K+  + F  ++  + S +        
Sbjct: 1   MMRSLYAGVSGLQNHQIRMDVIGNNISNVNTTGFKKGRVNFHDMISQTLSGAARPTEEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ I++ D I  QGSL  T   TD+A+QG+GFFI++  D  +  TRAG F 
Sbjct: 61  GVNPKQVGLGMTIASIDTIHTQGSLQTTGVMTDVAVQGEGFFILRKGD-RSFYTRAGVFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           ++ EG+L N   G  + G+  +  +    +N+   L+ + +          TT       
Sbjct: 120 LDEEGYLVNPANGLRVQGWRAETVNGQTFINTTGSLQDLIIPVGSKDPASATTEVFLACN 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVSIFR 226
                   P           E T  +++  YD+ G+     + +TK      +W  ++  
Sbjct: 180 LDKRLPEIPPGA--GPETVREGTWVATYDIYDSFGNPHTLRIEFTKVVGEPNRWRATVTV 237

Query: 227 QDQSTNNSFP---------------------YNVAPLNTVEVSFDPVTGYLANSSHKAIS 265
              +   +                         +  +                       
Sbjct: 238 DPDAETPTNTLVDVGETNNATNTFIIQFDNLGTIQSVEDEAGDVLDAGALQVQVGFDVPE 297

Query: 266 FNDNTSGIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
                     + T +++           TQ A     +    NG+  G  + F + ++G 
Sbjct: 298 ATIPPGEAAVRQTFNLNLGQVGSVVDAVTQFAERSSTKVFRQNGYTMGYLEGFKIDQNGV 357

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           +  +Y +G   P+ ++A+AT  +   L+      +  + +SGD ++G P     G++ +G
Sbjct: 358 ITGVYSNGNNRPLGQIALATFVNPGGLEKEGETMFRVSLNSGDPNVGPPNFAGKGKLIAG 417

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ALE +NVD+A   T++I  QR +  NS+   T    +  L++LKR
Sbjct: 418 ALEMSNVDLAEAFTDMIVTQRGFQANSRTITTSDQMLQELLTLKR 462


>gi|39995527|ref|NP_951478.1| flagellar hook protein FlgE [Geobacter sulfurreducens PCA]
 gi|39982290|gb|AAR33751.1| flagellar hook protein FlgE [Geobacter sulfurreducens PCA]
 gi|298504527|gb|ADI83250.1| flagellar hook protein FlgE [Geobacter sulfurreducens KN400]
          Length = 419

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 107/425 (25%), Positives = 188/425 (44%), Gaps = 10/425 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-TSNSYVSGG 59
           M +  ++ T +SG++A    +S + +NI+NV+T+G+K+  + FS ++  + +  S +  G
Sbjct: 1   MSVTSALYTGISGLNANGEAMSVIGNNISNVNTIGFKQGRMLFSDVLSSTISGGSQIGRG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
           ++I T +    QGS   T S TDLAIQG  FF+V+        TRAG F  N +  L N 
Sbjct: 61  VQIQTVENQFTQGSFESTESGTDLAIQGDSFFVVQNTSG-RYYTRAGAFSFNKDKTLVNP 119

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  ++GY +             G+ +        +  P  T  +   ++ ++T  TP  
Sbjct: 120 EGYQVMGYGI-----IPSSGLSDGVLKPIDLTNFATTPPKQTSTVKFVVNLDSTQTTPTL 174

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
                   A   + +S + YD+ G++    VY+ KT D  W+  +   D +         
Sbjct: 175 AWDPANPVATSNYSTSLSVYDSQGNAHTATVYFRKTADNAWDWHVILPDAAAGTPGSTTT 234

Query: 240 APLNTVEVSFD---PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
               T+             LA ++         T+       + +  TTQ A   +    
Sbjct: 235 PIDGTLTFDATGALTAQTPLAGAAQNITFAGGVTAPQPIFFDLGVGATTQYASSSVVSSQ 294

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+  G     ++   GYV+ +Y +G    +Y++A+A   S   L    G  +  T +
Sbjct: 295 TQDGYYQGTLTKVTIDDKGYVNGVYSNGQLQKLYQVALAKFSSTAGLSKAGGTLFEETLE 354

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG            G+I + +LE +NVD+A++  ++I  QR Y+ NSK   T  + +  +
Sbjct: 355 SGQPLFSDASTPGVGKILANSLEQSNVDMAAQFVKMITTQRGYSANSKTITTADEMLQEV 414

Query: 417 ISLKR 421
           +SLKR
Sbjct: 415 LSLKR 419


>gi|121533754|ref|ZP_01665581.1| protein of unknown function DUF1078 domain protein [Thermosinus
           carboxydivorans Nor1]
 gi|121307745|gb|EAX48660.1| protein of unknown function DUF1078 domain protein [Thermosinus
           carboxydivorans Nor1]
          Length = 420

 Score =  276 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 102/434 (23%), Positives = 179/434 (41%), Gaps = 29/434 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  + +NIANV+T+G+K + + F  ++  +   +        
Sbjct: 1   MMRSLFAGVSGLRNHQTRMDVIGNNIANVNTIGFKASRVNFQDILSQTMQGASSGIGNQG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN-VNCLTRAGDF 108
                 +  G+ I++ D I   GS   T   TDL+IQGKGFF++          TRAG+F
Sbjct: 61  GTNPIQIGLGVSIASIDTIFTDGSFQPTGKQTDLSIQGKGFFVLSPDGGKTEVFTRAGNF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
             +  G       G  +     +++  +  +  +          ++ A  T     +NNL
Sbjct: 121 DFDRLGNFIVPGTGYKVVGWKADSNGNIDTDPSKRTTIDIPVGTQMPAQATKAITFANNL 180

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
             +A   T              T K S+  YD LG      V +TKTGD  W+ +I    
Sbjct: 181 SADAANGT--------------TVKVSYDIYDNLGKRYTLPVVFTKTGDTTWDYTISNTS 226

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID-QQITIDISKTTQL 287
           + T  + P           +           +   I  +  T       I +   + TQ 
Sbjct: 227 EYTVATLPATSVTGRLTFDAATGKLSSTTPPTVTTIDISYTTPAQKVSGIQLKFDQVTQY 286

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
            G    Q  + +G+ PG  +  ++  +G +   + +G    + ++A+AT  +   L    
Sbjct: 287 GGDTTLQIVDQDGYPPGSLEGVTIDPNGVIVGRFSNGKTRNLAQVALATFNNPAGLTKIG 346

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
            + Y  + +SG   IG  G    G++  G LE +NVD+A E + +I  QR +  NSK+  
Sbjct: 347 DSLYAVSSNSGTPEIGVTGSGGRGKLNPGTLEMSNVDLAQEFSNMIITQRGFQANSKIIS 406

Query: 408 TGSDFMDILISLKR 421
              + +  L +LKR
Sbjct: 407 VTDEMLQELANLKR 420


>gi|289208114|ref|YP_003460180.1| fagellar hook-basal body protein [Thioalkalivibrio sp. K90mix]
 gi|288943745|gb|ADC71444.1| fagellar hook-basal body protein [Thioalkalivibrio sp. K90mix]
          Length = 408

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/417 (25%), Positives = 177/417 (42%), Gaps = 14/417 (3%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEIS 63
               +SG+++    +    +N++N  T G+KR+   F  +   S      +   GG  + 
Sbjct: 3   FNIGLSGLNSAQADLQTTGNNVSNAGTTGFKRSRAEFGDVFAQSFGGVSQTATGGGSRLM 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG    T +  DLAI G+GFF++         TRAG+F +N +G L N  G  
Sbjct: 63  AVTQQFSQGRTEFTENGLDLAIDGEGFFVMND-GGNRVYTRAGEFQVNRDGNLVNNQGQQ 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GYP  N  +     +   L  + ++    +   T+      NL  +A I+ P +    
Sbjct: 122 LQGYPPINPGSTDTDFNTGQLGDLRLQTGASAPQATSDIEALVNLQSDAPILDPGEFEFD 181

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
           +     Y + +S   YD+LG+S    +Y+ K+ +++W   +    +  N           
Sbjct: 182 DPD--SYNYSTSLTVYDSLGTSRDARIYFVKSDEREWTAFMSVDGEPIN--------EEE 231

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
             E+SFD       N+     + +          TID + TTQ  G F       +G A 
Sbjct: 232 GFELSFDASGQLDGNTEFPFSTDDFTNGAEGLDGTIDFAGTTQFGGDFAVNDLGQDGFAS 291

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+     +   G V   + +G    + ++A+A   +   L+    N +  T  +GD    
Sbjct: 292 GRLTGVDIDSSGVVFARFTNGQSSVLGQVALANFTNPQGLEQLGNNNWAETFAAGDPVFA 351

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            PG    GEI +GALE +NVDIA EL  LI AQRN+  N++   T       +I+++
Sbjct: 352 SPGTGNLGEIQAGALEASNVDIAQELVNLITAQRNFQANAQTISTADQVTQTIINIR 408


>gi|78224295|ref|YP_386042.1| hypothetical protein Gmet_3103 [Geobacter metallireducens GS-15]
 gi|78195550|gb|ABB33317.1| conserved hypothetical protein [Geobacter metallireducens GS-15]
          Length = 419

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 104/425 (24%), Positives = 182/425 (42%), Gaps = 10/425 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-TSNSYVSGG 59
           M +  ++ T +SG++A    +S + +NI+NV+T+G+K+  + FS ++  + +  S +  G
Sbjct: 1   MSVTSALYTGISGLNANGEAMSVIGNNISNVNTIGFKQGRMLFSDVLSSTISGGSQIGRG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
           ++I T +    QGS   T S TDLA+QG  FF+V+  +     TRAG F  + +  L N 
Sbjct: 61  VQIQTVENQFTQGSFESTESGTDLAVQGDSFFVVQNDNG-RYYTRAGAFTFDKDKTLVNP 119

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  + GY +             G+ +        +  P  T  +   L+ ++T  TP  
Sbjct: 120 EGYQVQGYGI-----IPSSGLADGVMKPIDLTTFATTPPKQTSAVDMVLNLDSTQSTPAL 174

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
                   A     +S + YD+ G++    VY+ KT    W+      D           
Sbjct: 175 PWNPANPVATSNFSTSLSVYDSQGNAHTATVYFRKTAANAWDWHAILPDAQAGTPGSSTT 234

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI---DISKTTQLAGGFIPQKS 296
               T+              +  A +          Q  +    +  TTQ A   I    
Sbjct: 235 PLDGTLTFDATGALTGQTPLASAAQNITFTGGVTAPQPILFGMGVGATTQYASPSIVSSQ 294

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G+  G     ++   GYV+ +Y +G    +Y++A+A   S   L    G  +  T D
Sbjct: 295 TQDGYYQGTLTKVTIDDKGYVNGVYSNGELKKLYQVALAKFASTTGLSKAGGTLFEETLD 354

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG            G++ + +LE +NVD+A++  ++I  QR Y+ NSK   T  + +  +
Sbjct: 355 SGQPLFSNASTPGVGKVLANSLEQSNVDMAAQFVKMITTQRGYSANSKTITTADEMLQEV 414

Query: 417 ISLKR 421
           ++LKR
Sbjct: 415 LNLKR 419


>gi|238919259|ref|YP_002932774.1| flagellar hook protein FlgE [Edwardsiella ictaluri 93-146]
 gi|238868828|gb|ACR68539.1| flagellar hook protein FlgE [Edwardsiella ictaluri 93-146]
          Length = 424

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 98/429 (22%), Positives = 186/429 (43%), Gaps = 20/429 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SGM+A S ++  + +NIAN  TVG+K  ++ F+ +       S +  G+++++ 
Sbjct: 2   GFSQAISGMNAASTQLDVIGNNIANSQTVGFKSGSVTFADMFA----GSKIGLGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
           D   + G+   T    D+AI G+GFF ++  +     +R G F  + +GFL N  G  L 
Sbjct: 58  DQDFKDGATTTTNRALDVAISGQGFFRMQAPNGSVNYSRNGQFTKDAKGFLTNAQGLYLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A  P  +        + +    + A  +T G +  NL+     I   K      
Sbjct: 118 GYPA--AGTPPTIQQGADPVPLQIPTGLMPAKASTEGTMVLNLNSADKAIDSTKLKFDPT 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ-------------DQSTN 232
               Y + +S   YD+LG+    ++Y+ K   ++ +++                     +
Sbjct: 176 NVNSYNYATSMTTYDSLGNVHNMNLYFVKGKPEEKDITTGTPPKIEKVMATPWHIYSIDS 235

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT-TQLAGGF 291
              P      +   + FD     L  ++   +    +   + Q  T++ + T  Q  G  
Sbjct: 236 AESPAPKTFTSIGALEFDSNGELLKGTAPLTLKMVASNGALAQDFTLNFTGTRQQNTGKD 295

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  NG+  G+   + ++ DG +   Y +  +  + ++ +A     + L     N +
Sbjct: 296 GVSAKTQNGYKAGELTGYQINDDGSITGSYTNQQKQLLGQIVMANFADPEGLTSEGNNEW 355

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             +  SG   IG  G +  G + SGA+E +NVD++ +L ++I AQRNY  N++  +T   
Sbjct: 356 SESAKSGQPIIGTSGTSGLGTLTSGAVEASNVDLSKQLVDMIVAQRNYQSNAQTIKTQDQ 415

Query: 412 FMDILISLK 420
            +  L++L+
Sbjct: 416 ILQTLVNLR 424


>gi|313901443|ref|ZP_07834901.1| fagellar hook-basal body protein [Thermaerobacter subterraneus DSM
           13965]
 gi|313468293|gb|EFR63749.1| fagellar hook-basal body protein [Thermaerobacter subterraneus DSM
           13965]
          Length = 406

 Score =  272 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 107/433 (24%), Positives = 179/433 (41%), Gaps = 41/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ S+   +SG+     R+  + +NIANV+TVGYK + + F  L   +            
Sbjct: 1   MMRSLYAGISGLQNHQLRMDVIGNNIANVNTVGYKSSRVTFKELFNQTLRGASAPAGPAR 60

Query: 51  --TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
             T+   +  G  +   D+I + G+   T   TD+AIQG GFF+++        TRAGDF
Sbjct: 61  GGTNPIQIGLGTALGGIDVIHQAGNPQVTGVVTDMAIQGDGFFVLQDATGGYAYTRAGDF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            ++ EG+L N  G  +LG+  +    P       G          + A  +T    S+NL
Sbjct: 121 RLDAEGYLVNADGLRVLGWQAQGGVLPARDALNLGA-VRVPVDLAVPAQASTRVTWSSNL 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
           D  A                  T   +   YD+LG+       +T+TG  +W  +     
Sbjct: 180 DATAPT--------------SSTLTQAIDVYDSLGNPHTLIFTFTRTGSNQWSWNAAAAA 225

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
               +     +   +   ++          +                 +T+D +  TQ A
Sbjct: 226 DPATSLGSGTLTFSSAGLLT----------AGSPGTVNYSPPGADRMTLTVDFAGLTQYA 275

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
           G    +    +G+  G+   FSV   G +   + +G   PI ++A+A   +   L     
Sbjct: 276 GPSTAEA-TADGYPAGQLTSFSVDASGTITGTFSNGMTQPIAQVALAAFANPAGLLRDG- 333

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N Y  + +SG   IG  G    G +  GALE +NVD++ E  ++I  QR +  NS+V  T
Sbjct: 334 NLYWESNNSGVARIGEAGTGGRGSVTPGALEMSNVDLSREFVDMIVTQRGFQANSRVITT 393

Query: 409 GSDFMDILISLKR 421
             + +  L++LKR
Sbjct: 394 SDEMLQELVNLKR 406


>gi|150390478|ref|YP_001320527.1| hypothetical protein Amet_2716 [Alkaliphilus metalliredigens QYMF]
 gi|149950340|gb|ABR48868.1| protein of unknown function DUF1078 domain protein [Alkaliphilus
           metalliredigens QYMF]
          Length = 441

 Score =  272 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 106/451 (23%), Positives = 186/451 (41%), Gaps = 42/451 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM +A+SG+ A   R+ A+ +NIANV+TVGYK T + F  +   +            
Sbjct: 1   MMRSMFSAVSGLQAHQLRMDAIGNNIANVNTVGYKGTRVTFQEVFSQTIRGAGAPQGGRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--RDNVNCLTRAGD 107
            T+   V  G+ +++      +GS   T  NTDL I G GFFIV     D  +  TRAG+
Sbjct: 61  GTNPQQVGLGVNVASMSTFHVRGSAESTGYNTDLMINGDGFFIVSSDANDQNHTYTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASA--------------PLIVNSFQGLERINVKHAE 153
           F ++  G L    G  ++G      S                       G+   + + A 
Sbjct: 121 FELDEAGNLITPGGQRVMGNMYDVESGRMGTGLQGLQISKSMTSPPMSTGVPLTDPQDAT 180

Query: 154 LSAMPTTTGFISNNLDKNATIITPDK---TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDV 210
           +       G +++++  NAT+   D+           +     ++F  YD LG +    +
Sbjct: 181 IPKSVFFGGNLNSDVQPNATLPVLDEFLEDLVDAEGKSSVARDTTFTVYDELGGTHDIRL 240

Query: 211 YYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT 270
            + KT + K+ V +              V                   +           
Sbjct: 241 AFVKTEENKYGVYV----------VENGVITDRIDHELEFEQGKLSDGTDLVLELTGLGN 290

Query: 271 SGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
              D   T+D    TQ++           G+  G  +DF++   G +  ++++G + PI 
Sbjct: 291 GASDFTFTVDFGAVTQVSNESDVSADVRVGYKQGNLEDFTIDSSGVITGVFNNGYKRPIG 350

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           ++AIA   +   L+    N Y  + +SG+  +G PG    G +  G LE +NVD++ E T
Sbjct: 351 QVAIANFRNPAGLEKIGENMYRNSPNSGEPLVGTPGSGGRGTLNPGTLEMSNVDLSREFT 410

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            +I  QR +  NS++  T  + +  ++++KR
Sbjct: 411 NMITTQRGFQANSRIITTSDEMLQEVVNMKR 441


>gi|317121822|ref|YP_004101825.1| flagellar hook-basal body protein [Thermaerobacter marianensis DSM
           12885]
 gi|315591802|gb|ADU51098.1| flagellar hook-basal body protein [Thermaerobacter marianensis DSM
           12885]
          Length = 406

 Score =  272 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 105/433 (24%), Positives = 182/433 (42%), Gaps = 41/433 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ S+   +SG+     R+  + +NIANV+TVG+K + + F  L   +            
Sbjct: 1   MMRSLYAGISGLQNHQLRMDVIGNNIANVNTVGFKSSRVTFKELFNQTLRGAAAPAGPTR 60

Query: 51  --TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
             T+   +  G  ++  D+I + G+   T   TDLAIQG GFF+++        TRAGDF
Sbjct: 61  GGTNPIQIGLGTALAGIDVIHQPGNPQVTGVATDLAIQGDGFFVLQDAAGGYAYTRAGDF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            ++  G+L N  G  +LG+  +    P       G          + A  ++    S+NL
Sbjct: 121 RLDAAGYLVNADGLRVLGWQAQGGVLPARDAVNLGP-IRVPVDMFVPAQASSRVTWSSNL 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
           D      TP                 +   YD+LG++      +T+TG  +W        
Sbjct: 180 DATTPTNTPL--------------TRAVDVYDSLGNAHTLIFTFTRTGSNQWSWQAEDAA 225

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
               +     +   N+  ++          + +        T      + +D S  TQ A
Sbjct: 226 NPGTSLGQGTLTFGNSGLLT----------AGNTGTVSFTPTGAATINLQVDFSGLTQYA 275

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                +    +G+  G+   F++   G +   + +GT  PI ++A+A+  +   L     
Sbjct: 276 APSTLEG-TADGYPAGELTSFAIDTSGTITGTFSNGTTQPIAQVALASFANPAGLLRDG- 333

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N Y  + +SG   IG  G    G +  GALE +NVD++ E  ++I  QR +  NS+V  T
Sbjct: 334 NLYWESNNSGVARIGVAGTGGRGALTPGALEMSNVDLSREFVDMIVTQRGFQANSRVITT 393

Query: 409 GSDFMDILISLKR 421
             + +  L++LKR
Sbjct: 394 SDEMLQELVNLKR 406


>gi|312876506|ref|ZP_07736489.1| fagellar hook-basal body protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796717|gb|EFR13063.1| fagellar hook-basal body protein [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 494

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 118/495 (23%), Positives = 197/495 (39%), Gaps = 77/495 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVLKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    LS   T    +  N
Sbjct: 121 FSLDKMGNLVTATGLNVLGWMYDPENKQIDTTKSPS-KINILAFPTLSPQATDQIILDGN 179

Query: 168 LDKNATIITPDKTPKHNGR----------------------------------DAEYTHK 193
           LD N  I+        NG+                                    +    
Sbjct: 180 LDSNKKIVEIQYDNDGNGKIDKDEKLTGEDVYNKIKDPSMSVLDKYQKILNKIGDDMKSS 239

Query: 194 SSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS--FPYNVAPLNTVEVSF-- 249
            SF  +D+ G      + + K    KW   I    +S N +     N+   NT  ++F  
Sbjct: 240 ISFRIFDSQGGEHTLSLTFVKYDSNKWFWIIDSPRKSDNYAKYLDDNIEGANTNFIAFGR 299

Query: 250 -----------------------DPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
                                       +  NS  +        +  +           Q
Sbjct: 300 IEFDSKGQVINVQLEGAQNQNSNKFTIKFKNNSLDEITFDTSIGNTDETLNIFKFDYIKQ 359

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            + G   +  +I+G+A G  + F+V   G +  +Y +G    I ++A+AT  +   L+  
Sbjct: 360 YSLGSSIRTKKISGYAAGSLQGFNVDATGKIIGVYSNGLNQIIGQIAVATFANPAGLQRI 419

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N Y+ T +SGD  IG PG    G IF G LE +NVD+A E T++I  QR Y  N++V 
Sbjct: 420 GDNLYINTPNSGDPEIGIPGTGSRGTIFQGTLEMSNVDLAKEFTDMIVTQRGYQANARVI 479

Query: 407 QTGSDFMDILISLKR 421
               + +  L+++KR
Sbjct: 480 TASDELLQDLVNIKR 494


>gi|197122873|ref|YP_002134824.1| hypothetical protein AnaeK_2470 [Anaeromyxobacter sp. K]
 gi|196172722|gb|ACG73695.1| protein of unknown function DUF1078 domain protein
           [Anaeromyxobacter sp. K]
          Length = 428

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 102/435 (23%), Positives = 172/435 (39%), Gaps = 21/435 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS--TSNSYVSG 58
           M +L ++ +  +G+ A S  +S V DNIAN +TVG+K    AF   +  S       +  
Sbjct: 1   MSLLTALSSGTTGLQASSLELSVVGDNIANANTVGFKSGRAAFEDALSQSVIGGTGQIGL 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFF---IVKGRDNVNCLTRAGDFHINNEGF 115
           G  ++    I  QG+L  T   TDLA+QG GFF              TR G F ++++G+
Sbjct: 61  GSRLAGVQKILTQGALASTGLATDLALQGNGFFVVRGAHAGQTGTFYTRDGQFTVDDDGY 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L N+ G  + G+P   + A   +         ++     SA P  T  ++   +  A   
Sbjct: 121 LVNLEGLRVQGFPADPSGALAGL-------PDDLLVGTASAQPRATTRLTLKANLQADAA 173

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
            P          A     ++   YD LG+     VY+ KTGD  W+              
Sbjct: 174 VPTAAWDPANPGATSNFSTTMTVYDALGAGHAVQVYFRKTGDGAWDWHALTDGAGVAGGT 233

Query: 236 PYNVAPLNTVEVSFDP---------VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
              +  +    ++F            + +           + +           ++  TQ
Sbjct: 234 AGQLTQIAGGTLAFGDGGELTSMTQTSSFTPAGQAAPQPLDFSFGDPTSAGGTGLAGVTQ 293

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            +          +G+  G+     V  +G +  ++ +G    + ++A+A   + D L   
Sbjct: 294 FSATSASTFIGQDGYGSGQLASVRVGPEGVISGVFTNGQTRVLGQVAVAGFAAPDQLDRA 353

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN    T  SG   +G  G      + +G+LE +NVD+A +   LI AQR +  NSK  
Sbjct: 354 GGNLLQQTPGSGQPVVGAAGSGGRASVVAGSLEQSNVDLAEQFVRLIAAQRAFQANSKTI 413

Query: 407 QTGSDFMDILISLKR 421
            T    +  LI++KR
Sbjct: 414 TTADQLLSELIAMKR 428


>gi|297584044|ref|YP_003699824.1| fagellar hook-basal body protein [Bacillus selenitireducens MLS10]
 gi|297142501|gb|ADH99258.1| fagellar hook-basal body protein [Bacillus selenitireducens MLS10]
          Length = 424

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 91/433 (21%), Positives = 177/433 (40%), Gaps = 23/433 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + + GM+    ++  + +NI+NV+T G+K+  + F+ LV    + +        
Sbjct: 1   MIRSLYSGIGGMNNFQTKLDVIGNNISNVNTFGFKKGRVTFNDLVSQQLAGASSPQEGER 60

Query: 55  ------YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
                  V  G   ++ D I+ QGSL  T  + D+AI G GFF V      N  TRAG+F
Sbjct: 61  GGTNPRQVGLGGSTASIDTINTQGSLQSTGRDLDMAISGDGFFQVAD-GGQNFYTRAGNF 119

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           +++  G L N  G  L GY + +  A         L        ++    T+   +  NL
Sbjct: 120 YLDENGMLVNADGLRLQGYGVGDDGAIDEAAGVGDLFIP--AGEQVDPEATSQVDLRGNL 177

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
           + ++ I                  +       T  +   Y + Y     + W++      
Sbjct: 178 NADSEIGEERTVRFFITDPLGGEQEIRLLMTKTAENEWDYSLEYWDNDIEDWDILPDIGQ 237

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
              + S   +      + +    +                   G +  + +++S  TQ +
Sbjct: 238 GFFDFSGTEDGVSRGRMNLDNLELIVEDLG------FIGGPWEGHEGSLNLNLSNVTQFS 291

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                +    NG + G  + ++VS+ G ++ I+ +G    + ++A+    +   L     
Sbjct: 292 SRSTVEVESRNGSSDGTLESYTVSETGEINGIFSNGEVRLLGQVALVNFNNPSGLSKAGS 351

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N +  + +SG+  +G  G    G +    LE +NVD++ E  E+I +QR +  N+++  T
Sbjct: 352 NLFEVSNNSGEPQVGLAGIGGRGSLVGATLEMSNVDLSEEFAEMIVSQRGFQANTRMITT 411

Query: 409 GSDFMDILISLKR 421
             + +  LI+LKR
Sbjct: 412 SDEILQELINLKR 424


>gi|297617147|ref|YP_003702306.1| fagellar hook-basal body protein [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144984|gb|ADI01741.1| fagellar hook-basal body protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 487

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 108/488 (22%), Positives = 186/488 (38%), Gaps = 70/488 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM   +SG+     R+  + +NIANV+TVGYK++   F    +              
Sbjct: 1   MMRSMYAGVSGLRTHQLRMDVIGNNIANVNTVGYKKSRAIFKDAFYQAIRGGSAPTGARG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+++S+ D+I+  GS   T  NTDLAI G G+FI+         TRAG F 
Sbjct: 61  GTNPQAIGLGVQLSSVDVIATPGSAQTTGKNTDLAIDGNGYFIL-ESGGERYYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS----------AMPT 159
            +  G      G  ++GY      +   +    G  +I++    +              T
Sbjct: 120 FDVLGNYVASGGLHVMGYMPSKDDSGNWITDSSGKRKIDITTGLVPIDISALQSTEPKAT 179

Query: 160 TTGFISNNLDKN---ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG 216
           T    S N D       +     +   +  D   +  +S   YDTLG+  V    + K  
Sbjct: 180 TLIRFSGNFDSTLEPEYVWDETSSSFVDNPDGADSKITSKEFYDTLGNKRVQYFKFEKVM 239

Query: 217 DKK--------------WEVSIFRQDQ-----------------------------STNN 233
           ++               W V                                        
Sbjct: 240 ERDNVDIGNGETMNGSIWRVRASSDPDCPNPTASDSKSEDYYLFFDEKGKLIRAKHDNGT 299

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
           +   +         +         +S    I + +N     Q IT++ S  TQ    F  
Sbjct: 300 TGASSSDWQEPDVTAMTFAATDDPSSQSITIHYVNNGVPTQQPITLNFSYLTQYNATFTG 359

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                +G+  G  +  ++ ++G +  +Y +G    + R+A+A   +   L    GN +  
Sbjct: 360 WAEYQDGYTKGDLRSITIDQNGVILGVYSNGITDNLARVALAVFQNPAGLLAKGGNLFQV 419

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           + +SGD  +G PG    G I  G+LE +NVD++ E T++I  QR +  NS++  T  + +
Sbjct: 420 SNNSGDPKVGAPGEEAMGAILPGSLEMSNVDLSEEFTDMIVTQRGFQANSRIITTSDEML 479

Query: 414 DILISLKR 421
             L++LKR
Sbjct: 480 QELVNLKR 487


>gi|163758031|ref|ZP_02165119.1| flagellar hook protein E [Hoeflea phototrophica DFL-43]
 gi|162284320|gb|EDQ34603.1| flagellar hook protein E [Hoeflea phototrophica DFL-43]
          Length = 419

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 191/422 (45%), Positives = 258/422 (61%), Gaps = 4/422 (0%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T  SGM+AQ+NR+  V+DN+AN +T GYKR +  FSSL+ P ++ SY SG +
Sbjct: 1   MSLYGMMRTGASGMNAQANRLGTVADNMANANTTGYKRASAEFSSLILPGSAGSYNSGAV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+ G+L  T+S TD+A+ G GFFIV   + +  LTRAG F  + EGFL N A
Sbjct: 61  TTDVRYSISQAGALEFTSSKTDMALDGSGFFIVTDDNGLPFLTRAGSFVPDGEGFLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY  ++ +   +VN F GL  +NV    L+A P+TTG+   NLD+ ATI+     
Sbjct: 121 GFRLMGYNYESGTPTPVVNGFDGLVPVNVSAGSLTAAPSTTGYFQANLDEGATIVPAADL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR-QDQSTNNSFPYNV 239
           P  N   A+YT KSS  A D LG  V+ D YYTKT    WEV+++     S   SFPY  
Sbjct: 181 PSTNSATADYTSKSSLIAIDNLGGEVLLDFYYTKTATNTWEVTVYDRAGASAGTSFPYAS 240

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
           APL T  + FDP+ G LA +S   ISF          +TID+S  +QL   F    + +N
Sbjct: 241 APLATTTLQFDPLNGQLAGASATDISFTVPGGAG---LTIDLSNMSQLNYAFTVDDANVN 297

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G  P    D  +S+DG +   Y++GT  P+YR+A+A V S D L+   GN Y    DSG 
Sbjct: 298 GSKPSTVTDIEISEDGTIFASYENGTLEPLYRVALADVTSPDKLRPLAGNVYSQGLDSGV 357

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I+ GF G    G++ SGALE++NVDIA ELT++I AQR+Y  NSKVFQTGSD M++L++L
Sbjct: 358 ITTGFAGSGSFGKVVSGALESSNVDIAEELTDMIAAQRSYTANSKVFQTGSDLMEVLVNL 417

Query: 420 KR 421
           KR
Sbjct: 418 KR 419


>gi|326389474|ref|ZP_08211041.1| fagellar hook-basal body protein [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994479|gb|EGD52904.1| fagellar hook-basal body protein [Thermoanaerobacter ethanolicus JW
           200]
          Length = 417

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 107/433 (24%), Positives = 195/433 (45%), Gaps = 30/433 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SNGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            ++ G L    G  +LG+        +  ++   +       + +  + TT   I  NL+
Sbjct: 120 FDSNGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISLKNWSSIDPVATTQLEIGGNLN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S V  + +T+ G   W+  +   D 
Sbjct: 179 ASTAIDADI--------------SYNIVVYDSQGGSHVATITFTRKGANSWDWKVSSSDP 224

Query: 230 STNN-SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           + ++      +   +  +++ D     +A  +      ++ T+     +++D+SK T  +
Sbjct: 225 AISSIDGTGTLTFDSEGKIAPDQSGNRIATGTLTFNMDSNMTNATIGPVSLDLSKLTMFS 284

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                ++   NG+  G  +  ++ K G V  IY +G R  I ++AIA   +   L+    
Sbjct: 285 SETDLRELSKNGNEAGSLESINIDKYGVVSGIYSNGRRQIIGQIAIADFQNPMGLEKIGN 344

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             ++ T +SG+  IG  G    G I  G LE +NVD+++E  ++I  QR +  N+KV   
Sbjct: 345 TMFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLSNEFADMIVTQRGFQANAKVITV 404

Query: 409 GSDFMDILISLKR 421
             + +  L+++KR
Sbjct: 405 SDEILQDLVNMKR 417


>gi|306820122|ref|ZP_07453770.1| flagellar hook protein FlgE [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304551900|gb|EFM39843.1| flagellar hook protein FlgE [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 474

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 107/475 (22%), Positives = 185/475 (38%), Gaps = 57/475 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +A+S +     R+  + +NIANV+TV +K     F                   
Sbjct: 1   MMRSMNSAVSSLKNHQARMDVIGNNIANVNTVAFKAARTTFKDTYSQLTRAASGSSGDRG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
             +   +  G+ +S+ D   ++G++  T  NTDL I G+GFF+V G D     TR G+F 
Sbjct: 61  GINPGQIGLGMNLSSIDNAMDKGTVETTNINTDLYIDGEGFFMVDGPDG-RFYTRDGNFG 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ EG+L N  G  ++GY        +       +   +V   ++++     G +S+   
Sbjct: 120 VDEEGYLVNKNGNYVMGYQADKDGNIIEKIDKIQVPIKDVLKPKVTSNIQLEGNLSSKTA 179

Query: 170 KNATIITPDK----------TPKHNGRDAEYTHKS------------------SFAAYDT 201
           +      P+            P    +   YT K                   + +  D+
Sbjct: 180 EGLPSPLPNTLATIYDKKPVDPADPSKGFTYTVKPELAEGSSPKRESIIGKTITTSVIDS 239

Query: 202 LGSSVVYDVYYTKTGDKKWEVSIF--RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANS 259
           LG      V + K G   W    F    D +        +            +TG+    
Sbjct: 240 LGGEHTIQVDFVKEGPNTWSAYAFYKTPDGAMVPVTGSTINTNPATTADGKALTGFKFTD 299

Query: 260 -------------SHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKP 306
                        +        N +       I +S  TQ            +G+  G+ 
Sbjct: 300 KGLVDPANAVKELTFTLDPSGINGAAPINNFKIGLSSLTQYESKSTAFAKTNDGYKLGEL 359

Query: 307 KDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPG 366
              S+  DG V   +++G    + ++  AT  + + L+    N + PT +SG+ +I  PG
Sbjct: 360 TKMSIGSDGKVIGQFNNGDTKALGQIVTATFSNVNGLQKQGDNLWSPTENSGEANINKPG 419

Query: 367 HNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
              +G + SGALE +NVD+A E T +I  QR +  NS+V  T    ++ L++LKR
Sbjct: 420 SGGNGALLSGALEMSNVDLAKEFTNMIVTQRGFQANSRVITTTDQMLEELVNLKR 474


>gi|241766920|ref|ZP_04764726.1| flagellar basal body FlaE domain protein [Acidovorax delafieldii
           2AN]
 gi|241362624|gb|EER58472.1| flagellar basal body FlaE domain protein [Acidovorax delafieldii
           2AN]
          Length = 425

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 97/425 (22%), Positives = 172/425 (40%), Gaps = 11/425 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
           S +  +SG++A S  +  +  NIAN +T G+K +   F+ +V     S   +    G+E 
Sbjct: 2   SFQQGLSGLNASSKNLDVIGHNIANANTTGFKASRAEFAEMVASAIGSAGGNNAGIGVET 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG+L  T ++ D+AI G GFF ++  D     TRAG+F ++  G +      
Sbjct: 62  ANVAQQFTQGNLTITGNSLDVAINGNGFFTLQQPDGSPAYTRAGNFKLDKTGNMVTNDNA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GYP+   +      +   +     +              + +         P  TP 
Sbjct: 122 KVMGYPVDPLTGLRSGTAPVPMVFPTAEPIPAKQTTKIMAGFNLDARAPDAAGNPAATPP 181

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                   T+ +S   YD+ G +    +Y+ K G   W+V     D   +          
Sbjct: 182 IPATPRA-TYGTSINVYDSQGVAKPVSLYFQKNGANTWDVYDKLDDPKASPPVVATPIGQ 240

Query: 243 NTVEVSFDPVTGYLANSSH-------KAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
              + +   V+      S         A S  +        + I++ K TQ    F    
Sbjct: 241 IKFDNNGAIVSPAPVAPSTEHLLNLTIAPSPPNPNGLPTFPVDINLDKVTQFGTKFAVSD 300

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              +G+  G+    +V  +G +   Y +G      +LA+A+  +   L    GN ++ T 
Sbjct: 301 LTQDGYTAGELTGINVENNGMIMTRYSNGVTRAEGQLALASFRNTQGLAAVGGNNWVETF 360

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG   +G       G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T    M  
Sbjct: 361 ESGQPVLGTATDGNFGALRSGALEDSNVDLTAELVNMMTAQRAYQANAQTIKTQDQVMST 420

Query: 416 LISLK 420
           L++L+
Sbjct: 421 LVNLR 425


>gi|220917665|ref|YP_002492969.1| protein of unknown function DUF1078 domain protein
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955519|gb|ACL65903.1| protein of unknown function DUF1078 domain protein
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 428

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 102/435 (23%), Positives = 172/435 (39%), Gaps = 21/435 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS--TSNSYVSG 58
           M +L ++ +  +G+ A S  +S V DNIAN +TVG+K    AF   +  S       +  
Sbjct: 1   MSLLTALSSGTTGLQASSLELSVVGDNIANANTVGFKSGRAAFEDALSQSVIGGTGQIGL 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFF---IVKGRDNVNCLTRAGDFHINNEGF 115
           G  ++    I  QG+L  T   TDLA+QG GFF              TR G F ++++G+
Sbjct: 61  GSRLAGVQKILTQGALASTGLATDLALQGNGFFVVRGAHAGQTGTFYTRDGQFTVDDDGY 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L N+ G  + G+P   + A   +         ++     SA P  T  ++   +  A   
Sbjct: 121 LVNLEGLRVQGFPADPSGALAGL-------PDDLLVGTASAQPRATTRLTLKANLQADAA 173

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
            P          A     ++   YD LG+     VY+ KTGD  W+              
Sbjct: 174 VPTAAWDPANPGATSNFSTTMTVYDALGAGHAVQVYFRKTGDGAWDWHALTDGAGVAGGT 233

Query: 236 PYNVAPLNTVEVSFDP---------VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
              +  +    ++F            + +           + +           ++  TQ
Sbjct: 234 AGQLTQIAGGTLAFGDGGELTSMTQTSSFTPAGQAAPQPLDFSFGDATSAGGTGLAGVTQ 293

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            +          +G+  G+     V  +G +  ++ +G    + ++A+A   + D L   
Sbjct: 294 FSATSASTFIGQDGYGSGQLASVRVGPEGVISGVFTNGQTRVLGQVAVAGFAAPDQLDRA 353

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN    T  SG   +G  G      + +G+LE +NVD+A +   LI AQR +  NSK  
Sbjct: 354 GGNLLQQTPGSGQPVVGAAGSGGRASVVAGSLEQSNVDLAEQFVRLIAAQRAFQANSKTI 413

Query: 407 QTGSDFMDILISLKR 421
            T    +  LI++KR
Sbjct: 414 TTADQLLSELIAMKR 428


>gi|312792656|ref|YP_004025579.1| fagellar hook-basal body protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179796|gb|ADQ39966.1| fagellar hook-basal body protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 494

 Score =  269 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 115/495 (23%), Positives = 196/495 (39%), Gaps = 77/495 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVLKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    LS   T    +  N
Sbjct: 121 FSLDKMGNLVTATGLNVLGWMYDPVNKQIDTTKSPS-KINILAFPTLSPQATDQIILDGN 179

Query: 168 LDKNATIITPDKTPKHNGR----------------------------------DAEYTHK 193
           LD N  I+        NG+                                    +    
Sbjct: 180 LDSNKKIVEIQYDNDGNGKIDKDEKLTGEDVYNKIKDPSMSVLDKYQKILNKIGDDMKSS 239

Query: 194 SSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS--FPYNVAPLNTVEVSF-- 249
            SF  +D+ G      + + K    KW   I    ++ N +     N+   NT  ++F  
Sbjct: 240 ISFRIFDSQGGEHTLSLTFVKYDSNKWFWIIDSPRKNNNYTEYLDDNIEGANTNFIAFGR 299

Query: 250 -----------------------DPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
                                       +  NS  +        +  +           Q
Sbjct: 300 IEFDSKGQVINVQLEGAQNQNSNKFTIKFKNNSLDEITFDTSIGNTDETLNIFKFDYIKQ 359

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            +     +  +++G+A G  + F+V   G +  +Y +G    I ++A+AT  +   L+  
Sbjct: 360 YSLDSSIRAKKVSGYAAGSLQGFNVDATGKIIGVYSNGLNQIIGQIAVATFANPAGLQRI 419

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             N Y+ T +SGD  IG PG    G IF G LE +NVD+A E T++I  QR Y  N++V 
Sbjct: 420 GDNLYINTPNSGDPEIGIPGTGSRGTIFQGTLEMSNVDLAKEFTDMIVTQRGYQANARVI 479

Query: 407 QTGSDFMDILISLKR 421
               + +  L+++KR
Sbjct: 480 TASDELLQDLVNIKR 494


>gi|307264876|ref|ZP_07546438.1| fagellar hook-basal body protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920134|gb|EFN50346.1| fagellar hook-basal body protein [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 417

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 106/433 (24%), Positives = 195/433 (45%), Gaps = 30/433 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SNGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            ++ G L    G  +LG+        +  ++   +       + +  + TT   I  NL+
Sbjct: 120 FDSNGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISLKNWSSIDPVATTQLEIGGNLN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S V  + +T+     W+  +   D 
Sbjct: 179 ASTAIDADI--------------SYNIVVYDSQGGSHVATITFTRKAANSWDWKVSSSDP 224

Query: 230 STNN-SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           + ++      +   +  +++ D     +A  +      ++ T+     +++D+SK T  +
Sbjct: 225 AISSIDGTGTLTFDSEGKIAPDQSGNRIATGTLTFNMDSNMTNATIGPVSLDLSKLTMFS 284

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                ++   NG+  G  ++ ++ K G V  IY +G R  I ++AIA   +   L+    
Sbjct: 285 SETDLRELSKNGNEAGSLENINIDKYGVVSGIYSNGRRQIIGQIAIADFQNPMGLEKIGN 344

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             ++ T +SG+  IG  G    G I  G LE +NVD+++E  ++I  QR +  N+KV   
Sbjct: 345 TMFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLSNEFADMIVTQRGFQANAKVITV 404

Query: 409 GSDFMDILISLKR 421
             + +  L+++KR
Sbjct: 405 SDEILQDLVNMKR 417


>gi|125972995|ref|YP_001036905.1| protein of unknown function DUF1078-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|256004792|ref|ZP_05429767.1| protein of unknown function DUF1078 domain protein [Clostridium
           thermocellum DSM 2360]
 gi|281417206|ref|ZP_06248226.1| fagellar hook-basal body protein [Clostridium thermocellum JW20]
 gi|125713220|gb|ABN51712.1| protein of unknown function DUF1078-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|255991242|gb|EEU01349.1| protein of unknown function DUF1078 domain protein [Clostridium
           thermocellum DSM 2360]
 gi|281408608|gb|EFB38866.1| fagellar hook-basal body protein [Clostridium thermocellum JW20]
 gi|316940769|gb|ADU74803.1| flagellar hook-basal body protein [Clostridium thermocellum DSM
           1313]
          Length = 440

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 106/441 (24%), Positives = 189/441 (42%), Gaps = 23/441 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + +SG+ A   ++  + +N+ANV+TVG+K + + F  +   +            
Sbjct: 1   MMRSMFSGVSGLQAHQTKMDVIGNNVANVNTVGFKSSRVTFQEVFSQTLKGASSPDPTTG 60

Query: 51  ---TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAG 106
              T+   V  GL ++T D +  +GS+  T + TDLAI+G GFFIVKG  +     TRAG
Sbjct: 61  RGGTNPMQVGLGLGVATIDTLMTRGSVQRTDNPTDLAIEGDGFFIVKGGSSDTFKFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPL-----KNASAPLIVNSFQGLERINVKHAELSAMPTTT 161
           +F I+  G L   +G  + G+                +  + +   +    +   M    
Sbjct: 121 NFGIDRLGNLVTGSGLNVYGWQSYTKLPDGTYKFDTESQIEPINLYSDDVNKNKRMIAAK 180

Query: 162 GFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWE 221
                  + N        +   +G  +          YD+LG+S   ++ + KT      
Sbjct: 181 ATTYAIFEGNLDASYSIYSSAASGTSSNNRFTMPVTVYDSLGNSYKINISFWKTDVTGGV 240

Query: 222 VSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
            +   Q  S N             +     +       S   I  + +    +  + +D 
Sbjct: 241 TTWTWQVDSGNGVTASGATGTILFDDQGQVIESSAVTPS-ITIIPDSSVGSQNINVKLDF 299

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           S+ T  A     + + ++G+  G    FS+  DG +  IY +G + P+  +A+A+  +  
Sbjct: 300 SRLTMYAADSSAKATNVDGYPAGSLVTFSIGSDGMIMGIYSNGQQQPLGLIALASFDNPA 359

Query: 342 NLKLFDGNTYLPTRDSGDISIGF-PGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
            L+    N Y+PT +SG+   G   G    G +  G LE +NVD++ E TE+I  QR + 
Sbjct: 360 GLEKVGENMYIPTSNSGEFKKGVKAGTEGVGTLSPGTLEMSNVDLSKEFTEMIITQRGFQ 419

Query: 401 VNSKVFQTGSDFMDILISLKR 421
            NS++  T  + +  L++LKR
Sbjct: 420 ANSRIITTSDEMLQELVNLKR 440


>gi|167040321|ref|YP_001663306.1| hypothetical protein Teth514_1684 [Thermoanaerobacter sp. X514]
 gi|300914405|ref|ZP_07131721.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X561]
 gi|307724359|ref|YP_003904110.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X513]
 gi|166854561|gb|ABY92970.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter sp. X514]
 gi|300889340|gb|EFK84486.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X561]
 gi|307581420|gb|ADN54819.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X513]
          Length = 417

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 107/433 (24%), Positives = 191/433 (44%), Gaps = 30/433 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV  +   N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SKGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +++G L    G  +LG+        +  ++   +       + +    TT   I  N++
Sbjct: 120 FDSQGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISLKNWSSIDPAATTQLEIGGNIN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S +  + +TK     W  S+   D 
Sbjct: 179 ASTEINGAI--------------SYNILVYDSQGGSHIATITFTKNDATTWNWSVSSSDP 224

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGY-LANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           + ++                    G  +AN +         TS     +++D+S+ T  +
Sbjct: 225 AISSVDGSGTLTFGADGRILPDANGVRIANGTLNFNMNTAVTSATIGPVSLDLSRLTMFS 284

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                ++   +G+  G  +  ++ K G V  IY +G R  I ++AIA   +   L+    
Sbjct: 285 SETDLRELSKDGNEAGSLESINIDKYGVVSGIYSNGRRQVIGQIAIADFQNPMGLEKVGN 344

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             ++ T +SG+  IG  G +  G I  G LE +NVD+A+E T++I  QR +  N++V   
Sbjct: 345 TMFINTVNSGEPMIGAAGTDTRGSINPGTLEMSNVDLANEFTDMIVTQRGFQANARVITA 404

Query: 409 GSDFMDILISLKR 421
             + +  L+++KR
Sbjct: 405 SDEILQDLVNIKR 417


>gi|302872562|ref|YP_003841198.1| fagellar hook-basal body protein [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302575421|gb|ADL43212.1| fagellar hook-basal body protein [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 489

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 114/490 (23%), Positives = 194/490 (39%), Gaps = 72/490 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVLKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    L    T       N
Sbjct: 121 FSLDKMGNLVTATGLNVLGWMYDPVNNQIDTTKSPS-KINILAFPTLPPKATDKISFDGN 179

Query: 168 LDKNATIITPDKTPKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           L  +    +       +     A+  + +SF  YD+ G    + + + KTGD  W   + 
Sbjct: 180 LSADLKAYSGQIDKYEDLLNVPADSKYSTSFKIYDSQGKEHTFQLTFVKTGDNTWNWYVD 239

Query: 226 RQDQSTNNSFPYNVAPLN------------------TVEVSFDPVTGYLANSSHKAISFN 267
                 N     N                       T  ++F      L + +       
Sbjct: 240 APRIKKNVGTAQNPDEKYVYVDEMLDANNDYDKFIATGTITFGQAGKVLDDENTSDKVEG 299

Query: 268 DNTSGIDQQITIDISKT-----------------------------------TQLA-GGF 291
            + +G     T D + T                                   TQ      
Sbjct: 300 LSVTGGRIINTTDGTFTIKFKNDVVNPITFKVNSAEFDVNDNTNIAFFLKNITQFGNMES 359

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
             + +++ G+A G  + F+V   G +  +Y +G    I ++A+AT  +   L+    N Y
Sbjct: 360 SIRVAQMTGYAAGNLQGFNVDASGKITGVYSNGLNQLIGQIAVATFANPAGLQRIGDNLY 419

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T +SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N++V     +
Sbjct: 420 INTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANARVITASDE 479

Query: 412 FMDILISLKR 421
            +  L+++KR
Sbjct: 480 LLQDLVNIKR 489


>gi|167037660|ref|YP_001665238.1| hypothetical protein Teth39_1248 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116075|ref|YP_004186234.1| flagellar hook-basal body protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856494|gb|ABY94902.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929166|gb|ADV79851.1| flagellar hook-basal body protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 417

 Score =  268 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 107/433 (24%), Positives = 191/433 (44%), Gaps = 30/433 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV  +   N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SKGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +++G L    G  +LG+        +  ++   +       + +    TT   I  N++
Sbjct: 120 FDSQGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISLKNWSSIDPAATTQLEIGGNIN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S +  + +TK     W  S+   D 
Sbjct: 179 ASTEINGAI--------------SYNILVYDSQGGSHIATITFTKNDATTWNWSVSSSDP 224

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGY-LANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           + ++                    G  +AN +         TS     +++D+S+ T  +
Sbjct: 225 AISSVDGSGTLTFGADGRILPDANGVRIANGTLNFNMNTAVTSATIGPVSLDLSRLTMFS 284

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                ++   +G+  G  +  ++ K G V  IY +G R  I ++AIA   +   L+    
Sbjct: 285 SETDLRELSKDGNEAGSLESINIDKYGVVSGIYSNGRRQVIGQIAIADFQNPMGLEKVGN 344

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             ++ T +SG+  IG  G +  G I  G LE +NVD+A+E T++I  QR +  N++V   
Sbjct: 345 TMFINTVNSGEPMIGAAGTDTRGSINPGTLEMSNVDLANEFTDMIVTQRGFQANARVITA 404

Query: 409 GSDFMDILISLKR 421
             + +  L+++KR
Sbjct: 405 SDEILQDLVNMKR 417


>gi|269138582|ref|YP_003295282.1| flagellar hook protein [Edwardsiella tarda EIB202]
 gi|267984242|gb|ACY84071.1| flagellar hook protein [Edwardsiella tarda EIB202]
 gi|304558592|gb|ADM41256.1| Flagellar hook protein FlgE [Edwardsiella tarda FL6-60]
          Length = 410

 Score =  268 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 97/416 (23%), Positives = 185/416 (44%), Gaps = 8/416 (1%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SGM+A S+++  + +NIAN  TVG+K  ++ F+ +       S V  G+ +++ 
Sbjct: 2   GFSQAISGMNAASSQLDVIGNNIANSQTVGFKSGSVTFADMFA----GSKVGLGVTVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
           +   + G+   T    D+AI G+GFF ++  +     TR G F  + +GFL N  G  L 
Sbjct: 58  NQDFKDGTTTTTNRGLDVAISGQGFFRMQDPNGSVYYTRNGQFSKDAKGFLTNAQGMYLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A  P  +        I +    + A  +T G +  NL+     +          
Sbjct: 118 GYPA--AGTPPTIQQGADPVPIQIPTGLMPAKASTQGTMVLNLNSANKAVDKTVAF-DPS 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   YT+ +S   YD+LG+    ++Y+ K                + +S      P +  
Sbjct: 175 KVDSYTYATSMTTYDSLGNVHNMNLYFVKGESTTTAPITTTWKVYSIDSADPAGKPQDAG 234

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT-TQLAGGFIPQKSEINGHAPG 304
           +++FD        ++   ++   +     Q   +D + T  Q  G         +G+  G
Sbjct: 235 DLTFDSNGELAKGTAPLTLNMAASNGAPAQTFKLDFTGTRQQNTGKDGVTSKTQDGYKAG 294

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +   + ++ DG +   Y +  +  + ++ +A   + + L     N +  +  SG   +G 
Sbjct: 295 ELTGYQINDDGTITGSYTNQQKQLLGQIVMANFAAPEGLVSEGNNVWSESAKSGQPIVGT 354

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G +  G + SGA+E +NVD++ +L ++I AQRNY  N++  +T    +  L++L+
Sbjct: 355 SGTSGLGSLTSGAVEASNVDLSKQLVDMIVAQRNYQSNAQTIKTQDQILQTLVNLR 410


>gi|221636048|ref|YP_002523924.1| flagellar hook protein FlgE [Thermomicrobium roseum DSM 5159]
 gi|221157294|gb|ACM06412.1| flagellar hook protein FlgE [Thermomicrobium roseum DSM 5159]
          Length = 423

 Score =  268 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 112/438 (25%), Positives = 182/438 (41%), Gaps = 34/438 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +A+SG+ A    +  + +NIANV+T G+K   + F+ ++               
Sbjct: 1   MMRSMFSAISGLRAHQTWMDVIGNNIANVNTTGFKVGRVRFTDILSQLVRGASGPTETRG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
             +   +  G  +   D I  QG+L  T   +DLAIQG GFF+V         TR G F 
Sbjct: 61  GINPLQIGLGAVVGAVDTIHTQGALQLTGKPSDLAIQGDGFFVVSDGS-QTLYTRDGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           I ++  L N + G  +     +A+  +      G         +L A+PTT   +  NL+
Sbjct: 120 IGSDLRLVNPSNGFYVLGWQADANGNVDTAGPVGP-ITIPIGQQLDAVPTTQITVQGNLN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI----- 224
            N                      +  +  D+LG    + + + K G   W  ++     
Sbjct: 179 ANQDPAA------------TPHFVTKVSITDSLGKRHEFYILFDKVGTNTWNYTLQEDDP 226

Query: 225 -FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                   +  F     P  T+    D      A++       +         +T D S+
Sbjct: 227 RTTSTTEDDPDFALGGTPSGTLVFDADGNLDLAASNISAVDLDSTAGGASSITVTPDFSR 286

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQLA  +    +     A      F+VS+ G V  IY +G    + ++A+A   +   L
Sbjct: 287 LTQLAAPYSANAAANGAPAG-SLTTFTVSQSGQVLGIYSNGVTKVVGQIALALFTNPGGL 345

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               GN YLPT +SG+  +G       G+I SG LE +NVD+A E T +I AQR +  NS
Sbjct: 346 MKVGGNAYLPTVNSGEPIVGPADSGGRGKIASGYLEMSNVDLAQEFTSMIMAQRGFQANS 405

Query: 404 KVFQTGSDFMDILISLKR 421
           +V  T  + +  L++L+R
Sbjct: 406 RVITTSDEVLQELVNLRR 423


>gi|312126828|ref|YP_003991702.1| fagellar hook-basal body protein [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776847|gb|ADQ06333.1| fagellar hook-basal body protein [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 486

 Score =  268 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 114/487 (23%), Positives = 193/487 (39%), Gaps = 69/487 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVLKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGRAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    L    T       N
Sbjct: 121 FSLDKMGNLVTATGLNVLGWMYDPVNNQIDTTKSPS-KINILAFPTLPPKATDKISFDGN 179

Query: 168 LDKNATIITPDKTPKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           L  +  I +   T   +     A+  + +SF  YD+ G      + + KT D  WE  + 
Sbjct: 180 LSADTKIYSGQITNYEDLLNVPADSKYSTSFKIYDSQGKEHTLQLTFVKTSDNTWEWFVD 239

Query: 226 RQDQSTNNSFPYNVAPLNT------------------VEVSFDPVTGYLANSSHKAISFN 267
                 N     N                          ++F      L + +   +   
Sbjct: 240 APRVKKNIGTAQNPDEKYVYVDEMLDANNDYDNFIARGTITFGQAGKVLDDENTTDVEGI 299

Query: 268 DNTSG--------------------------------IDQQITIDISKTTQLA-GGFIPQ 294
             T G                                 +  I   +   TQ        +
Sbjct: 300 AITGGRITGNGTFTIKFKNDVVNPITFKVNSAEFDVNDNTNIAFFLKNITQFGNMESSIR 359

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
            +++ G++ G  + F+V   G +  +Y +G    I ++AIAT  +   L+    N Y+ T
Sbjct: 360 VAQMTGYSAGSLQGFNVDASGKITGVYSNGLNQLIGQIAIATFANPAGLQRIGDNLYINT 419

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N++V     + + 
Sbjct: 420 VNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANARVITASDELLQ 479

Query: 415 ILISLKR 421
            L+++KR
Sbjct: 480 DLVNIKR 486


>gi|288940409|ref|YP_003442649.1| fagellar hook-basal body protein [Allochromatium vinosum DSM 180]
 gi|288895781|gb|ADC61617.1| fagellar hook-basal body protein [Allochromatium vinosum DSM 180]
          Length = 436

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 100/435 (22%), Positives = 181/435 (41%), Gaps = 20/435 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN--SYVSGGLEIS 63
           S    +SG+ A +  +    +N+AN  T+G+K++   F+ +   S     +  + G+ + 
Sbjct: 2   SFSIGLSGLQAAAKDLEVTGNNVANSGTIGFKKSRAEFADIYASSFYTCVNKSAVGVRLD 61

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN--CLTRAGDFHINNEGFLENVAG 121
                  QG++  T +  DLAI G+GFF++      +    TR G F ++ +G++ N +G
Sbjct: 62  AVTQQFSQGNVELTDNTLDLAINGEGFFVLNSEAGQDGKVYTRNGAFQVDRDGYVVNSSG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK-- 179
             L  YP    ++ +       LE I +    ++   TT   +  NL+ + T+IT     
Sbjct: 122 QRLQAYPPTTPNSAVSAFDTGKLEDIQLPLDNMAPKATTEVELQVNLNSDETVITGTTPP 181

Query: 180 --------TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR----- 226
                    P  +     Y   +++  YD+LG      +Y+ KT    W V +       
Sbjct: 182 GPAFAFPTAPATDVDPTSYNWSTTYQVYDSLGKPRDVTMYFVKTAPDNWAVHVGMRDSAG 241

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
             Q         +     V  +       +A S    ++  D+        +ID+S +TQ
Sbjct: 242 VMQDVGGGTNTAIFTAAGVFDTATSTPNPIAVSVGPFLTPPDDNGAGALAFSIDMSNSTQ 301

Query: 287 L-AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
                        +G+  G    F V  DG +   Y +G    + ++A+A   +   L+ 
Sbjct: 302 YHNSRNNLNDVTQDGYTSGTLSGFDVDADGAIFSRYSNGKSYVLGQVAMANFKNPQGLQQ 361

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N +  + +SG+      G  + G I S ALE +NVD++ EL  +I AQRNY  N+K 
Sbjct: 362 LGDNNWGESYNSGEPIYAAAGDGRLGSIQSCALENSNVDLSQELVNMITAQRNYEANAKT 421

Query: 406 FQTGSDFMDILISLK 420
             T       +++++
Sbjct: 422 ISTSDQMTQTILNIR 436


>gi|256750749|ref|ZP_05491634.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750332|gb|EEU63351.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 417

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 108/433 (24%), Positives = 191/433 (44%), Gaps = 30/433 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV  +   N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SKGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +++G L    G  +LG+        +  ++   +       + +    TT   I  N++
Sbjct: 120 FDSQGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISLKNWSSIDPAATTQLEIGGNIN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S +  + +TK     W  S+   D 
Sbjct: 179 ASTEINGAI--------------SYNILVYDSQGGSHIATITFTKNDATTWNWSVSSSDP 224

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGY-LANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
           + ++                    G  +AN +         TS     +++D+S+ T  +
Sbjct: 225 AISSVDGSGTLTFGADGRILPDANGVRIANGTLNFNMNTAVTSATIGPVSLDLSRLTMFS 284

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                ++   +G+  G  +  ++ K G V  IY +G R  I ++AIA   +   L+    
Sbjct: 285 SETDLRELSKDGNEAGSLESINIDKYGVVSGIYSNGRRQVIGQIAIADFQNPMGLEKVGN 344

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
             ++ T +SG+  IG  G N  G I  G LE +NVD+A+E T++I  QR +  N++V   
Sbjct: 345 TMFINTVNSGEPMIGAAGTNTRGSINPGTLEMSNVDLANEFTDMIVTQRGFQANARVITA 404

Query: 409 GSDFMDILISLKR 421
             + +  L+++KR
Sbjct: 405 SDEILQDLVNMKR 417


>gi|212709492|ref|ZP_03317620.1| hypothetical protein PROVALCAL_00534 [Providencia alcalifaciens DSM
           30120]
 gi|212687830|gb|EEB47358.1| hypothetical protein PROVALCAL_00534 [Providencia alcalifaciens DSM
           30120]
          Length = 422

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 104/425 (24%), Positives = 185/425 (43%), Gaps = 14/425 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S  + ++ +NIAN  T G+K    +F+ +       S V  G+ ++  
Sbjct: 2   SFSQAVSGLNAASAGLDSIGNNIANSATNGFKGATTSFADMFA----GSGVGLGVNVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G +  T   TD+AI G GFF V+ ++     +R G F  +  G L N  G V+ 
Sbjct: 58  TQNFKDGPITRTDRATDVAISGNGFFRVQDQNGDVYYSRDGQFLRDKSGNLVNNQGMVVT 117

Query: 126 GYPLK-NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP   +    + V S      +N+    + A  +    ++ NL+    +      P + 
Sbjct: 118 GYPASVDDKGNVTVQSGGVPGGMNIPTDMMDAKQSDLAKLTINLNSEDKVKAKAFDPNNP 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              A Y   ++  AYD+ G++    VY+ K  D KWEV      ++            N 
Sbjct: 178 DDIATYNFSTTMTAYDSQGNTHEISVYFVKKDDNKWEVHAKDASETVAKKLGELEFDGNG 237

Query: 245 VEVSFDPVTGYLANSSHKAISFNDN--------TSGIDQQITIDISKTTQLAGG-FIPQK 295
             ++   V G         +                 D  + +D+ KT Q          
Sbjct: 238 KLMTEKVVKGPNPGDPDTTVQLPTTFDFPFKGLNGANDGTLKVDLGKTRQQKVSESSVSA 297

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
            ++NG+  G+   F +  +G +   Y +  +  + ++A++   + + L    GN +  + 
Sbjct: 298 IDVNGYPAGEYTTFKIEDNGLIVANYSNQQKRVVGQIALSAFANPNGLVSQGGNVWAASN 357

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG+   G PG  Q G++ SGALE++NVD++ EL  +I  QRNY  N++  +T    +  
Sbjct: 358 ASGNPMDGVPGVGQFGKLTSGALESSNVDMSQELISMIVMQRNYQSNAQTIKTQDQMLQT 417

Query: 416 LISLK 420
           L++L+
Sbjct: 418 LVNLR 422


>gi|206889889|ref|YP_002248123.1| flagellar hook protein FlgE [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741827|gb|ACI20884.1| flagellar hook protein FlgE [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 434

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 104/439 (23%), Positives = 188/439 (42%), Gaps = 25/439 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGG 59
           +L S+ T +SG++A    +S + DNIAN +TVG+K +   F+ ++  +   +    V  G
Sbjct: 1   MLTSLFTGISGLNANGLALSVIGDNIANANTVGFKASRANFADILSQTLGGASAMQVGRG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV 119
             I     +  QG+L  T++  DLAI+G GFF+V+  +     TRAG F +N +G++ + 
Sbjct: 61  TMIIDIQKLFTQGTLETTSNPLDLAIEGDGFFVVQQPNGPTYYTRAGQFRVNKDGYIVDP 120

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G +L  Y +              +  + +         T       NLD      T   
Sbjct: 121 NGYLLQAYQMDVNGNVT-----GAIGNVYLAGLMSDPSATDLITTQVNLDSREDTTTWSF 175

Query: 180 TPKHNGR-DAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS---- 234
           T          Y + ++   YD+ G+  +   Y+ KT    WE  +   + +T  +    
Sbjct: 176 TSGSTLPVAGTYNYSTAITIYDSQGNPHLVYTYFCKTAANTWEAHVVYNNSATGTNYVEV 235

Query: 235 -FPYNVAPLNTVEVSFDPVTGYLANS-----------SHKAISFNDNTSGIDQQITIDIS 282
            F        T+    +     +  +              A+ F+       Q + ID++
Sbjct: 236 DFDSGTTQPVTIAFDSNGALSDVYVTTPHTPPDPTFRPTAALDFSSWGVTSPQNVDIDLN 295

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
            +TQ            NG++ G     +V +DG +  ++ +G    + ++ +A   +  N
Sbjct: 296 NSTQYGSSNAVVFQNQNGYSAGNLIAVTVDQDGVISGVFTNGQVKKVAQVVLAKFVAAHN 355

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L     N YL +  SG  + G PG    G++++ +LE +NVD+A E   +I AQR Y  N
Sbjct: 356 LTKVGNNLYLESYASGGPTYGAPGTVGVGKVYANSLEASNVDLAEEFIRMIAAQRAYQAN 415

Query: 403 SKVFQTGSDFMDILISLKR 421
            +V  T  + ++ L+++ R
Sbjct: 416 VRVITTTDNMLNELMNIVR 434


>gi|110632640|ref|YP_672848.1| flagellar hook protein FlgE [Mesorhizobium sp. BNC1]
 gi|110283624|gb|ABG61683.1| flagellar basal body FlaE [Chelativorans sp. BNC1]
          Length = 422

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 185/425 (43%), Positives = 257/425 (60%), Gaps = 7/425 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G MKT +SGM+AQ+NR+S V+DNIAN  T GYKR    FS+LV P T  SY SGG+
Sbjct: 1   MSLYGMMKTGVSGMNAQANRLSTVADNIANSSTNGYKRATTEFSTLVVPGTQGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + ++ +S QG L +T S TDLA+ G GFFIV+G +    LTRAG F ++ +G L N +
Sbjct: 61  TSTVRNAVSAQGVLQYTTSITDLAVNGSGFFIVQGSNGQPYLTRAGSFVLDGDGRLVNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK- 179
           G  L+GY   N +     N + GLE I +K  EL A P+  G  S NL  +A I+     
Sbjct: 121 GYQLMGYSYANGTPSATANGYAGLEPITIKQPELVATPSRNGVFSANLPLDAEIVDTGAG 180

Query: 180 --TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR-QDQSTNNSFP 236
             T   N   +EY+ K+S  AY   G  V+ DVY+TKTGD +WEV++F   D + +  FP
Sbjct: 181 QSTAGDNTSTSEYSVKTSLVAYGNRGEQVLLDVYFTKTGDDEWEVAVFDRADATPDTGFP 240

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
           Y   PL T +++FDP TG L  +S   ++           + +D+S+ +QL  GF    +
Sbjct: 241 YASGPLATDQLTFDPTTGKLTGTSVTGVTIPVPGGD---DLELDLSQLSQLDSGFQVYDA 297

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
           E++G  P       +S +G V   Y DG+  P+YR+ +A V S D L++  GN +  T  
Sbjct: 298 EVDGTPPTSIDSIEISAEGIVYAQYADGSFKPLYRIPLANVTSPDQLEVLSGNAFAETAA 357

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG + IGF G +  G+I SGALE++NVDIA ELT +IE+QR+Y  NSKVFQTGSD M++L
Sbjct: 358 SGAVRIGFAGSDGLGDIASGALESSNVDIAEELTSMIESQRSYTANSKVFQTGSDLMELL 417

Query: 417 ISLKR 421
           ++LKR
Sbjct: 418 VNLKR 422


>gi|296133040|ref|YP_003640287.1| fagellar hook-basal body protein [Thermincola sp. JR]
 gi|296031618|gb|ADG82386.1| fagellar hook-basal body protein [Thermincola potens JR]
          Length = 419

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 107/432 (24%), Positives = 179/432 (41%), Gaps = 26/432 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM   +SG+     R+  + +NIANV+T+GYK+    F  ++               
Sbjct: 1   MMRSMFAGVSGLRNHQVRMDVIGNNIANVNTIGYKKARATFQDILSQNIRGASSPTATRG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   V  G+ I+T D I  QGS   T   TD+ + G GFFIV    N    TRAG+F 
Sbjct: 61  GTNPMQVGLGMTINTIDTIHTQGSSETTGKVTDMMVDGDGFFIVGDGTN-RFYTRAGNFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +  G L N +G ++ G+   +        +  G++    K   +    T      NNLD
Sbjct: 120 FDAVGNLINTSGLLVQGWMADSQGNIDTTVAISGIKIP--KGQSIQPKATENATFVNNLD 177

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
                     TP                 YD+LG++    + + KT +      +     
Sbjct: 178 AGTPQYDNTVTPPVGVVATT------LEIYDSLGNAYNLPIEFRKTANSNEWSVVVDPQG 231

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           +   +        N +        G            N      DQ I +D++K TQ AG
Sbjct: 232 TFTAATLAVTTTSNLI----FDGNGNYKAGDLTIDLTNFTNGANDQSIKVDLTKITQYAG 287

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               + +  +G+A G    +++   G +   + +G    + ++A+A   +   L    GN
Sbjct: 288 ESNVEPNFQDGYASGVLNGYAIDSSGVITGQFSNGLTKQLAQVALANFNNPAGLMKVGGN 347

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            +  + +SG+  IG  G    GEI  G LE +NVD++ E T++I  QR +  NS++    
Sbjct: 348 LFTQSNNSGNAQIGAAGTGGRGEISPGKLEMSNVDLSQEFTDMIITQRGFQANSRIITVS 407

Query: 410 SDFMDILISLKR 421
            + +  L++LKR
Sbjct: 408 DEMLQELVNLKR 419


>gi|310659037|ref|YP_003936758.1| flagellar hook protein [Clostridium sticklandii DSM 519]
 gi|308825815|emb|CBH21853.1| flagellar hook protein [Clostridium sticklandii]
          Length = 418

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 100/434 (23%), Positives = 175/434 (40%), Gaps = 31/434 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +A+S +     R+  + +NIANV+T+GYK + + F   +               
Sbjct: 1   MMRSMNSAVSALRNHQLRMDVIGNNIANVNTIGYKSSRVTFKDSLSQMLRGASGPDASRG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIV--KGRDNVNCLTRAGD 107
            T+   V  G+++S+ D +   G    T    D+ + G+GFF+V   G DN    TRAG+
Sbjct: 61  GTNPQQVGLGMDLSSIDTLFTTGVPDRTDRGLDVMVNGEGFFMVSADGTDNGMYYTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F I+ +G L N  G  +LGY   +A           +         +  + TT   +  N
Sbjct: 121 FDIDEDGNLVNADGLRVLGYKTDDAGNVGNEVGGIVVPL----ADSIPPIATTNVVMEGN 176

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LD  A +                  ++     D+LG+S    + +TKT    W V+    
Sbjct: 177 LDARAVLTGS-------TTPPTIERQTEITVNDSLGTSHKIRLEFTKTAANTWNVTPTPI 229

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
               + +                  +    N +                  +D+S  TQ 
Sbjct: 230 TTPPSPAGTPVSIAFEPSTGKLTAASVKTLNMT-----LTPTNGASPVTFDVDLSALTQY 284

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
                      +G   G    +++ + G V+ ++ +G    + ++A +   +   L    
Sbjct: 285 GTDSSALMRSQDGSPVGVLTSYAIGQKGEVEGVFSNGRTKILGQVATSIFANPAGLVKMG 344

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN Y  + +SGD  +  PG   +G +  GALE +NVD+  E T +I  QR +  NS++  
Sbjct: 345 GNLYRSSANSGDPQVNKPGTGGNGGLQPGALEMSNVDLGKEFTNMIVTQRGFQANSRIIS 404

Query: 408 TGSDFMDILISLKR 421
           T    ++ L++LKR
Sbjct: 405 TTDQMLEELVNLKR 418


>gi|294635610|ref|ZP_06714087.1| flagellar hook protein FlgE [Edwardsiella tarda ATCC 23685]
 gi|291091062|gb|EFE23623.1| flagellar hook protein FlgE [Edwardsiella tarda ATCC 23685]
          Length = 411

 Score =  266 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 97/416 (23%), Positives = 181/416 (43%), Gaps = 7/416 (1%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SGM+A S+++  + +NIAN  TVG+K  ++ F+ +       S V  G+ +++ 
Sbjct: 2   GFSQAISGMNAASSQLDVIGNNIANSQTVGFKSGSVTFADMFA----GSKVGLGVTVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
           +   + G+   T    D+AI G+GFF ++  +     TR G F  + +GFL N  G  L 
Sbjct: 58  NQDFKDGTTTTTNRGLDVAISGQGFFRMQDPNGSVYYTRNGQFSKDAKGFLTNAQGMYLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   +  P  +        I +    + A  TT G +  NL+     I    +P    
Sbjct: 118 GYPA--SGTPPTIQQGADPVPIQIPTGLMPAKSTTQGSMVLNLNSANKAIDSKTSPFDPN 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD-QSTNNSFPYNVAPLNT 244
           +   YT+ +S   YD+LG+    ++Y+ K                + +++ P    P + 
Sbjct: 176 KVDTYTYATSMTTYDSLGNVHNMNLYFVKGESTTGAAPETAWHVYAVDSAAPATDKPQDV 235

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FD     +            N +              Q  G         +G+  G
Sbjct: 236 GSLTFDANGNLIKGGKQTINMVASNGAPAQTFTLDFTGTRQQNTGKDGVTSKTQDGYKAG 295

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +   + ++ DG +   Y +  +  + ++ +A   + + L     N +  +  SG   +G 
Sbjct: 296 ELTGYQINDDGTITGSYTNQQKQLLGQIVMANFAAPEGLVSEGNNVWSESAKSGQPIVGT 355

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G +  G + SGA+E +NVD++ +L ++I AQRNY  N++  +T    +  L++L+
Sbjct: 356 SGTSGLGNLTSGAVEASNVDLSKQLVDMIVAQRNYQSNAQTIKTQDQILQTLVNLR 411


>gi|257095359|ref|YP_003169000.1| hypothetical protein CAP2UW1_3821 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047883|gb|ACV37071.1| protein of unknown function DUF1078 domain protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 417

 Score =  266 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 101/418 (24%), Positives = 176/418 (42%), Gaps = 5/418 (1%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S +  +SG+ A +  ++ + +N+AN  TVG+K     F+ +   S      S V  G+ +
Sbjct: 2   SFQQGLSGLSAAATALNVIGNNVANASTVGFKGANAHFADVFASSLGIVGASQVGIGVGV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S+      QG+L  T +  DLA+ G GFF +   D     TR G FHI+ EG++ N    
Sbjct: 62  SSIQQQFTQGNLTTTNNGLDLALNGGGFFRMSD-DGAITYTRNGQFHIDKEGYVINDLNL 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GYP     A    +  +     N      ++ P + G ++  L+ ++    P  TP 
Sbjct: 121 RLTGYPADALGAISPSSPVELQLSANQIPPRATSDPLS-GNLTAVLNLDSRDKVPPITPF 179

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +      Y   ++ + YDTLG +     +Y            +    + + + P  +   
Sbjct: 180 NFANPDTYNFSTATSVYDTLGVAHNLTTFYILNAPTDPPGGEWTVWATLDGADPQVLPGG 239

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           N +  +   +T   A  +    +             +D + TTQ        +    G++
Sbjct: 240 NLIFDTSGALTAASAKQTLPTWALTSGAVTPWSPGLLDYTGTTQYGSESSVDRLTQGGYS 299

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G      V  DG +   Y +G    + ++ +AT    + LK    N +  +  SG   +
Sbjct: 300 AGSLTGMGVGSDGIIQGRYSNGQTRNLGQVVLATFADPNGLKNLGNNQWSSSSASGPELV 359

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             PG    G I S A+E +NVD+  EL ++I AQRNY  N++  +T    +  L++L+
Sbjct: 360 AAPGSGSRGVIQSSAIEDSNVDLTKELVDMITAQRNYQANAQTIKTQDQVLQTLVNLR 417


>gi|312621577|ref|YP_004023190.1| fagellar hook-basal body protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202044|gb|ADQ45371.1| fagellar hook-basal body protein [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 488

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 111/489 (22%), Positives = 186/489 (38%), Gaps = 71/489 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVLKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    L    T       N
Sbjct: 121 FSLDKMGNLVTATGLNVLGWMYDPVNNQIDTTKSPS-KINILAFPTLPPKATDKISFDGN 179

Query: 168 LDKNATIITPDKTPKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           L  +  I +   T   +     A+  + +SF  +D+ G      + + KTGD  WE  + 
Sbjct: 180 LSADTKIYSGQITKFEDLLNVPADSKYSTSFKIFDSQGKEHTLQLTFIKTGDNTWEWFVD 239

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS-------------- 271
                 N     N                   N   +                       
Sbjct: 240 APRVKKNIGTAQNPQEAYVYVDDMIEANNDYDNFIARGTITFGQAGKVLDDENTPDVEGI 299

Query: 272 --------------------------------------GIDQQITIDISKTTQLA-GGFI 292
                                                      I   +   TQ       
Sbjct: 300 AITGGRFINTQDGTFTINFKNSVVNPVTLKVNSSQFDVNDATNIAFFLKNITQFGNMESS 359

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
            + +++ G++ G  + F+V   G +  +Y +G    I ++AIAT  +   L+    N Y+
Sbjct: 360 IRVAQMTGYSAGSLQGFNVDASGKITGVYSNGLNQLIGQIAIATFANPAGLQRIGDNLYI 419

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T +SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N++V     + 
Sbjct: 420 NTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANARVITASDEL 479

Query: 413 MDILISLKR 421
           +  L+++KR
Sbjct: 480 LQDLVNIKR 488


>gi|326204617|ref|ZP_08194473.1| fagellar hook-basal body protein [Clostridium papyrosolvens DSM
           2782]
 gi|325985184|gb|EGD46024.1| fagellar hook-basal body protein [Clostridium papyrosolvens DSM
           2782]
          Length = 443

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 106/446 (23%), Positives = 189/446 (42%), Gaps = 30/446 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + +SG+ A   ++  + +N+ANV+T+G+K   + F  +   +            
Sbjct: 1   MMRSMFSGVSGLKAHQAKMDVIGNNVANVNTLGFKAGRVTFQEIFNQTLRGAGAPDAATA 60

Query: 51  ---TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAG 106
              T+   +  G+ + + D     GS   T + TDL+I G GFFIVKG        TRAG
Sbjct: 61  RGGTNPMQIGLGIAVGSIDNQMTGGSPQRTDNPTDLSISGNGFFIVKGSAADTFKFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLER---------INVKHAELSAM 157
           +F ++  G L +  G  + G+          V                  N     ++A 
Sbjct: 121 NFGLDKLGNLVSGDGMNVYGWTKYEQQGDGTVKFDTEAPIGPINLYSDATNGNKKIIAAK 180

Query: 158 PTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD 217
            TT    S NL+     +           +        +  +D+LG++    + +TK   
Sbjct: 181 ATTYAEFSGNLNSAQKAVATPPATPPASDEQ---FIMPYTVFDSLGNAHEMTLTFTKAAP 237

Query: 218 KKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANS-SHKAISFNDNTSGIDQQ 276
                +          +    V    T  + FD      +++ +   ++           
Sbjct: 238 TGTPPTTTWTYTLAAKAGDGTVPIPTTGTLKFDGEGKLTSDTVNSIKVTMTPTAGANPFD 297

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           +T+D  K TQ +G    + S ING+  G    F++  DG +  +Y +G + P+  +A+A 
Sbjct: 298 VTLDFKKLTQFSGDSSVKPSNINGYTTGNLVTFNIGSDGMITGVYSNGQQQPLGLIALAG 357

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFP-GHNQHGEIFSGALETANVDIASELTELIEA 395
             +   L+   GN ++PT +SGD + G P G    G +  G LE +NVD++ E T++I  
Sbjct: 358 FDNPAGLQKVGGNLFMPTTNSGDFNKGVPAGSQGVGTLSPGTLEMSNVDLSREFTDMIVT 417

Query: 396 QRNYAVNSKVFQTGSDFMDILISLKR 421
           QR +  NS++  T  + +  L++LKR
Sbjct: 418 QRGFQANSRIITTSDEMLQELVNLKR 443


>gi|326319097|ref|YP_004236769.1| fagellar hook-basal body protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375933|gb|ADX48202.1| fagellar hook-basal body protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 425

 Score =  265 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 95/425 (22%), Positives = 170/425 (40%), Gaps = 11/425 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
           S +  +SG++A S  +  +  N+AN  TVG+K +   F+ +V     S   +    G+E+
Sbjct: 2   SFQQGLSGLNAASKNLDVIGHNVANSGTVGFKASRAEFAEMVANAIGSAGGTNAGIGVEL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T ++ D+AI G GFF ++  D     TRAG+F +++ G L      
Sbjct: 62  SAVAQQFNQGNISVTGNSLDVAINGDGFFTLQQPDGSRAYTRAGNFKLDSNGQLVTNTKA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GY L   +     ++   L     K          T   + +            TP 
Sbjct: 122 QVMGYALDPITGKRTASNAAPLSFPTSKPIPAKQTTAITAEFNLDARAPDAAGDATATPP 181

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                   T+ +S   YD+ G +    +Y+ K G   W+V     D +            
Sbjct: 182 VPATPRS-TYGTSINVYDSQGVAKPVSLYFQKNGANTWDVYDKLDDATATPPVVATPIGQ 240

Query: 243 NTVEV-------SFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
              +        +                +  +     D  + I +   +Q    F    
Sbjct: 241 IKFDNSGKIVSPTATAPETGFQMPLTVKPTPPNPNGLADYTVNIKLDGVSQYGKAFAVSN 300

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              +G+  G+    S+  +G V   Y +G      ++A+A+  +   L     N ++ T 
Sbjct: 301 LSQDGYTAGELTGISIENNGTVMTRYSNGVTRAEGQVALASFRNTQGLASVGSNNWVETF 360

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG   +G P   + G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T    M  
Sbjct: 361 ESGQPVLGTPTEGKFGGLRSGALEDSNVDLTAELVNMMTAQRAYQANAQTIKTQDQVMST 420

Query: 416 LISLK 420
           L++L+
Sbjct: 421 LVNLR 425


>gi|312135845|ref|YP_004003183.1| fagellar hook-basal body protein [Caldicellulosiruptor owensensis
           OL]
 gi|311775896|gb|ADQ05383.1| fagellar hook-basal body protein [Caldicellulosiruptor owensensis
           OL]
          Length = 489

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 108/490 (22%), Positives = 185/490 (37%), Gaps = 72/490 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVVKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASADMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRYTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    L    T       N
Sbjct: 121 FSLDRMGNLVTATGLNVLGWMYDPVNNQIDTTKSPS-KINILAFPTLPPKATDKISFDGN 179

Query: 168 LDKNATIITPDKTPKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           L  +    +   T   +     A+  + +SF  YD+ G    + + + KTGD  W   + 
Sbjct: 180 LSADLKTYSGQITKYEDLLNVPADSKYSTSFKIYDSQGKEHTFQLTFVKTGDNTWNWYVD 239

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS-------------- 271
                 N     N                   N                           
Sbjct: 240 APRVKKNVGTAQNPDEKYVYVDEMLDANNDYDNFIATGTIIFGQAGKVFDDENTSDKVEG 299

Query: 272 ---------------------------------------GIDQQITIDISKTTQLA-GGF 291
                                                    +      +   TQ      
Sbjct: 300 ITITGGRIINTADGTFTIKFKNDVVNPITFKVNSAEFDVNDNTNFAFFLKNITQFGNMES 359

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
             + +++ G++ G  + F+V   G +  +Y +G    I ++A+AT  +   L+    N Y
Sbjct: 360 SIRVAQMTGYSAGNLQGFNVDASGKITGVYSNGLNQLIGQIAVATFANPAGLQRIGDNLY 419

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T +SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N++V  +  +
Sbjct: 420 INTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANARVITSSDE 479

Query: 412 FMDILISLKR 421
            +  L+++KR
Sbjct: 480 ILQELVNIKR 489


>gi|91776309|ref|YP_546065.1| flagellar hook protein FlgE [Methylobacillus flagellatus KT]
 gi|91710296|gb|ABE50224.1| protein of unknown function DUF1078-like protein [Methylobacillus
           flagellatus KT]
          Length = 410

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 96/418 (22%), Positives = 181/418 (43%), Gaps = 12/418 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           + +  +SG++A S  +  + +N+AN  TVG+K++   F+ +   S        +  G +I
Sbjct: 2   AFQQGLSGLNAASKNIEVIGNNVANASTVGFKQSRTEFADVYANSLGGGNASKIGIGTKI 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++ ++ +  D+AI G GFF +   +     +R G F ++ +G+++N AG 
Sbjct: 62  AAITQQFTQGNISNSQNPLDVAINGNGFFRMSD-NGAITYSRNGQFQLDKDGYIQNAAGQ 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY L N                 ++       P TT  I+  L+ ++     D    
Sbjct: 121 RLTGYALANGQIQTGA-------LTELRIDAADMPPRTTTSITGPLNLDSRAEILDPANF 173

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                + Y H +    +D+LG+S    +YY K+G      +         ++    + P 
Sbjct: 174 DIDDPSSYNHSTPIEVFDSLGNSHSVQLYYLKSGITT-APNATTTWTVMASANGSQLMPN 232

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
               + FD      A +         +       +T++++ +TQ A  F       +G+ 
Sbjct: 233 PIGTMVFDGSGIDPAITLAPLSIPLSSGGLTPMSVTLNLTGSTQFANTFNESDLGQDGYG 292

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   FS+  DG +   Y +G    + ++A+A   + + L+    N +  T +SG   +
Sbjct: 293 AGRLSSFSIGADGSILGRYSNGRSSVLGQVALANFRNLNGLQPLGDNQWAETSESGPPIV 352

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G       G + S  LE +NVD+ +EL  +I AQR Y  N++  +T    M  L++L+
Sbjct: 353 GVANSGGLGVLQSYRLEDSNVDLTAELVNMITAQRVYQANAQTIKTEDQIMQTLVNLR 410


>gi|120613059|ref|YP_972737.1| hypothetical protein Aave_4423 [Acidovorax citrulli AAC00-1]
 gi|120591523|gb|ABM34963.1| protein of unknown function DUF1078 domain protein [Acidovorax
           citrulli AAC00-1]
          Length = 425

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 104/426 (24%), Positives = 177/426 (41%), Gaps = 13/426 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
           S +  +SG++A S  +  +  N+AN  TVG+K +   F+ +V     S   +    G+E+
Sbjct: 2   SFQQGLSGLNAASKNLDVIGHNVANSGTVGFKASRAEFAEMVANAIGSAGGTNAGIGVEL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T ++ D+AI G GFF ++  D  +  TRAG+F +++ G L      
Sbjct: 62  SAVAQQFNQGNISVTGNSLDVAINGDGFFTLQQPDGSHAYTRAGNFKLDSNGQLVTNTKA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GY L   +     ++   L     K   + A  TTT     NLD  A     D T  
Sbjct: 122 QVMGYALDPITGKRTASNAAPLTFPTSKP--IPAKQTTTITAEFNLDARAPDAAGDATAT 179

Query: 183 HN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                    T+ +S   YD+ G +    +Y+ K G   W+V     D + N         
Sbjct: 180 PPVPATPRSTYGTSINVYDSQGVAKPVSLYFQKNGANTWDVYDRLDDATANPPVVATPIG 239

Query: 242 LNTVEVS-------FDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
               + S                       +  +     D  + I +   +Q    F   
Sbjct: 240 QIKFDNSGKIVSPAATAPETGFQMPLTVKPTPPNPNGLADYTVNIKLDGVSQYGKAFAVS 299

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G+  G+    S+  +G V   Y +G      ++A+A+  +   L     N ++ T
Sbjct: 300 NLSQDGYTAGELTGISIENNGTVMTRYSNGVTRAEGQVALASFRNTQGLASVGNNNWVET 359

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   +G P   + G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T    M 
Sbjct: 360 FQSGQPVLGTPTEGKFGGLRSGALEDSNVDLTAELVNMMTAQRAYQANAQTIKTQDQVMS 419

Query: 415 ILISLK 420
            L++L+
Sbjct: 420 TLVNLR 425


>gi|183220587|ref|YP_001838583.1| flagellar hook protein FlgE [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910695|ref|YP_001962250.1| flagellar hook protein FlgE [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775371|gb|ABZ93672.1| Endoflagellar hook protein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779009|gb|ABZ97307.1| Flagellar hook protein FlgE [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 464

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 109/465 (23%), Positives = 188/465 (40%), Gaps = 47/465 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ S+ + +SG+     R+  + +NI+NV+T G+K   + F  ++               
Sbjct: 1   MMRSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQELQGASEPNERIG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   V  G  I+  D I  QG+L  T  NTDLA+ G+GFF+VK  D     TRAG F+
Sbjct: 61  GTNPKQVGLGSLIAAIDKIMTQGALQTTGKNTDLAVSGEGFFVVKDGD-KQFYTRAGAFN 119

Query: 110 INNEGFLENVAGGVLLGYP---LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
           ++  GF  N A G+ +      L  +    I ++    + +   +++  A  T      +
Sbjct: 120 VDKNGFYVNPANGLKVQGWNSRLDESGNKYINSAGSLEDIVIPLYSKEPARATQNVDFQS 179

Query: 167 NLDKNATIITPDKTP-------KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK 219
           NL+ +   + PD T                  H +S   YD LG++    V + K  +  
Sbjct: 180 NLNASVAAVPPDATEEDIQRYINDPDPRQRRGHVTSINVYDELGNTRQMGVEFYKMRENV 239

Query: 220 WEVSI------FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI 273
           W++                          NT         G + + S    S        
Sbjct: 240 WKMRFKLEDASQVSVDVNGTGGENTSVSGNTELEVSFTPDGKIISVSDGVDSQTTGKLKA 299

Query: 274 DQQITIDIS-----------------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
           D    I  +                   TQ +  F  +  + +G+  G  + FS+   G 
Sbjct: 300 DISFRIPGNPSAQKFSLNLGEAGLVGGITQFSSDFTTKAVKQDGYPMGYMESFSIDNTGT 359

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           V  ++ +G R P+ R+A+A   +   L       Y  + +SG+ +IG  G    G+I +G
Sbjct: 360 VTGVFSNGVRQPLARVALANFTNPAGLNKEGDTMYSFSLNSGEANIGEAGSQGRGKINAG 419

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            LE +NVD++ + T++I  QR +  NS+   T    +  ++ LKR
Sbjct: 420 LLEMSNVDLSDQFTDMIVTQRGFQANSRTIVTSDQMIQEVLGLKR 464


>gi|302338085|ref|YP_003803291.1| fagellar hook-basal body protein [Spirochaeta smaragdinae DSM
           11293]
 gi|301635270|gb|ADK80697.1| fagellar hook-basal body protein [Spirochaeta smaragdinae DSM
           11293]
          Length = 460

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 102/464 (21%), Positives = 195/464 (42%), Gaps = 50/464 (10%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS--------- 54
           + S+   +SG+     R+  + +NI+NV+TVG+K+  + F  L+  + S +         
Sbjct: 1   MRSLYAGVSGLQNHQTRMDVIGNNISNVNTVGFKKGRVNFQDLLSQTMSGAARPTDEVGG 60

Query: 55  ----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHI 110
                V  G+ +++ D +  QGSL  T   TD+AIQG GFFI +  D     TRAG F +
Sbjct: 61  VNPKQVGLGMNVASIDTVHTQGSLQTTGIMTDIAIQGDGFFIERSGD-KEFYTRAGAFGL 119

Query: 111 NNEGFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           +  G L N + G+ +   +         I  +    + +    ++  A  T    ++ NL
Sbjct: 120 DENGTLVNPSNGLRVQGWMAQDVDGRTFINTATDVEDLVIPVGSKDPARATGEVDLACNL 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVSIFR 226
           DK   +I        +   AE T       YD+ G   V  + +T+    + +W+ S+  
Sbjct: 180 DKRTPLIPAGA---GDADVAEGTWSIDKTIYDSFGEEHVLRINFTRVAGTENQWQGSVTV 236

Query: 227 QDQSTNNSFPYNVAPLNTVEVSFDP--------------------VTGYLANSSHKAISF 266
              +   +           + +                         G L  +    ++ 
Sbjct: 237 DPDAEAPTNTLVDIGEANNDTNTFVVEFDNLGTLQAAVDGQGDRIDNGTLQVNVAFDVAG 296

Query: 267 NDNTSGIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYV 317
               +G   +  + ++           TQ A     +  + +G+  G  + F + + G +
Sbjct: 297 ATPEAGAPVRQDMVLNLGDVGSVVDTITQFAEKSSTKAFKQDGYGMGYLESFKIDQSGVI 356

Query: 318 DIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGA 377
             +Y +G    + ++A+A+  +   L+    +T++ + +SG+  IG  G    G++ +GA
Sbjct: 357 TGVYSNGANRTLGQVALASFTNPGGLEKAGESTFVVSNNSGEARIGESGVAGKGKLIAGA 416

Query: 378 LETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           LE +NVD+A + T++I  QR +  NS+   T    +  L++LKR
Sbjct: 417 LEMSNVDLAEQFTDMIVTQRGFQANSRTITTSDQMLQELLTLKR 460


>gi|302389667|ref|YP_003825488.1| fagellar hook-basal body protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200295|gb|ADL07865.1| fagellar hook-basal body protein [Thermosediminibacter oceani DSM
           16646]
          Length = 404

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/432 (25%), Positives = 179/432 (41%), Gaps = 41/432 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + ++G+     ++  + +NIANV+TVGYK++ + F   +  +            
Sbjct: 1   MMRSMFSGVTGLRNHQIKMDVIGNNIANVNTVGYKKSRVTFQDTLSQTMRGASSAQGNRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I+  D I    SL  T + TDLAI+G GFFI+         TRAG+F 
Sbjct: 61  GTNPMQIGLGMTIAAIDTIHTPTSLEATGNMTDLAIEGDGFFILSDGQGY-YYTRAGNFG 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            + +G L N A G  +     ++S                K   + A PT     + NL+
Sbjct: 120 FDEQGNLVNTANGFKVMGWQDSSSKTPQ----DIKPINIQKGMLMPAKPTDIVVFAKNLN 175

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
           K   ++T                   F  YD+LG +    + +T  GD  W+  I     
Sbjct: 176 KADQVVT-----------------IPFKVYDSLGRAHNLTITFTNNGDNTWDYDISFDPT 218

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
             + S   +   L           G L+  S                 T D S  TQ A 
Sbjct: 219 LISVSSGSDTGTL------AFDPNGNLSGGSTINSVTLTIVGANPITFTPDFSNVTQYAK 272

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 S  NG+  G     SV   G +  ++D+G  + + ++A+A   +   L     N
Sbjct: 273 ETTVDLSYQNGYPAGTLLGISVDSTGTITGVFDNGQTMELAQVALAVFNNPAGLMKAGRN 332

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  + +SG+  IG  G    G I  G+LE +NVD+A E T++I  QR +  NS+V    
Sbjct: 333 MYTYSNNSGEPQIGLAGTGGRGTISPGSLEMSNVDLAEEFTQMIITQRGFQANSRVITAS 392

Query: 410 SDFMDILISLKR 421
            + +  L+++KR
Sbjct: 393 DEMLQELVNIKR 404


>gi|222530130|ref|YP_002574012.1| hypothetical protein Athe_2164 [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456977|gb|ACM61239.1| protein of unknown function DUF1078 domain protein
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 488

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/489 (22%), Positives = 186/489 (38%), Gaps = 71/489 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM +++S + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVLKSASAPDTASG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGKAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   +    L    T       N
Sbjct: 121 FSLDKMGNLVTATGLNVLGWMYDPVNNQIDTTKSPS-KINILAFPTLPPKATDKISFDGN 179

Query: 168 LDKNATIITPDKTPKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           L  +  I +   T   +     A+  + +SF  +D+ G      + + KTGD  WE  + 
Sbjct: 180 LSADTKIYSGQITKFEDLLNVPADSKYSTSFKIFDSQGKEHTLQLTFIKTGDNTWEWFVD 239

Query: 226 RQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS-------------- 271
                 N     N                   N   +                       
Sbjct: 240 APRVKKNIGTAQNPQEAYVYVDDMIEANNDYDNFIARGTITFGQAGKVLDDENTPDVEGI 299

Query: 272 --------------------------------------GIDQQITIDISKTTQLA-GGFI 292
                                                      I   +   TQ       
Sbjct: 300 AITGGRFINTQNGTFTINFKNNVVNPVTLKVNSSQFDVNDATNIAFFLKNITQFGNMESS 359

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
            + +++ G++ G  + F+V   G +  +Y +G    I ++AIAT  +   L+    N Y+
Sbjct: 360 IRVAQMTGYSAGSLQGFNVDASGKITGVYSNGLNQLIGQIAIATFANPAGLQRIGDNLYI 419

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T +SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N++V     + 
Sbjct: 420 NTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANARVITASDEL 479

Query: 413 MDILISLKR 421
           +  L+++KR
Sbjct: 480 LQDLVNIKR 488


>gi|269976274|ref|ZP_06183270.1| flagellar hook protein FlgE [Mobiluncus mulieris 28-1]
 gi|269935603|gb|EEZ92141.1| flagellar hook protein FlgE [Mobiluncus mulieris 28-1]
          Length = 472

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 100/475 (21%), Positives = 175/475 (36%), Gaps = 59/475 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ T +SG+      +   S+NIANV+T G+K  +  F                   
Sbjct: 1   MLRSLFTGISGLSVHQTMLDVTSNNIANVNTTGFKSASTRFEDTFSQLVKSGAAPRLNER 60

Query: 50  -STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
              + + V  G+++ +       G+  +T  N D  I G GFF++K  +     TR G F
Sbjct: 61  GGMNPAQVGLGVKLQSITNNFTGGAAQNTGRNLDTMINGDGFFVLKKTNGTQVYTRNGSF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            ++ +G +    G  + G+              Q L           A PT       NL
Sbjct: 121 GLDAQGQVVAADGSFVQGWMADKKGKISASGQTQNLVLP--LTQTFEANPTKKITYGGNL 178

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY---------------- 212
             +   I P    + +  D  +    +   YD  G      + +                
Sbjct: 179 PADKVWIDPSPNKRAD-EDNAFMVTQTLTVYDDKGDPHNVLLKFERSDSKAPGVKPKWKV 237

Query: 213 -----------TKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSS- 260
                      TK  ++  E++     +       YN     + E+ F+       ++  
Sbjct: 238 MAYDAEAYKHLTKKAERDTEITAGDDQKGAAYKLKYNGKEATSFEIEFETDGTLKEDTKK 297

Query: 261 --------------HKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKP 306
                                         IT+D+S  T  AG    Q   I+G++ G  
Sbjct: 298 LLKNVEFKVMQAKVTADKKLAVKDGVAANPITMDLSALTGYAGVNSAQYETIDGNSAGTL 357

Query: 307 KDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPG 366
             F V  DG +   + +G    + ++A A+  +   L+    + ++ + +SG   IG PG
Sbjct: 358 TGFGVEADGTIRGTFSNGDTRALAKIATASFSNPLGLEKAGASYFVESGNSGQPQIGEPG 417

Query: 367 HNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
               G +  GA+E +NVD+A+E T LI +QR +  N++V  T  + +  L+S+KR
Sbjct: 418 SGTRGAMTGGAIEMSNVDLAAEFTNLILSQRGFQANTRVITTSDEILQELVSMKR 472


>gi|225849153|ref|YP_002729317.1| flagellar hook protein FlgE [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643172|gb|ACN98222.1| flagellar hook protein FlgE [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 409

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 117/427 (27%), Positives = 184/427 (43%), Gaps = 26/427 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--------PSTSNS 54
           +L S  TA+SG++     +  +SDNIANV+T+G+K   + F  LV          +  N 
Sbjct: 1   MLQSFYTAVSGLNGNQKWIDVISDNIANVNTIGFKSERVTFEDLVAKSLTTFANNTPKNM 60

Query: 55  YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEG 114
            + GG  I+       QGS  +T +  DLA+ G+GFF+VK        TRAG F ++  G
Sbjct: 61  EIGGGSFIALTTKDFSQGSFQNTVNPLDLALDGEGFFMVKDNQGTVYYTRAGQFRLDANG 120

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
            + NV G  L G+ L  A           +    +              + + ++  +  
Sbjct: 121 DIVNVDGMKLQGWKLDTAGNISAALDKINIPYSILPSITTKINLVEPTNLDSRVNTISGT 180

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
                        A + + +S   YD+LG+      Y+ K+    W V+ +  + +T   
Sbjct: 181 -------IDPTNPATFNYANSMTIYDSLGNPHTLTFYFQKSSPNTWNVAAYVDNNTTTPV 233

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
                       + FD     ++ S         N +   Q +T+D+++  Q+A  FI  
Sbjct: 234 GSGT--------LQFDSTGKLISGSPITLSIPLTNGATTPQTVTVDLTQVKQVASDFIFY 285

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G A G     SVS+DG V  +Y +G    I RLA+AT   ++ L     N YLP 
Sbjct: 286 A-NQDGFAKGDLIGVSVSEDGVVRGMYSNGKVELIARLAVATFKDKEMLVRKGNNLYLPN 344

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             S    I  PG     ++ SG LE +NVDI+ E   LI AQR Y  N++V  T    + 
Sbjct: 345 TQSFTPII-TPG-GILSKVRSGFLELSNVDISKEFINLITAQRAYQANARVITTDDQILQ 402

Query: 415 ILISLKR 421
             +++KR
Sbjct: 403 EAMNIKR 409


>gi|13472592|ref|NP_104159.1| flagellar hook protein FlgE [Mesorhizobium loti MAFF303099]
 gi|14023338|dbj|BAB49945.1| flagellar hook protein; FlgE [Mesorhizobium loti MAFF303099]
          Length = 418

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 181/422 (42%), Positives = 250/422 (59%), Gaps = 5/422 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S  +DNIAN DT GYKR++  FS+L+ PST  +Y SGG+
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTTADNIANSDTTGYKRSSAEFSTLIMPSTGGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + +  +S+ G L +T S +DLA+ G GFF+V+       LTRAG F  + +G L N A
Sbjct: 61  TTTIRQAVSDPGVLQYTTSVSDLAVSGDGFFVVQDPSGTPFLTRAGAFVPDAQGRLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+ Y   N +    VN F+GL+ + +    L+A P+T G  S NL   AT +     
Sbjct: 121 GFQLMAYSYANGTPAATVNGFEGLQPVVISDQGLTATPSTLGTYSGNLPAGATPVAAANL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ-DQSTNNSFPYNV 239
           P  N   A+YT KSS  AYD LG+  + DVY+T TG   W+V++F Q   +   SFPY  
Sbjct: 181 PGANASTAQYTSKSSMVAYDNLGNKKLLDVYFTNTGTGTWQVAVFDQSKATPGTSFPYTG 240

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
             L T  ++FD  TG L  +           + ++    +D+SK TQL  GF    +++N
Sbjct: 241 GALGTANLTFDTTTGKLTGAPTSVSFTVPGGASLN----LDLSKLTQLGTGFTVSDAQVN 296

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP       +SKDG +   Y DG+  P+Y++ +A V S D LK   GN Y    DSG 
Sbjct: 297 GNAPSTIDKVQISKDGTIYAQYKDGSTKPLYKIPLADVQSPDQLKALPGNVYAQGTDSGA 356

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I +GF    + G I SGALE +NVDIA ELT++I AQR+Y  NSKVFQTGSD MD+L++L
Sbjct: 357 IRVGFANEGKAGSIISGALENSNVDIAEELTDMIAAQRSYTANSKVFQTGSDLMDVLVNL 416

Query: 420 KR 421
           KR
Sbjct: 417 KR 418


>gi|253998488|ref|YP_003050551.1| flagellar hook protein FlgE [Methylovorus sp. SIP3-4]
 gi|253985167|gb|ACT50024.1| flagellar basal body FlaE domain protein [Methylovorus sp. SIP3-4]
          Length = 402

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 97/418 (23%), Positives = 176/418 (42%), Gaps = 20/418 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---GLEI 62
           S +  +SG++A S  +  + +N+AN +TVG+K++   F+ +   + + S       G+++
Sbjct: 2   SFQQGLSGLNAASKSLDVIGNNVANANTVGFKQSRAEFADVYANALNGSGTGSAGIGVKV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++ +T +  D+AI G GFF +         +R G F ++  G++   +G 
Sbjct: 62  ADIQRQFTQGNITNTENPLDIAINGNGFFRL-SNSGAITYSRNGQFQLDKAGYIVTSSGE 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY   +  A         L  I +  A+L+   +T      NLD  + ++       
Sbjct: 121 HLTGYVADSNGALQT----GALTDIKINSADLAPQASTKVSDVFNLDSRSAVLP--IASF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                  YT     + YD+ G+      Y  KT    W+V                    
Sbjct: 175 DPADPTTYTQVVPISVYDSQGNPHTLQSYLIKTAANTWDVRTTVD----------GGTTA 224

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
                      G L  ++ + ++    T    Q IT+D + +TQ    +       +G+A
Sbjct: 225 VGSSQLTFDTNGLLTGTTTQTVTLAPPTVPAAQSITVDFASSTQFGSDYSLNSQVQDGYA 284

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   FS + DG +   Y +G    + ++ +A   + + L     N +  T D+G   I
Sbjct: 285 SGRLSSFSTAADGTIIGRYTNGQAKALAQVVLAKFANPNGLAALGNNQFAETSDAGVPVI 344

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G  G    G + S A E +NVD+ +EL  +I AQR Y  N++  +T    +  L++L+
Sbjct: 345 GKAGTGGLGVLQSSATEDSNVDLTAELVNMITAQRYYQANAQTIKTQDQVLQTLVNLR 402


>gi|220929459|ref|YP_002506368.1| hypothetical protein Ccel_2042 [Clostridium cellulolyticum H10]
 gi|219999787|gb|ACL76388.1| protein of unknown function DUF1078 domain protein [Clostridium
           cellulolyticum H10]
          Length = 454

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 107/454 (23%), Positives = 194/454 (42%), Gaps = 35/454 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + +SG+ A   ++  + +N+ANV+T+G+K   + F  +   +            
Sbjct: 1   MMRSMFSGVSGLKAHQAKMDVIGNNVANVNTLGFKAGRVTFQEIFNQTLRGAGAPDAATA 60

Query: 51  ---TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR-DNVNCLTRAG 106
              T+   +  G+ + + D     GS   T + TDL+I G GFFIVKG   +    TRAG
Sbjct: 61  RGGTNPMQIGLGIAVGSIDNQMTGGSPQRTDNPTDLSISGDGFFIVKGSIADTFKFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSF--QGLERINVKHAELSAMPTTTGFI 164
           +F ++  G L +  G  + G+   +      V       +  IN+     +         
Sbjct: 121 NFGLDKLGNLVSGDGMNVYGWTKYDTLGDGTVKFDTEAEITPINLYSDVTNGNKKIIAAK 180

Query: 165 SNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY----------TK 214
           + +  + +  +        +  D++      F  YD+LG++    V +           K
Sbjct: 181 ATSYAEFSGNLNSALPILADPDDSDPQFTVPFTIYDSLGNAHELMVNFKKTDDLTDIPVK 240

Query: 215 TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKA------ISFND 268
             D         +   T +    N    +  +V+F+     +   +              
Sbjct: 241 LPDGTDGTEPGTEWTYTISDKAGNSVLTDAGKVNFNSKGKLVLGDNDAPEQRIMEFDPGQ 300

Query: 269 NTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVP 328
           N+      IT+D  K TQ AG    + S I+G+  G    F++  DG +  +Y +G + P
Sbjct: 301 NSGTGKINITLDFKKLTQYAGDNSVKPSNIDGYTTGNLVTFNIGSDGMLTGVYSNGQQQP 360

Query: 329 IYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP-GHNQHGEIFSGALETANVDIAS 387
           +  +A+A   +   L+   GN ++PT +SGD + G P G    G +  G LE +NVD++ 
Sbjct: 361 LGLIALAGFDNPAGLQKVGGNLFIPTTNSGDFTKGVPAGSQGVGTLSPGTLEMSNVDLSR 420

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           E T++I  QR +  NS++  T  + +  L++LKR
Sbjct: 421 EFTDMIVTQRGFQANSRIITTSDEMLQELVNLKR 454


>gi|160896079|ref|YP_001561661.1| flagellar basal body FlaE domain-containing protein [Delftia
           acidovorans SPH-1]
 gi|160361663|gb|ABX33276.1| flagellar basal body FlaE domain protein [Delftia acidovorans
           SPH-1]
          Length = 423

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 178/423 (42%), Gaps = 9/423 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
             +  +SG++A S  +  +  NIAN +T G+K +   F+  V     S S      G+ +
Sbjct: 2   GFQQGLSGLNAASKNLDVIGHNIANANTTGFKSSRAEFAEAVASAVGSASGQNSGIGVNV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG +  T +N D+AI G GFF+V+  D     TRAG+F ++ +G L+ V G 
Sbjct: 62  AAVTQQFRQGPITTTGNNLDVAINGNGFFVVRQPDGSTAYTRAGNFGLDKQGNLKTVQGD 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GYP+   +  ++                ++A  TT   +S NLD  AT    + T  
Sbjct: 122 NVMGYPVDATTGKVLAGGQPVPMVFPSGQP-IAAKTTTKIDVSLNLDARATPAAGNSTAT 180

Query: 183 HN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQDQSTNNSFPYNVA 240
                    T+ +S   YD+ G      +Y+ K      W+V     D + +      + 
Sbjct: 181 PPVPATPRATYGTSINVYDSQGVPTPVQMYFEKDAASNTWKVYDGLDDPTASPPKVATLL 240

Query: 241 PLNTVEVSFDPVTGYLANS---SHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
                + S    +G    +   S    +    T      +T+D S  +Q    F     +
Sbjct: 241 TTLVFDASGKITSGSPVTAQIKSSNPNAPTPGTINGTAGVTLDFSNVSQFGSKFAVSSLK 300

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+  G     +V  DG +   Y +G      +LA+A   +   L     N ++ T DS
Sbjct: 301 QDGYTAGALTGINVGNDGSIVATYSNGVTRTEGQLALAAFTNTQGLGAVGDNKWVETSDS 360

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G    G       G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T       L+
Sbjct: 361 GPALNGTAESGTFGSLRSGALEDSNVDLTAELVNMMTAQRAYQANAQTIKTQDQVFSTLV 420

Query: 418 SLK 420
           +L+
Sbjct: 421 NLR 423


>gi|313200563|ref|YP_004039221.1| flagellar basal body flae domain-containing protein [Methylovorus
           sp. MP688]
 gi|312439879|gb|ADQ83985.1| flagellar basal body FlaE domain protein [Methylovorus sp. MP688]
          Length = 402

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 99/418 (23%), Positives = 176/418 (42%), Gaps = 20/418 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSG---GLEI 62
           S +  +SG++A S  +  + +N+AN +TVG+K++   F+ +   + + S       G+++
Sbjct: 2   SFQQGLSGLNAASKSLDVIGNNVANANTVGFKQSRAEFADVYANALNGSGTGSAGIGVKV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++ +T +  D+AI G GFF +         +R G F ++  G++   +G 
Sbjct: 62  ADIQRQFTQGNITNTENPLDIAINGNGFFRL-SNSGAITYSRNGQFQLDKAGYIVTSSGE 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY      A         L  I +  A+L+   +T      NLD  + ++       
Sbjct: 121 RLTGYVADTNGALQT----GALTDIKISSADLAPQASTKVNDVFNLDSRSAVLP--IASF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +      YT     + YD+ G+      Y  KT    W V                    
Sbjct: 175 NPADPTTYTQVVPISVYDSQGNPHTLQSYLIKTAANTWSVRTTVD----------GGTTA 224

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
                      G L  ++ +A++    T    Q ITID + +TQ    +       +G+A
Sbjct: 225 VGSSTLTFDTNGLLTGTTTQAVTLAPPTVPASQAITIDFASSTQFGSDYSLNSQVQDGYA 284

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   FS + DG +   Y +G    + ++ +A   + + L     N +  T D+G   I
Sbjct: 285 SGRLSSFSTAADGTIIGRYTNGQAKALAQVVLAKFANPNGLSALGNNQFAETADAGVPVI 344

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G  G    G + S A E +NVD+ +EL  +I AQR Y  N++  +T    +  L++L+
Sbjct: 345 GKAGTGGLGTLQSSATEDSNVDLTAELVNMITAQRYYQANAQTIKTQDQVLQTLVNLR 402


>gi|303240279|ref|ZP_07326798.1| fagellar hook-basal body protein [Acetivibrio cellulolyticus CD2]
 gi|302592189|gb|EFL61918.1| fagellar hook-basal body protein [Acetivibrio cellulolyticus CD2]
          Length = 439

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 101/439 (23%), Positives = 184/439 (41%), Gaps = 20/439 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM + +SG+ A   ++  + +N+ANV+TV YK   + F  +   +            
Sbjct: 1   MMRSMFSGVSGLRAHQTKMDVIGNNVANVNTVAYKSGRVTFQEVFSQTIKGAGAPDTATG 60

Query: 51  ---TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC-LTRAG 106
              T+   V  G+ +S+ D I+ +GSL  T + TDLAI+G GFFIVKG        TRAG
Sbjct: 61  RGGTNPMQVGLGIGVSSVDTITTRGSLQRTDNPTDLAIEGDGFFIVKGGSADTYRFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
           +F I+  G L   +G  + G+           N         +               + 
Sbjct: 121 NFGIDKTGNLVTGSGMNVYGWQAYTRETDGTYNYDTENPIEPINLYSDIPNKNKRMIAAK 180

Query: 167 NLDKN---ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS 223
               +     +    ++                  YD+LG+S   +V   K         
Sbjct: 181 ATTSSVFAGNLDASYESLGSGASAGNVQFSVPMTVYDSLGNSYSINVDLWKISVGSSGSE 240

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                 + + S   + +   + +     +    + +   +I   ++       +  D SK
Sbjct: 241 WNWAIDTGSGSTASSASGTISFDSEGQIIASGTSVNPAISIIPPESVGSEPIDVLFDFSK 300

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T  +     + + ++G++ G    FS+  DG +  IY +G + P+  +A+A+  +   L
Sbjct: 301 LTMYSADSSAKPTSVDGYSTGTLVSFSIGSDGIITGIYSNGQQQPLGLIALASFENPAGL 360

Query: 344 KLFDGNTYLPTRDSGDISIGF-PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           +    N ++PT +SGD   G   G    G +  G LE +NVD+++E T++I  QR +  N
Sbjct: 361 QKSGNNMFIPTTNSGDFKKGVKAGSEGVGTLNPGTLEMSNVDLSTEFTDMIVTQRGFQAN 420

Query: 403 SKVFQTGSDFMDILISLKR 421
           S++  T  + +  L++LKR
Sbjct: 421 SRIITTSDEMLQELVNLKR 439


>gi|289578425|ref|YP_003477052.1| fagellar hook-basal body protein [Thermoanaerobacter italicus Ab9]
 gi|289528138|gb|ADD02490.1| fagellar hook-basal body protein [Thermoanaerobacter italicus Ab9]
          Length = 413

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 105/432 (24%), Positives = 189/432 (43%), Gaps = 32/432 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SNGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +++G L    G  +LG+        +  ++   +       + ++   TT   I  NL+
Sbjct: 120 FDSQGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISIKNWSSIAPAATTQLEIGGNLN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S +  + +T+T    W+ S+   D 
Sbjct: 179 ASTEINGSI--------------SYNILVYDSQGGSHIATLTFTRTDASTWDWSVSSSDP 224

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           + ++          T            A  +       + T+     + +D+S+ T  + 
Sbjct: 225 AISSVDGSGT---LTFGADGKIAPNTTATGTLTFNMNTNETNATIGPVQLDLSQLTMFSS 281

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               ++   NG+  G  +  ++ K G V  IY +G +  I ++AIA   +   L+     
Sbjct: 282 ETDLRELSKNGNEAGSLESINIDKYGVVSGIYSNGRKQIIGQIAIADFQNPMGLEKVGNT 341

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            ++ T +SG+  IG  G    G I  G LE +NVD+A+E  ++I  QR +  N+K+    
Sbjct: 342 MFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLANEFADMIVTQRGFQANAKIITAS 401

Query: 410 SDFMDILISLKR 421
            + +  L+++KR
Sbjct: 402 DEMLQDLVNMKR 413


>gi|261344142|ref|ZP_05971786.1| flagellar hook protein FlgE [Providencia rustigianii DSM 4541]
 gi|282567734|gb|EFB73269.1| flagellar hook protein FlgE [Providencia rustigianii DSM 4541]
          Length = 422

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 100/425 (23%), Positives = 187/425 (44%), Gaps = 14/425 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S  + ++ +NIAN  T G+K    +F+ +       S V  G+ ++  
Sbjct: 2   SFSQAVSGLNAASAGLDSIGNNIANSATNGFKGATTSFADMFA----GSGVGLGVNVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G +  T   TD+AI G GFF V+ ++     +R G F  +  G L N  G V+ 
Sbjct: 58  TQNFKDGPITRTDRATDVAISGNGFFRVEDQNGDVFYSRDGQFQRDKSGNLVNNQGMVVT 117

Query: 126 GYPLKNA-SAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP        + + S      +N+    + A  +    ++ NL+    I        + 
Sbjct: 118 GYPASVDAKGNVSIQSGGVPAGMNIPTDMMDAKKSELAKLTINLNSEDKIKEKAFDVNNP 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN--------SFP 236
              A Y   ++  +YD+ G++    VY+ K  + +W+V     +++           + P
Sbjct: 178 DDIATYNFSTTMTSYDSQGNTHEISVYFVKGANNEWKVYAKDANETKATQLINTEEPTDP 237

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG-FIPQK 295
            +   ++   V            +     +       D  + ID++KT Q          
Sbjct: 238 ADPVIVHDRLVFDGNGRLQAPTDAIFDFDYKGLNGANDGVLKIDLNKTRQQKVSESSVSA 297

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
            ++NG+  G+   F +  +G V   Y +  +  + ++A++   + + L    GN +  + 
Sbjct: 298 IDVNGYPAGEYTTFKIEDNGLVVANYSNQQKRVVGQIALSAFANPNGLVSQGGNVWASSN 357

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG+   G PG  Q G++ SGALE++NVD++ EL  +I  QRNY  N++  +T    +  
Sbjct: 358 ASGNPMDGVPGVGQFGKLTSGALESSNVDMSQELISMIVMQRNYQSNAQTIKTQDQMLQT 417

Query: 416 LISLK 420
           L++L+
Sbjct: 418 LVNLR 422


>gi|319944135|ref|ZP_08018413.1| flagellar hook protein FlgE [Lautropia mirabilis ATCC 51599]
 gi|319742629|gb|EFV95038.1| flagellar hook protein FlgE [Lautropia mirabilis ATCC 51599]
          Length = 417

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 112/423 (26%), Positives = 189/423 (44%), Gaps = 15/423 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           + +  +SG++A +  +  +  N+AN  TVG+K +   F+ +   +    SN     G E+
Sbjct: 2   AFQQGLSGLNAAARHLDTIGHNVANASTVGFKASRAEFADVYATTVYGVSNVSPGIGTEV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                   QG+L  T ++ DL I G GFF +         TR G F ++  G++ N +G 
Sbjct: 62  GAIAQQFSQGALTTTNNSLDLGINGGGFFRMSDNGGAITYTREGQFKLDKSGYIVNASGK 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GYP+        V +    + + +   +++   TT+  +  N+D  AT      T  
Sbjct: 122 RLTGYPVDKNG----VVTNGTAQDLKLDSTDIAPKQTTSAAVRVNVDARATTPANAFTL- 176

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                  Y   +S + +D+LG   V  +Y+ KTGD  W+V      +  N          
Sbjct: 177 --TDAKTYDGGTSVSVFDSLGREHVMAMYFRKTGDNSWDVHGTLDGEPLNGGAAVGKLAF 234

Query: 243 NTVEVSFDPVTGYLANSSHKAISFND-----NTSGIDQQITIDISKTTQLAGGFIPQKSE 297
           N          G    ++   ++F+        +G +  ++++ + TTQ    F     E
Sbjct: 235 NPNGTLKGASDGNGDPTTSNVMTFDVSLNMGADAGGNHTVSVNFADTTQFGTNFTVAHQE 294

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            NG+  GK   FSV +DG +   Y +G  V   R+A+A   +   L+   GN +  T DS
Sbjct: 295 QNGNGSGKLAGFSVGRDGSLMARYTNGQTVSKGRVALANFTNPQGLQPLGGNQWGETADS 354

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G   +G P     G I SGALE++NVD+  EL  +I AQR Y  N++  +T    +  ++
Sbjct: 355 GAPLVGSPSTGTLGVIQSGALESSNVDLTQELVNMITAQRVYQANAQTVRTHDQLLQTIV 414

Query: 418 SLK 420
           +L+
Sbjct: 415 NLR 417


>gi|319781665|ref|YP_004141141.1| flagellar hook-basal body protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167553|gb|ADV11091.1| flagellar hook-basal body protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 419

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 175/423 (41%), Positives = 248/423 (58%), Gaps = 6/423 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN DT GYKR++  FS+LV PST  +Y SGG+
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANSDTTGYKRSSAEFSTLVMPSTGGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + +  +S+ G L +T S +DLA+ G GFF+V+       LTRAG F  + +G L N A
Sbjct: 61  TTTIRQAVSDPGVLQYTTSVSDLAVSGDGFFVVQDPSGTPYLTRAGAFVPDGQGRLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+ Y  +N      VN F+GL  + +    ++A P+T G  + NL   AT +     
Sbjct: 121 GFQLMAYSYENGVPAATVNGFEGLVPVVISDQGMTATPSTEGSFAGNLPAGATPVATANL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF--PYN 238
           P  N   A+YT KSS  AYD LG+  + DVY+T TG   W+V++F Q ++T  +      
Sbjct: 181 PAANAATAQYTSKSSMVAYDNLGNKKLLDVYFTNTGAGTWQVAVFDQSKATAGTSFPYTA 240

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L +  ++FD  TG L  +         N + ++    +D+S  TQL  GF    +++
Sbjct: 241 GGLLGSANLTFDTTTGKLTGTPTNVSFTVPNGATLN----LDLSALTQLGTGFTVSDAQV 296

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+AP       +SKDG +   Y DG+  P+Y++ +A V S D LK   GN Y    +SG
Sbjct: 297 NGNAPSTIDKVQISKDGTIYAQYKDGSTKPLYKIPLADVQSPDQLKALPGNVYSQGTESG 356

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
            + +GF    + G I SGALE +NVDIA ELT +I AQR+Y  NSKVFQTGSD MD+L++
Sbjct: 357 AVRVGFANEGKLGSIISGALENSNVDIAEELTNMIAAQRSYTANSKVFQTGSDLMDVLVN 416

Query: 419 LKR 421
           LKR
Sbjct: 417 LKR 419


>gi|328545491|ref|YP_004305600.1| flagellar basal body FlaE [polymorphum gilvum SL003B-26A1]
 gi|326415232|gb|ADZ72295.1| Flagellar basal body FlaE [Polymorphum gilvum SL003B-26A1]
          Length = 424

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 167/427 (39%), Positives = 248/427 (58%), Gaps = 9/427 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQS+++  V+DNIAN  T GYKR A  FSS++    + +Y SGG+
Sbjct: 1   MSLYGVMRTGVSGMNAQSSKLGTVADNIANSSTTGYKRAASEFSSMILSQGTGTYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +  T   IS+QG++ +T S  DLAI G GFF+V  R+    LTRAG F ++++G+L N A
Sbjct: 61  KAHTVYAISQQGAISYTTSGLDLAIDGNGFFVVADREGSTALTRAGSFVVDSKGYLVNTA 120

Query: 121 GGVLLGYPL-KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L GYP+    +   + N   GLE +NV  ++L A+PT +  +  N+ ++A I+    
Sbjct: 121 GYYLQGYPIGNGGTVAPVANGLGGLENVNVSQSKLEAVPTDSALLWANVPEDAAIVAAAD 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK----KWEVSIFR-QDQSTNNS 234
            P  N   A Y+ K+S   YD LG++V  D+YY+K  +      WEV+I+   D +    
Sbjct: 181 LPSANAATATYSAKTSLIVYDNLGNAVTLDIYYSKATETAADSDWEVTIYNADDAAPGGG 240

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
           FPY    L T  ++FD  TG LA +S   I+             +D+S  T L   F   
Sbjct: 241 FPYGAPALATQTITFDRTTGNLAAASPTDITVAVPNGST---FDLDMSGMTYLNADFTIT 297

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
           + + NG+AP   +    + DG +  +Y +G R  +YR+ +A VPS D L    GN Y  +
Sbjct: 298 EVDANGNAPSAVESVEFADDGTLFAVYANGDRRALYRIPLADVPSPDKLTPLSGNIYTVS 357

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SG++ +GFPG    G +  GALE++NVD+ASELT +IE+QR Y  NSKVF+ GSD ++
Sbjct: 358 NNSGEVRVGFPGEGGLGSLTVGALESSNVDLASELTSMIESQRGYTANSKVFKAGSDLLE 417

Query: 415 ILISLKR 421
            L++L R
Sbjct: 418 ELVNLVR 424


>gi|332525066|ref|ZP_08401246.1| flagellar basal body and hook protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332108355|gb|EGJ09579.1| flagellar basal body and hook protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 432

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 105/435 (24%), Positives = 180/435 (41%), Gaps = 24/435 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +  +SG++A S  +  + +NIAN +T G K +   FS +   + + +    V  G+ +
Sbjct: 2   SFQQGLSGLNATSKSLDVIGNNIANANTYGAKVSRAEFSDMYATALNGAGVNNVGIGVTL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                   QG++  T +  D+AI G GFF V    +    TR G F ++ EG++ N    
Sbjct: 62  GAVSQQFTQGNISTTGNAMDMAINGAGFFQVTDGVSPTVYTRNGQFKVDREGYIVNNEKL 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT-- 180
            L+GYP                + + +  A ++   T+   +  NL  ++ +  P  T  
Sbjct: 122 KLMGYPADGTGTI----QPGLAQPLKLPTAGIAPSATSKIELEFNLKADSVVTAPAATAT 177

Query: 181 -PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
                   + Y + +S  AYD+ G  V    Y+ K  + KW V +    Q  N     N 
Sbjct: 178 PQIDFTDKSTYNNATSVVAYDSKGQDVALSYYFQKESNDKWNVYVTANGQPVNVDAAGNP 237

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNT--------------SGIDQQITIDISKTT 285
               T+E           + +        N                 +   ++++++  T
Sbjct: 238 VKWQTLEFDNTTGRLASPDPADALALSITNDLIITDPVTGRETSRIVVPLNMSVNVASAT 297

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q    F       NG+A G+    ++  DG V   Y +G   P  +L +A   +   L+ 
Sbjct: 298 QYDQTFGVTNLTQNGYAAGQLTSIAIEADGIVLARYSNGQSKPAGQLELANFRNPQGLQP 357

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
             GN +  T  SGD  +G P     G I +GALE +N+D+  EL  +I AQR Y  N++ 
Sbjct: 358 LGGNVWASTYASGDAVVGVPSEGNMGVIQAGALEESNIDLTGELVNMITAQRIYQANAQT 417

Query: 406 FQTGSDFMDILISLK 420
            +T    M  L++++
Sbjct: 418 IKTQDQVMQTLVNMR 432


>gi|260466603|ref|ZP_05812791.1| flagellar basal body FlaE domain protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259029609|gb|EEW30897.1| flagellar basal body FlaE domain protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 418

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 181/422 (42%), Positives = 251/422 (59%), Gaps = 5/422 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S  +DNIAN DT GYKR++  FS+L+ PST  +Y SGG+
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTTADNIANSDTTGYKRSSAEFSTLIMPSTGGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             + +  +S+ G L +T S +DLA+ G GFF+V+       LTRAG F  + +G L N A
Sbjct: 61  TTTIRQAVSDPGVLQYTTSVSDLAVSGDGFFVVQDPSGTPYLTRAGAFVPDAQGRLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+ Y   N +    VN F+GLE + +    L+A P+T G  S NL   AT +     
Sbjct: 121 GFQLMAYSYANGTPAATVNGFEGLEPVVIADQGLTATPSTAGSFSGNLPAGATAVATANL 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS-FPYNV 239
           P  N   A+YT KSS  AYD LG+  + DVY+T TG   W+V++F Q ++T  + FPY  
Sbjct: 181 PGANAATAQYTSKSSMVAYDNLGNKKLLDVYFTNTGTGTWQVAVFDQSKATAGTSFPYTG 240

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
             L T  ++FD  TG L  +           + ++    +D+S  TQL  GF    +++N
Sbjct: 241 GALGTANLTFDTTTGKLTGTPTSVSFTVPGGASLN----LDLSTLTQLGTGFTVSDAQVN 296

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP       +SKDG +   Y DGT  P+Y++ +A V S D LK   GN Y    DSG 
Sbjct: 297 GNAPSAIDKVQISKDGTIYAQYKDGTSKPLYKIPLADVQSPDQLKALPGNVYAQGTDSGA 356

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           + +GF    + G I SGALE +NVDIA ELT++I AQR+Y  NSKVFQTGSD MD+L++L
Sbjct: 357 VRVGFANEGKAGSIISGALENSNVDIAEELTDMIAAQRSYTANSKVFQTGSDLMDVLVNL 416

Query: 420 KR 421
           KR
Sbjct: 417 KR 418


>gi|77918787|ref|YP_356602.1| flagellar biosynthesis, hook protein [Pelobacter carbinolicus DSM
           2380]
 gi|77544870|gb|ABA88432.1| flagellar biosynthesis, hook protein [Pelobacter carbinolicus DSM
           2380]
          Length = 413

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 120/426 (28%), Positives = 194/426 (45%), Gaps = 18/426 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YV 56
           M +  ++ + +SGM+     +S + +NIAN +TVG+K +   FS L+  S + S     V
Sbjct: 1   MALSSALYSGISGMNTNGTAMSVIGNNIANTNTVGFKSSRTVFSDLLASSVNGSGGASQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFHINNEGF 115
             G  +ST D +  QG+   T S TDLAI+G+G F+V+     +   TRAG F  + EGF
Sbjct: 61  GRGTGLSTVDNLFSQGTFETTESQTDLAIEGEGLFVVREEGAESLYYTRAGSFSFDGEGF 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L N  G  +            +++S    + +   +A + A  T    +S NLD N  +I
Sbjct: 121 LTNAEGYRVQ----GKTYVNGVLSSADATDIMVDINAGIEAKMTDKITLSTNLDANEPVI 176

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
           T             Y + +S   YD+LG++ +   Y+ K+ D  W+ ++  ++ +T  S 
Sbjct: 177 TAA---FDPNDTTTYNYSNSTTIYDSLGNTHLMTTYFIKSDDNTWDWNVVDENDATLYSS 233

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
                      + FD     ++  +              Q I   +  TTQ A       
Sbjct: 234 ATAGNS-----LEFDTSGKQISGGTATLGPLTPGAGTASQTINFALKNTTQFANDSQVIS 288

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              NG+  G   + S+  +G V   Y +G  +   R+ +A   S   L+    + +  T 
Sbjct: 289 QTQNGYGAGNLTNISIDNEGNVLAKYSNGEEIAKSRIVLAKFSSFSGLRKEGASLFSATG 348

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG   IG PG    G IF+ ALE + VD+A+E  ++I  QR +  NSKV  T  + +  
Sbjct: 349 ESGPPRIGVPGTE-LGNIFTNALEQSTVDLAAEFVKMITTQRGFQANSKVITTTDEMLSE 407

Query: 416 LISLKR 421
           LI+LKR
Sbjct: 408 LINLKR 413


>gi|124268254|ref|YP_001022258.1| flagellar basal body and hook protein [Methylibium petroleiphilum
           PM1]
 gi|124261029|gb|ABM96023.1| flagellar basal body and hook protein [Methylibium petroleiphilum
           PM1]
          Length = 420

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 110/423 (26%), Positives = 176/423 (41%), Gaps = 12/423 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +  +SG++A S  +  + +N+AN  T G K +   F  +   + + S    V  G+ +
Sbjct: 2   SFQQGLSGLNAASKNLEIIGNNVANASTFGAKSSRAEFGDVYANALNGSGTNMVGIGVNL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +T      QG++  T +  DLAI G GFF V    N     R G F I+ EGF+ N +G 
Sbjct: 62  ATVAQQFTQGNITTTDNPMDLAINGSGFFQVSDGKNPTMYARNGQFKIDREGFIVNNSGY 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            LLGYP       +        + I +  A ++   T    I  NLD    + TP     
Sbjct: 122 KLLGYPADGQGVIV----PGQAQAIQLPTAGIAPRATDRIAIEMNLDARQAVTTPATGGI 177

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                A Y + +S   YD  G  V    Y+ K+G  +W+V +       +        P 
Sbjct: 178 DFDDPATYNNATSVTVYDAKGQDVALTYYFQKSGADQWDVYVTANGTPISVDGTGAALPS 237

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT-----IDISKTTQLAGGFIPQKSE 297
            T+    +         +          +     +      +D++  TQ   GF      
Sbjct: 238 TTMTFPANGSAPTAPVGAVPINIPATTNAAGGTTLPITGIELDVTSATQYGSGFGVTDMS 297

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
             G+APG+    S+  +G +   Y +G   P  +L +A   +   L+    N +  T  S
Sbjct: 298 QTGYAPGQLSGISIEANGVIMARYSNGQSKPGGQLELANFRNPQGLQPLGNNVWATTFTS 357

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           GD  +G  G    G + SGALE +N+D+  EL  +I AQR Y  N++  +T    M  L+
Sbjct: 358 GDPVVGAAGDGNFGVLQSGALEESNIDLTGELVNMITAQRVYQANAQTVKTQDSMMQTLV 417

Query: 418 SLK 420
           +L+
Sbjct: 418 NLR 420


>gi|197285510|ref|YP_002151382.1| flagellar hook protein FlgE [Proteus mirabilis HI4320]
 gi|227356001|ref|ZP_03840393.1| flagellar hook protein [Proteus mirabilis ATCC 29906]
 gi|194682997|emb|CAR43446.1| flagellar hook protein [Proteus mirabilis HI4320]
 gi|227163989|gb|EEI48891.1| flagellar hook protein [Proteus mirabilis ATCC 29906]
          Length = 406

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 93/415 (22%), Positives = 172/415 (41%), Gaps = 10/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NI+N  T G+K   ++F+ +   S +      G+++S  
Sbjct: 2   SFSQAVSGLNAAAANLDTIGNNISNSATYGFKGATVSFADVFAGSGA----GLGVKVSGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + GS+  T   TD+AI G GFF ++  +     +R G+F  +  G+L N+ G  + 
Sbjct: 58  SQNFKDGSITTTNRPTDVAISGGGFFRIEDSNGGVFYSRNGEFGKDKNGYLTNMQGMRIT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP++N     +V        I +    ++A  T    ++ NL+     I          
Sbjct: 118 GYPVQNVDGKNVVQKGATPTPIIIPTDMMNASATDKMDMTVNLNSAEEAIDQTTHKFDPK 177

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y   ++   YD+LG+    ++++ KT D +W V                +   +  
Sbjct: 178 DNDSYNFSTNVTTYDSLGNEHNLNLFFVKTKDNEWSVYAQDTTTGEPAQDLGKLVYKDNG 237

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            +           +           S            T Q        K   NG+  G+
Sbjct: 238 VLDETAPKLKNFTT------VAYKGSQPMDMEMNFSGSTQQKVAESSVSKLAQNGYQAGE 291

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
             +F +  DG +   Y +     + ++A+A   +   L     N +  T  SG   +G  
Sbjct: 292 FTNFRIEPDGSIMATYSNQQSQVVGQIALANFANPGGLSSQGDNMWSETNGSGSPIVGVA 351

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ + ALE +NVD++ EL  +I AQRNY  N++  +T    +  L+S++
Sbjct: 352 GSGVFGKLTNNALEASNVDMSQELVNMIVAQRNYQSNAQTIKTQDQILQTLVSMR 406


>gi|146296289|ref|YP_001180060.1| hypothetical protein Csac_1266 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409865|gb|ABP66869.1| protein of unknown function DUF1078 domain protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 484

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 108/485 (22%), Positives = 189/485 (38%), Gaps = 67/485 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ SM ++++ + A   R+  + DNIANV+TVG+K + + F+S+                
Sbjct: 1   MMRSMFSSITSLRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVFASVIKAASAPDTTSG 60

Query: 50  --STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
              ++   +  G+ +++ DM   +GSL  T + TDLAI+G GFF+V G       TRAG+
Sbjct: 61  RGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFFVVGGDGRAPRFTRAGN 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F ++  G L    G  +LG+     +  +        +   + +  L+   T       N
Sbjct: 121 FSLDKMGNLVTANGLNVLGWMADPVNNQIDTTKSPS-KINILAYPTLAPKATDKISFDGN 179

Query: 168 LDKNATIITPDKTPKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIF 225
           L  +    T       +     A+  +  SF  YD+ G      + + K G+ +WE  + 
Sbjct: 180 LSADTVAYTGQIAKYEDLLNVPADSKYSMSFKVYDSQGKEHTLQLIFVKNGNNQWEWFVD 239

Query: 226 RQDQSTNNSF------------------------------------------------PY 237
                 N                                                     
Sbjct: 240 APRVKKNIGTAEVYAYVDDMIDANNNYDEFIARGTITFGQAGKVFDDENTPNVEGIQITG 299

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA-GGFIPQKS 296
                +          G   N     ++ +      +  I   +   TQ        + +
Sbjct: 300 GRVYDSANGTFTINFVGNAVNPITFKVNSSQFDVNDNTNIAFFLKNLTQFGNMDSSIRVA 359

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
           ++ G++ G  + F++   G +  IY +G    I ++AIAT  +   L+    N Y+ T +
Sbjct: 360 QMTGYSAGSLQGFNIDATGKITGIYSNGLNQLIGQIAIATFANPAGLQRIGDNLYINTVN 419

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SGD  IG PG    G I  G LE +NVD+A E T++I  QR Y  N++V     + +  L
Sbjct: 420 SGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMIVTQRGYQANARVITASDELLQDL 479

Query: 417 ISLKR 421
           +++KR
Sbjct: 480 VNIKR 484


>gi|325291962|ref|YP_004277826.1| Flagellar hook protein FlgE [Agrobacterium sp. H13-3]
 gi|325059815|gb|ADY63506.1| Flagellar hook protein FlgE [Agrobacterium sp. H13-3]
          Length = 426

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 212/426 (49%), Positives = 282/426 (66%), Gaps = 5/426 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G+M+T +SGM+AQ+N++  V DNIAN  T GYKR + +FSSLV PS+S SY SGG+
Sbjct: 1   MSIFGTMRTGVSGMNAQANKLGTVGDNIANASTTGYKRASTSFSSLVLPSSSGSYASGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + + +  ISEQG+L +T S+TDLAIQG GFF+V+       LTRAG F  N EG+LEN A
Sbjct: 61  QSNVRYSISEQGNLSYTTSSTDLAIQGNGFFVVQDGGGTPYLTRAGSFVKNAEGYLENAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GYP    +   +VN F GLE +NV +  L+A P+T G    NL+++   +     
Sbjct: 121 GFQLMGYPYGANAPAAVVNGFTGLEAVNVNNFGLTASPSTQGSFPANLNRDEAAVAAGSR 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P  N   +   +K+S  AYD+ G+ V+YD YYTKTG   WEV+++RQDQSTN  FPY   
Sbjct: 181 PSDNLATSTIGNKTSLTAYDSGGAKVLYDFYYTKTGANTWEVAVYRQDQSTNGGFPYTAT 240

Query: 241 P-----LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
           P       +V ++FDP T  L  +S K+I+ ND  SG+ Q I+ID+S  +Q +  F P  
Sbjct: 241 PAANLVKESVTLAFDPATNKLTPTSQKSITINDTVSGVPQAISIDLSDMSQFSTKFTPGT 300

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           + +NG+ P + KD  + KDG V  +Y DG R  IY+LA+ATVPS DNL   +GN YLP+ 
Sbjct: 301 AILNGNGPSQIKDVEIGKDGVVTAVYQDGGRRNIYQLAVATVPSVDNLSPQNGNVYLPSN 360

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG ++IGFP     G I  GALE +NVDIASELT++IE+QR Y  NSKVFQTGSD MD+
Sbjct: 361 ESGVVTIGFPQTGSFGYIQKGALEGSNVDIASELTDMIESQRIYTANSKVFQTGSDLMDV 420

Query: 416 LISLKR 421
           LI+LKR
Sbjct: 421 LINLKR 426


>gi|158320521|ref|YP_001513028.1| hypothetical protein Clos_1488 [Alkaliphilus oremlandii OhILAs]
 gi|158140720|gb|ABW19032.1| protein of unknown function DUF1078 domain protein [Alkaliphilus
           oremlandii OhILAs]
          Length = 448

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 103/448 (22%), Positives = 185/448 (41%), Gaps = 29/448 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ SM +A+S + A   ++  + +NIANV+TVG+K T + F  +   +            
Sbjct: 1   MMRSMYSAVSSLKAHQLKMDVIGNNIANVNTVGFKGTRVTFQEVFSQTLRGAGRAQEGGR 60

Query: 51  --TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN--VNCLTRAG 106
             T+   V  G+ +++ D    +GS+  T  NTDL I G+GFF+V           TRAG
Sbjct: 61  GGTNPQQVGLGINVNSMDTFHTRGSVESTGYNTDLMINGEGFFVVSDTQGGLQKSYTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
            F ++  G L    G  +LGY     +   +  + +G          L      T   + 
Sbjct: 121 AFGLDANGNLITPDGYYVLGYTAVRDADGQVQKNEKGQPIFEENLTGLRISRDETAPPAA 180

Query: 167 NLDKNATIITPDKTPKHNGRDAEY--THKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI 224
                 T          +   A     H++    +D+LG++    V + +T         
Sbjct: 181 TTKATFTGNIDSNLSADSTGTAGDGGIHETVMKVHDSLGNAHTVKVQFQRTDQGNDTKRT 240

Query: 225 FRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKA-------ISFNDNTSGIDQQI 277
           F    +  ++                  +  + + +           + +         I
Sbjct: 241 FAVTITELDNVKLGAPIPLEPATPLTFDSAGILDKTALTKGTLKLGHATDGLDGAKQLSI 300

Query: 278 TIDISKTTQLAGG----FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLA 333
            +D +K T  A            EING+A GK  DF++S  G ++  + +G+R  + R+ 
Sbjct: 301 ELDFTKLTSYAADKGAKSDAAALEINGYASGKIDDFTISTTGEIEANFTNGSRQILGRVG 360

Query: 334 IATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELI 393
           +A   +   L    GN Y  T +SG++  G+ G    G +  GA+E +NVDI+ E T++I
Sbjct: 361 LANFKNPAGLLKTGGNMYRETSNSGEVMFGYAGTGGFGALNPGAIEMSNVDISREFTDMI 420

Query: 394 EAQRNYAVNSKVFQTGSDFMDILISLKR 421
             QR +  NS++  T  + +  ++++KR
Sbjct: 421 TTQRGFQANSRIITTSDEMLQEIVNMKR 448


>gi|152980177|ref|YP_001353111.1| flagellar hook protein FlgE [Janthinobacterium sp. Marseille]
 gi|151280254|gb|ABR88664.1| FlgE flagellar hook protein [Janthinobacterium sp. Marseille]
          Length = 416

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 183/422 (43%), Gaps = 14/422 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +  +SG++A S  + A+ +N+AN  TVG+K++ + F+ +   + S S    +  G+++
Sbjct: 2   SFQQGLSGLNAASKSLEAIGNNVANSGTVGFKQSQVQFADIYASTLSGSGAAQIGIGVQV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +  QG++  + +  D+AI G GFF            R G F +  EG+++N +G 
Sbjct: 62  ARVAQLFSQGNIAVSNNPLDMAINGDGFFR-MSSGGSITYGRNGQFELTKEGYIQNASGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY              Q    + +   +    P  T      L  ++     D    
Sbjct: 121 RLTGYMADANG------VVQNGAPVELVINKADMGPAATTKYDVKLTLDSRKDVLDPLLF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +    A ++  +S   YD+LG+S +   +Y KT   +W V           + P      
Sbjct: 175 NPDDAATFSDSTSVPVYDSLGNSHILRTFYVKTAGGEWSVFATNDGVPIGYTLPVTATNP 234

Query: 243 NTVEVSFDPVTGYLANSSHKAISFN----DNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
                  D  TG    S+  +           +     IT++++ T Q A  F   K+  
Sbjct: 235 PVPLGVMDFGTGGALVSTTPSPMVAAMAVTTGAATPFNITLNVAGTQQFAQAFGVSKNLP 294

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+ PG    F V+ DG +   Y +G    + ++ +++  + + L+    N ++ T +SG
Sbjct: 295 DGYRPGTLTGFDVASDGSIMGRYSNGEVNVLGQVILSSFANPNGLQNIGDNQWVETAESG 354

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
                 PG +  G + S  +E +NVD+ +EL  +I AQR Y  N++  +T    M  L++
Sbjct: 355 VPLTSTPGSSGLGVVQSARIEESNVDLTAELVNMITAQRVYQANAQTIKTQDQIMQTLVN 414

Query: 419 LK 420
           L+
Sbjct: 415 LR 416


>gi|114566393|ref|YP_753547.1| flagellar hook protein [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114337328|gb|ABI68176.1| flagellar hook protein [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 475

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 96/477 (20%), Positives = 177/477 (37%), Gaps = 60/477 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY------- 55
           ++ SM + +SG+     R+  + +NIAN++T GYK++ + F   ++ +   +        
Sbjct: 1   MMRSMYSGVSGLRNHQTRMDVIGNNIANINTAGYKKSRVVFQDTLYQTMRGATRPDSSGS 60

Query: 56  --------VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
                   +  G+ +S+ D I        T    D+ I G G+F+++        TRAG+
Sbjct: 61  RGGTNPMGIGLGMSVSSIDQIHTGAPTTATNKLLDMGIDGDGYFMIR-HGQQKYFTRAGN 119

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAEL----SAMPTTTGF 163
           F ++ +G L + A G  +   +          +      +               T    
Sbjct: 120 FELDTKGNLVHTANGYYVQGWVTKIDPVTGQWNLDCSREVETVDISGLLACDPQATKEMS 179

Query: 164 ISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK----- 218
            S NLD        D   +      + +  +S   +D+LG        + K         
Sbjct: 180 FSGNLDAEIPFKQVDPEDESIYPGTQESIITSMDVWDSLGKKETVYFRFFKYEVDAGPPR 239

Query: 219 --KWEVSIFRQDQSTNNSFPY--------------------------------NVAPLNT 244
              W V I   +    N+  Y                                N+   + 
Sbjct: 240 LSNWAVDISLNNPLFENAKDYDSTSDFATVDLSVDPPTEETLTTGETEIVRLFNLQFDDN 299

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
            +V            +   I    + +  D +  ID S  TQ AG     +   NG+  G
Sbjct: 300 GKVVLAGTPDDPEPKTVDLIIDRASEAAEDIEFKIDFSAMTQFAGNS-VTEIAQNGYGMG 358

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               ++V  DG +   YD+G    + R+A+A   +   L    G  +  + +SG+  +  
Sbjct: 359 SLSSYTVGIDGVIRGSYDNGETRDLARVALARFQNPAGLTQLGGTMFQKSVNSGEAVVSP 418

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           P  +  G+I   +LE +NVD++ E T++I  QR +  NS++  T  + +  L++LKR
Sbjct: 419 PTESGMGKIVPSSLEMSNVDLSEEFTDMIVTQRGFQANSRIITTSDEMIQELVNLKR 475


>gi|51894131|ref|YP_076822.1| flagellar hook protein [Symbiobacterium thermophilum IAM 14863]
 gi|51857820|dbj|BAD41978.1| flagellar hook protein [Symbiobacterium thermophilum IAM 14863]
          Length = 418

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/433 (22%), Positives = 181/433 (41%), Gaps = 30/433 (6%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-------TSNSYV 56
           + S+ + +SG+ +   R+  + +NIANV+T G+K + + F+ +   +       T+   +
Sbjct: 1   MRSLYSGVSGIRSHQTRMDVIGNNIANVNTTGFKASRVTFTDVFNQTLSSGSALTNPQQI 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
             G+ + + D+I+++G+   T    DLAI G G F++KG ++    +RAG F  N +G L
Sbjct: 61  GLGVAVGSTDLITDEGAFQMTGRAFDLAISGAGLFVLKGANDEILYSRAGMFDWNPDGIL 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
            N A G+ +   +         +     +   V+        TT      NL        
Sbjct: 121 INPALGMKVQGWMAVDGVIGRTDRATMQDIQIVRGTVSLPQATTKVTFKGNL-------- 172

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
                     + + T+++   AYD+LG  +   + +TK     W V  +   ++   S  
Sbjct: 173 ------DAAAEEDSTYETIINAYDSLGRDIPITLRFTKGDGNTWTVQYW-DPETEGWSEE 225

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL--------A 288
           + +   +   +                   + N    D +IT+D  K TQ          
Sbjct: 226 HTLDFGSDGRILGPQGPNDDDPRLWTITITDPNDQADDLEITLDFRKITQAYDASGSGGT 285

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                +    +G   G  +   V++ G +   Y +G    + ++A+A   +   L     
Sbjct: 286 ARSTVELDTRDGRPMGSLEAVYVNELGEIIGRYTNGDSQLLAQIALAHFNNMAGLIKEGN 345

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           +T+  +  SG   IG  G    G +  G LE +NVD+A + TE+I  QR Y  +++V  T
Sbjct: 346 STFAESPASGVPQIGTAGTGGRGTLVPGNLEGSNVDLAGQFTEMILTQRGYQASARVVST 405

Query: 409 GSDFMDILISLKR 421
             D +  +I+LKR
Sbjct: 406 ADDMLQEIINLKR 418


>gi|134095097|ref|YP_001100172.1| flagellar hook protein FlgE [Herminiimonas arsenicoxydans]
 gi|133739000|emb|CAL62048.1| Flagellar hook protein FlgE [Herminiimonas arsenicoxydans]
          Length = 418

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 95/424 (22%), Positives = 175/424 (41%), Gaps = 16/424 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +  +SG++A S  + A+ +N+AN  TVG+K++ + F+ +   + S S    +  G +I
Sbjct: 2   SFQQGLSGLNAASKSLEAIGNNVANSGTVGFKQSQVQFADIYASTLSGSGAAQIGIGTQI 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +  QG++  + +  D+AI G GFF            R G F ++ EGF+++ +G 
Sbjct: 62  ARVAQLFSQGNITASNNPLDMAINGDGFFR-MSSGGTISYARNGQFELSKEGFIQSASGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY         I           +K  +    P  T      L  ++     +    
Sbjct: 121 RLTGYMADANGVVAIGA------PAELKINKADLAPEATTKYELKLTLDSRKNVLNSANF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +      +   +S   YD+LG+S +   +Y KT   +W+V                    
Sbjct: 175 NPDDPTTFNDSTSVPVYDSLGNSHILRTFYVKTAGGEWDVFATNDGVPIGYDPAAVPPAN 234

Query: 243 NTVEVSFDPV------TGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
             V +              +  +           +     I ID + T Q A  F   K 
Sbjct: 235 APVALGTMQFGPGGVLIPSIPPTPLVVPMDVSTGATTPFNIVIDHTGTQQFAQSFGVNKQ 294

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G  PG    F+V+ DG +   Y +G    + ++ +++  + + L+    N ++ T +
Sbjct: 295 LPDGFPPGTLTAFNVASDGSIVGRYSNGKVNVLGQVILSSFANPNGLQNIGDNQWVETAE 354

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG      PG +  G + S  +E +NVD+ +EL  +I AQR Y  N++  +T    +  L
Sbjct: 355 SGVALTSAPGSSGLGSVQSARIEESNVDLTAELVNMITAQRYYQANAQTIKTQDQILQTL 414

Query: 417 ISLK 420
           ++L+
Sbjct: 415 VNLR 418


>gi|156934440|ref|YP_001438356.1| flagellar hook protein FlgE [Cronobacter sakazakii ATCC BAA-894]
 gi|156532694|gb|ABU77520.1| hypothetical protein ESA_02271 [Cronobacter sakazakii ATCC BAA-894]
          Length = 409

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 98/416 (23%), Positives = 179/416 (43%), Gaps = 9/416 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A S  +  + +NIAN  T G+K  +++F+ +       S    G++++  
Sbjct: 2   AFSQAVSGLNAASTNLDVIGNNIANSATYGFKSGSVSFADMFA----GSKAGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G   +T    D+AI   GFF +   +     +R G F ++ +  L N+ G  + 
Sbjct: 58  TQDFGDGVTTNTGRKLDVAISQNGFFRLLDSNGGVFYSRNGQFKLDEKSNLVNMQGMQVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        + +  A++ A  TT+     NL+ +  +  P ++P    
Sbjct: 118 GYPA--TGTPPTIQQGADPIPLTIPTAQMPASQTTSANFVMNLNSSDDV--PAQSPFDPA 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
             + +        YD+LG+     +YY KT D +W+V       S +          +  
Sbjct: 174 NSSTFNKSVPLTVYDSLGNEHNLKLYYVKTADNQWDVYNNDTSVSGSTPTKLTSLTFSDS 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ-KSEINGHAPG 304
                      A S    IS            +++++ TTQ   G      S  NG+ PG
Sbjct: 234 GALTSITNAAPAGSQQVPISVASLNGSAAFTFSMNLTGTTQQNSGANVLLTSNQNGYKPG 293

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               + V++DG +   Y +     + ++ +A   + + L     N +  +  SG   +G 
Sbjct: 294 DLVGYQVNEDGSLVGNYSNEKSQLLGQIVLANFANPEGLSSQGDNVWSASTASGVALLGS 353

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 354 AGTGNFGKLTSGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 409


>gi|260597445|ref|YP_003210016.1| flagellar hook protein FlgE [Cronobacter turicensis z3032]
 gi|260216622|emb|CBA29917.1| Flagellar hook protein flgE [Cronobacter turicensis z3032]
          Length = 410

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 98/417 (23%), Positives = 181/417 (43%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A S  +  + +NIAN  T G+K  +++F+ +       S    G++++  
Sbjct: 2   AFSQAVSGLNAASTNLDVIGNNIANSATYGFKSGSVSFADMFA----GSKAGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G   +T    D+AI   GFF +   +     +R G F ++ +  L N+ G  + 
Sbjct: 58  TQDFGDGVTTNTGRKLDVAISQNGFFRLLDSNGGVFYSRNGQFKLDEKSNLVNMQGMQVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        + +  A++ A  TT+     NL+ +  +  P +TP    
Sbjct: 118 GYPA--TGTPPTVQQGADPIPLTIPTAQMPASQTTSANFVMNLNSSDDV--PAQTPFDPA 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD--QSTNNSFPYNVAPLN 243
             + +        YD+LG+     +YY KT D KW+V         +T  +   ++   +
Sbjct: 174 NSSTFNKSVPLTVYDSLGNEHNLKLYYVKTADNKWDVYNMDTSVSSATPTTPLTSLTFSD 233

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
           +  ++         +        + N S            T Q +G  +   S  NG+ P
Sbjct: 234 SGALTGITNAAPAGSQQVPISVTSLNGSAAFSFSMNLTGTTQQNSGANVLLTSNQNGYKP 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G    + V++DG +   Y +     + ++ +A   + + L     N +  +  SG   +G
Sbjct: 294 GDLVGYQVNEDGSLVGNYSNEKSQLLGQIVLANFANPEGLSSQGDNVWSASTASGVALLG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 354 SAGTGNFGKLTSGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 410


>gi|268589982|ref|ZP_06124203.1| flagellar hook protein FlgE [Providencia rettgeri DSM 1131]
 gi|291314700|gb|EFE55153.1| flagellar hook protein FlgE [Providencia rettgeri DSM 1131]
          Length = 419

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 179/422 (42%), Gaps = 11/422 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S  + ++ +NIAN  T G+K    +F+ +       S V  G+ ++  
Sbjct: 2   SFSQAVSGLNAASAGLDSIGNNIANSATNGFKGATTSFADMFA----GSGVGLGVNVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G +  T   TD+AI G GFF V+ ++     +R G F  +  G L N  G V+ 
Sbjct: 58  TQNFKDGPITRTDRATDVAISGNGFFRVQDQNGDTYYSRDGQFLRDKSGNLVNNQGMVVT 117

Query: 126 GYPLKNAS-APLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP        + + S      +N+    + A  +    ++ NL+    I        + 
Sbjct: 118 GYPASVDEKGNVTIQSGGVPAGLNIPTDMMDAKASELAKLTINLNSEDKIKDKPFDVNNP 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS------FPYN 238
              A Y   ++  AYD+ G++    VY+ K+ D +W+V     +                
Sbjct: 178 DDSATYNFSTTMTAYDSQGNTHEISVYFVKSADNEWKVYAKDANDKVATQLINTEDVDDT 237

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
           V   N +    +       +++        N +              Q          ++
Sbjct: 238 VVVHNKLIFDGNGRLSAPTDATFDFNYKGLNGANDGVLRVDLNKTRQQKVSESSVSAIDV 297

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+  G+   F +  +G +   Y +  +  + ++A++   + + L    GN +  +  SG
Sbjct: 298 NGYPAGEYTTFKIEDNGLITANYSNQQKRVVGQVALSAFANPNGLVSQGGNVWASSNTSG 357

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           +   G PG  Q G++ SGALE++NVD++ EL  +I  QRNY  N++  +T    +  L++
Sbjct: 358 NPMDGVPGVGQFGKLTSGALESSNVDMSQELISMIVMQRNYQSNAQTIKTQDQMLQTLVN 417

Query: 419 LK 420
           L+
Sbjct: 418 LR 419


>gi|225181603|ref|ZP_03735044.1| protein of unknown function DUF1078 domain protein [Dethiobacter
           alkaliphilus AHT 1]
 gi|225167711|gb|EEG76521.1| protein of unknown function DUF1078 domain protein [Dethiobacter
           alkaliphilus AHT 1]
          Length = 408

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 106/432 (24%), Positives = 183/432 (42%), Gaps = 37/432 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +  S+ T +SG+     ++  + +NIANV+T  +K   + F  ++               
Sbjct: 1   MQRSLFTGVSGLRNHQTKMDVIGNNIANVNTTAFKAGRVRFQDILSQNIRGASAPQDGRG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
             + + V  G+ +++ D I   GSL  T   TDLAIQG GFF++    N    +R G F 
Sbjct: 61  GINPAQVGLGMSVASIDTIHTPGSLQSTGRPTDLAIQGSGFFVMSDGAN-EFYSRDGAFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           + ++G L N A G        +A   +                    +      + +N+ 
Sbjct: 120 LGSDGDLVNGANGFKPLGWQADAFGNI---------------NTNGPLQPLNIPLGHNVT 164

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
             AT      +   +  +    H +    Y++ G S + ++ +TKTG   WE        
Sbjct: 165 TRATENLTFSSNLDSLAEIGTEHMAESLVYNSQGGSHLVEIIFTKTGSNTWEW------- 217

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
              +    N        + FD     L  +   AIS  D     D  + +D +  +Q+ G
Sbjct: 218 -EASGITGNETVSGQGTIEFDEFGNLLQATGDAAISITDIDGADDISMAVDFNNMSQVVG 276

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               Q    +G   G+  +F++ K G +  IY +G  V + ++A+A+  + + L    GN
Sbjct: 277 HSNAQVRYQDGFPAGELTEFTIGKTGVISGIYTNGLVVELGQIALASFDNPEGLMKAAGN 336

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  + +SG   +G  G    G I +G LE +NVD++ E TE+I   R +  NS+V  T 
Sbjct: 337 MYQVSSNSGQARVGGAGLEGRGVIETGTLEMSNVDLSYEFTEMITTSRGFQANSRVITTS 396

Query: 410 SDFMDILISLKR 421
            D +  +++LKR
Sbjct: 397 DDLLQEVVNLKR 408


>gi|37525841|ref|NP_929185.1| flagellar hook protein FlgE [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785270|emb|CAE14211.1| Flagellar hook protein FlgE [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 404

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 100/417 (23%), Positives = 185/417 (44%), Gaps = 16/417 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K + +AFS +       S V  G+++S  
Sbjct: 2   AFSQAVSGLNAAAGNLDVIGNNIANAATYGFKSSTVAFSDIFA----GSQVGLGVKVSGV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
           +   + G+   T    DLAI   GFF ++G D     +R G F ++    + N+ G  L 
Sbjct: 58  NQNFKDGTPTTTNRTLDLAITQGGFFRMQGGDGGIYYSRNGQFKMDENRNIINMQGMKLT 117

Query: 126 GYPLKN-ASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP  +       +      E I +    L A  TT   ++ NL+      T   +P++N
Sbjct: 118 GYPAASVNGGAPEIQKGANPEPITIPQGILMAKATTKVTMTANLNSMHKKPTEAFSPENN 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y + +S   +D+LG+     V++ KT D +W+V           +          
Sbjct: 178 D---SYNYPTSVTTFDSLGNPHAIQVFFVKTNDNEWQVHAQDSAVEGAKAASLGT----- 229

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF-IPQKSEINGHAP 303
             + FD     + +++    +           ITID + + Q           + +G+A 
Sbjct: 230 --LKFDGNGKLIGDNNQFTFNVPSLNGSNAADITIDFNGSKQQKIDTDSISAPKQDGYAA 287

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+ K + + +DG V   Y +     + ++ +    + + L     N ++ T  SG+  +G
Sbjct: 288 GEFKGYRIEQDGRVIGTYTNEQSQLLGQIVLTNFANPEGLAAKGDNVWVETSASGNPVVG 347

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
                  G++ SG+LE +NVD++ EL  +I AQRNY  +++  +T    +  L+S++
Sbjct: 348 IADSGGFGKLLSGSLEASNVDMSQELVNMIVAQRNYQSSAQTIKTQDQILQTLVSMR 404


>gi|20807880|ref|NP_623051.1| flagellar basal body and hook proteins [Thermoanaerobacter
           tengcongensis MB4]
 gi|254478868|ref|ZP_05092232.1| Flagellar basal body protein FlgE [Carboxydibrachium pacificum DSM
           12653]
 gi|20516445|gb|AAM24655.1| Flagellar basal body and hook proteins [Thermoanaerobacter
           tengcongensis MB4]
 gi|214035181|gb|EEB75891.1| Flagellar basal body protein FlgE [Carboxydibrachium pacificum DSM
           12653]
          Length = 415

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 107/432 (24%), Positives = 181/432 (41%), Gaps = 30/432 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAISGLQAHQARLDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +  +G    T + TDL+I G GFFIV         TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTRGGAQRTDNPTDLSIDGNGFFIV-SNGESILYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            ++ G L    G  +LG+        +  ++   +         +    TT   I  NL+
Sbjct: 120 FDSNGDLVTPDGYKVLGWM-STDGKTVNTDTGNLVPISLKNWFGMEPSTTTQLEIGGNLN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YDT G S V  + +T+     W  S+     
Sbjct: 179 ASTGIGQSI--------------SYNIIVYDTQGGSHVATITFTRQDPNTWNWSV-SSQD 223

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
              +S     +   T            A  +         T+     + ID+SK T  + 
Sbjct: 224 PYISSVSVAGSTAITFGADGKIAPNTQATGTLTFNMNTAVTNAQIGPVNIDLSKLTMFST 283

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               ++   NG+  G  +  ++ K G V  IY +G R  I ++A+A   +   L+     
Sbjct: 284 ETDLRELSKNGNEAGSLQSINIDKYGVVSGIYSNGRRQVIGQIALADFQNPMGLEKVGNT 343

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            ++ T +SG+  IG  G    G I  G LE +NV++A+E  ++I  QR +  N+KV    
Sbjct: 344 MFINTVNSGEPMIGAAGSGTRGSINPGTLEMSNVNLANEFVDMITTQRGFQANAKVITVS 403

Query: 410 SDFMDILISLKR 421
            + +  L+++KR
Sbjct: 404 DEMLQDLVNMKR 415


>gi|297544701|ref|YP_003677003.1| fagellar hook-basal body protein [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842476|gb|ADH60992.1| fagellar hook-basal body protein [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 413

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 105/432 (24%), Positives = 187/432 (43%), Gaps = 32/432 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ +   R+  + +NIANV+TVGYK + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKSHQARMDVIGNNIANVNTVGYKASRMTFKEIFSQTIKGASAPQGNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +   G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFTSGGAQRTDNPTDLSIDGNGFFIV-SNGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +++G L    G  +LG+        +  ++   +       + ++   TT   I  NL+
Sbjct: 120 FDSQGDLVTPDGYKVLGWM-STDGETVNTDTGNLVPISIKNWSSIAPAATTQLEIGGNLN 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +  I                    +   YD+ G S +  + +T+T    W  S+   D 
Sbjct: 179 ASTEIDGSI--------------SYNILVYDSQGGSHIATLTFTRTDASTWNWSVSSSDP 224

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           + ++          T        T   A  +       + T+     + +D+S+ T  + 
Sbjct: 225 AISSVDGSGT---LTFGADGKIATNTTATGTLTFNMNTNETNATIGPVQLDLSQLTMFSS 281

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               ++   NG+  G  +  ++ K G V  IY +G    I ++AIA   +   L+     
Sbjct: 282 ETDLRELSKNGNEAGSLESINIDKYGVVSGIYSNGREQIIGQIAIADFQNPMGLEKVGNT 341

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            ++ T +SG+  IG  G    G I  G LE +NVD+A+E  ++I  QR +  N+K+    
Sbjct: 342 MFINTVNSGEPMIGAAGTGTRGSINPGTLEMSNVDLANEFADMIVTQRGFQANAKIITAS 401

Query: 410 SDFMDILISLKR 421
            + +  L+++KR
Sbjct: 402 DEMLQDLVNMKR 413


>gi|116328901|ref|YP_798621.1| flagellar hook protein FlgE [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330492|ref|YP_800210.1| flagellar hook protein FlgE [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121645|gb|ABJ79688.1| Endoflagellar hook protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116124181|gb|ABJ75452.1| Endoflagellar hook protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 464

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 106/465 (22%), Positives = 192/465 (41%), Gaps = 47/465 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ S+ + +SG+     R+  + +NI+NV+T G+K   + F  ++               
Sbjct: 1   MMRSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQELRGASEPKENIG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
             +   V  G  I+  D I  QGSL  T  NTD+A+ G+GFFIVK  D     TRAG F+
Sbjct: 61  GVNPQQVGLGSLIAAIDKIMTQGSLQTTGKNTDVAMSGEGFFIVKDGD-KQFYTRAGAFN 119

Query: 110 INNEGFLENVAGG---VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
           ++  G+  N A G         L +     I +S    + I   +++  A  T+     +
Sbjct: 120 LDKNGYYVNPANGLKVQGWNARLDDKGNKFINSSASIEDIIIPVYSKEPARATSQIDFKS 179

Query: 167 NLDKNATIITPDKTP-------KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK 219
           NL+ +A  + PD T                  H ++   +D  G    + + + K  D  
Sbjct: 180 NLNSSAPAVPPDATQEEITAMINDPDPKMRRGHVTTIKTFDDQGIQREFKMEFYKVRDNT 239

Query: 220 WEVSIFRQDQSTNNSFPYNVAPLNT---------------VEVSFDPVTGYLANSSHKAI 264
           W+  +   D +  ++        NT                ++ +        NS     
Sbjct: 240 WKARLSMTDATQLSADVSGTGGQNTQLPGNTELEFGFTPDGKLVYVSDGVDSMNSGKLNA 299

Query: 265 SFNDNTSGIDQQITIDIS--------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
             +   +G     + D++          TQ +  F  +  + +G+  G  + FS+   G 
Sbjct: 300 KVSFRIAGNPAVQSFDLNLGEAGMVDGITQFSSDFTTKAVKQDGYTMGYLESFSIDNSGT 359

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           +  ++ +G R P+ R+A A   +   L       +  + +SG+ +IG  G    G+I +G
Sbjct: 360 ITGVFSNGVRQPLARIATAVFNNPAGLDKAGDTMFAYSMNSGEPNIGEAGVQGRGKINAG 419

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            LE +NVD++ + T++I  QR +  NS+   T    +  ++ LKR
Sbjct: 420 LLEMSNVDLSDQFTDMIVTQRGFQANSRTITTSDQMIQEVLGLKR 464


>gi|300722682|ref|YP_003711972.1| flagellar hook protein [Xenorhabdus nematophila ATCC 19061]
 gi|139522504|gb|ABO77656.1| FlgE [Xenorhabdus nematophila]
 gi|297629189|emb|CBJ89785.1| flagellar biosynthesis; hook protein [Xenorhabdus nematophila ATCC
           19061]
          Length = 398

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 99/415 (23%), Positives = 176/415 (42%), Gaps = 18/415 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A ++ +  + +NI+N  T G+K ++ AF+ +       S V  G+++S  
Sbjct: 2   SFSQAVSGLNAAASNLDVIGNNISNSATFGFKSSSAAFADVFS----GSEVGLGVKVSGM 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + GS   T    D+AI   GFF ++  +     +R G F ++ +  L N+ G  L 
Sbjct: 58  VQNFKDGSTTTTNRKLDMAINQGGFFRMQDSNGNILYSRNGQFKMDEDRNLINMQGMKLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP  N    +       +  I++    L A  TT   +  NL    T IT +       
Sbjct: 118 GYPAVNGEIQI----GGAVGPISIPTDMLDAKATTEITLKANLSSMETAITGE---FDPD 170

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   + + +    +D+LG+    +V++ KT + KW      +  +          P    
Sbjct: 171 KKDTFNYSAPLQVFDSLGNQHDINVFFVKTDNNKWTAHALDRSVA-------GAKPQELG 223

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           E+ F+           K      N S   Q          Q          + +G+A G 
Sbjct: 224 ELEFNTSGQMKDIPPFKFEVPALNGSAAAQINIELNGSKQQSIAQNSISPPKQDGYAAGH 283

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
             D+ V  DG +  +Y +  +  + ++ +A   + + L     N +  +  SG   IG  
Sbjct: 284 FTDYRVDDDGKIYGVYSNDQKQVLGQIVLANFANPEGLAAQGDNVWAESGASGSSVIGVA 343

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + SGALE +NVD++ EL  +I +QRNY  N++  +T    +  L+S++
Sbjct: 344 GSGNLGNLISGALEASNVDMSQELVNMIVSQRNYQSNAQTIKTQDQILQTLVSMR 398


>gi|290474972|ref|YP_003467856.1| flagellar hook protein [Xenorhabdus bovienii SS-2004]
 gi|289174289|emb|CBJ81079.1| flagellar biosynthesis; hook protein [Xenorhabdus bovienii SS-2004]
          Length = 416

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 190/421 (45%), Gaps = 12/421 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A ++ +  + +NIAN  T G+K ++ AF+ +       S V  G+++S  
Sbjct: 2   AFSQAVSGLNAAASNLDVIGNNIANSATFGFKSSSAAFADVFS----GSDVGLGVKVSGM 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + GS   T+   D+AI   GFF +   +     +R G F+++++  L N+ G  L 
Sbjct: 58  VKNFKDGSTTTTSRQLDMAITQGGFFRMLDSNGSTFYSRNGQFNMDSDRNLINMQGMKLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP    +    +        I++    L A  TT   ++ NL+        D  P +  
Sbjct: 118 GYPAVQGANGPEIQKGAAPGPISIPRDMLDAKATTNVTMTANLNSMNK--KVDINPFNPS 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL--- 242
               + + S  + YD+LG+    +V++ KT D +W++         ++    N   +   
Sbjct: 176 NKDSFNYSSGLSVYDSLGNEHNINVFFVKTNDNEWDIYAQDTSVPGSDHQKLNDKKVVEK 235

Query: 243 --NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG-FIPQKSEIN 299
              +  V F      + N++  A         I   ITID + + Q +         + N
Sbjct: 236 EGESKSVLFSGNGKIIGNNNAFAFDMPGLNGSIGAPITIDFNNSKQQSISQDSISNQQQN 295

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A G   ++ V  DG +  +Y +     + ++ +A   + + L     N ++ T  SG 
Sbjct: 296 GYAAGSFTNYRVDSDGKIHGLYSNQQTQVLGQVVLANFSNPEGLAAQGDNVWVETGASGS 355

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
             +G  G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    +  L+S+
Sbjct: 356 PIVGTAGSGNFGKLISGALEASNVDMSQELVNMIVAQRNYQSNAQTIKTQDQILQTLVSM 415

Query: 420 K 420
           +
Sbjct: 416 R 416


>gi|119953082|ref|YP_945291.1| flagellar hook protein FlgE [Borrelia turicatae 91E135]
 gi|119861853|gb|AAX17621.1| flagellar hook protein FlgE [Borrelia turicatae 91E135]
          Length = 442

 Score =  259 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 106/445 (23%), Positives = 183/445 (41%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QGS   T   +DL I G GFFI++  +N    TRAG F 
Sbjct: 61  GVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFFILRDGNNS-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASA--PLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           +++   L N A G+ +   +  +     +I  S    + +     + SA  T     + N
Sbjct: 120 VDSNRCLVNPANGMRIQGWMAKSIGGEQVINTSADVEDLVIPIGDKESAKATEHITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   II    +     R    T   +   YD+ G++ V ++   K        +    
Sbjct: 180 LDKRLPIIEEGASEVDVARG---TWVVNKTIYDSFGNTSVVELRVVKDTTTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS            +S +   G   +     I+F    +                
Sbjct: 237 VNGETNSNFTIGFNNEGALLSLNGQAGQPGDLLEFPITFGVVNANAGEVGEQQTINLRLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  +Y +G R  I ++A+A
Sbjct: 297 NVGSYTDSITQFADASTTKAIIQDGYGMGYMENYEIDQNGIIMGVYSNGIRRDIGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       +  T +SG   IG  G    G I +G LE ANVD+A + T++I  
Sbjct: 357 SFVNPGGLAKVGDTNFSETSNSGQARIGETGLAGLGTIRAGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|24215548|ref|NP_713029.1| flagellar hook protein FlgE [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45657072|ref|YP_001158.1| flagellar hook protein FlgE [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24196693|gb|AAN50047.1| flagellar hook protein FlgE [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45600309|gb|AAS69795.1| FlgE [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
          Length = 464

 Score =  259 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 106/465 (22%), Positives = 191/465 (41%), Gaps = 47/465 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ S+ + +SG+     R+  + +NI+NV+T G+K   + F  ++               
Sbjct: 1   MMRSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQELRGASEPKENIG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
             +   V  G  I+  D I  QGSL  T  NTD+AI G+GFFIVK  D     TRAG F+
Sbjct: 61  GVNPQQVGLGSLIAAIDKIMTQGSLQTTGKNTDVAISGEGFFIVKDGD-KQFYTRAGAFN 119

Query: 110 INNEGFLENVAGGVLLGYP---LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
           ++  G+  N A G+ +      L +     I ++    + I   +++  A  T+     +
Sbjct: 120 LDKNGYYVNPANGLKVQGWNSRLDDKGNKYINSAASIEDIIIPVYSKEPARATSQIDFKS 179

Query: 167 NLDKNATIITPDKTP-------KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK 219
           NL+ +A  + PD T                  H ++   +D  G    + + + K  D  
Sbjct: 180 NLNSSAPAVPPDATQEEITAMINDPDPKMRRGHVTTINTFDDQGIQREFKMEFYKVRDNT 239

Query: 220 WEVSIFRQDQSTNNSFPYNVAPLNT---------------VEVSFDPVTGYLANSSHKAI 264
           W+  +   D +  +         NT                ++ +        NS     
Sbjct: 240 WKARLSMTDSTQLSVDVSGTGGQNTQLPGNTELEFGFTPDGKLVYVSDGVDSMNSGKLNA 299

Query: 265 SFNDNTSGIDQQITIDIS--------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
             +    G       D++          TQ +  F  +  + +G+  G  + FS+   G 
Sbjct: 300 KVSFRIPGNPAIQNFDLNLGEAGMVNGITQFSSDFTTKAVKQDGYTMGYLESFSIDNSGT 359

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           +  ++ +G R P+ R+A A   +   L       +  + +SG+ +IG  G    G+I +G
Sbjct: 360 ITGVFSNGVRQPLARVATAVFNNPAGLDKAGDTMFSYSMNSGEPNIGEAGVQGRGKINAG 419

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            LE +NVD++ + T++I  QR +  NS+   T    +  ++ LKR
Sbjct: 420 LLEMSNVDLSDQFTDMIVTQRGFQANSRTITTSDQMIQEVLGLKR 464


>gi|258404710|ref|YP_003197452.1| fagellar hook-basal body protein [Desulfohalobium retbaense DSM
           5692]
 gi|257796937|gb|ACV67874.1| fagellar hook-basal body protein [Desulfohalobium retbaense DSM
           5692]
          Length = 433

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 114/441 (25%), Positives = 185/441 (41%), Gaps = 28/441 (6%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YV 56
           MG+ G++ T +S + A    ++ + +N+AN +T  +K +   FS L+    S+S     V
Sbjct: 1   MGLQGALYTGVSALGATGEAMNVIGNNLANSNTTAFKASRTLFSDLLASDVSSSSGTSQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFHINNEGF 115
             G+ +++ D +  QG    T S+TDLAI+G+GFF V   +   +  TRAG F+ N+EGF
Sbjct: 61  GTGVGLASVDTVFSQGGFNPTESSTDLAIEGEGFFKVSDPNTGADAYTRAGGFNFNDEGF 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L N  G  + GY +      +        +        + A  T    +S NL+ +A + 
Sbjct: 121 LVNPQGYRVQGYDVDGDGNTV----GNLKDIYTDLSGSVPAQETGRASLSTNLNASAEV- 175

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS- 234
               +   N         +S   YD+LG+S + +VY+TK G   W   +      TN   
Sbjct: 176 --GASFDINDPAGTSNFSTSINVYDSLGTSHLANVYFTKAGSNAWNYHVTADVGGTNTVL 233

Query: 235 ------FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK----- 283
                 F            S+    G +              +G                
Sbjct: 234 KSHQIKFTSTGYLKEVDGNSYMNEKGEIPAGQEGNNVITVKNTGNPINWGNGSDGHVFDV 293

Query: 284 ---TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
               +Q AG       + +G + G      V ++G V   Y +G    + +L +A   + 
Sbjct: 294 EFNLSQYAGQSELVSKQQDGFSSGALNGIEVDQEGMVIGSYSNGESKDLAKLGLAKFANN 353

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
           + L     + +  T  SG  +IG PG    G I S ALE + VDIA + T++I  QR Y 
Sbjct: 354 NGLAQVGNSLFEATNASGLPAIGTPG-AGVGTIRSNALEQSTVDIAKQFTDMITTQRAYQ 412

Query: 401 VNSKVFQTGSDFMDILISLKR 421
            NS+   T  D +  +++LKR
Sbjct: 413 ANSRTITTTDDMLQEVVNLKR 433


>gi|15887919|ref|NP_353600.1| flagellar hook protein FlgE [Agrobacterium tumefaciens str. C58]
 gi|15155515|gb|AAK86385.1| flagellar hook protein [Agrobacterium tumefaciens str. C58]
          Length = 425

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 216/426 (50%), Positives = 284/426 (66%), Gaps = 6/426 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G+M+T +SGM+AQ+N++  V DNIAN  T GYKR + +FSSLV PS+S SY SGG+
Sbjct: 1   MSIFGTMRTGVSGMNAQANKLGTVGDNIANASTTGYKRASTSFSSLVLPSSSGSYASGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + + +  ISEQG+L +T S+TDLAIQG GFF+V+       LTRAG F  N+EG+LEN A
Sbjct: 61  QSNVRYSISEQGNLSYTTSSTDLAIQGNGFFVVQDGSGTPYLTRAGSFQKNSEGYLENAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GYP  +     +VN F GLE INV +  L+A P+T G    NL+++    T    
Sbjct: 121 GFQLMGYPYGSNPPAAVVNGFTGLEAINVNNFGLTASPSTQGSFPANLNRDDKAATAPL- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P  N   A + +K+S  A+D+ G+ V+YD YYTKTGD  WEV+++RQDQSTN  FPY   
Sbjct: 180 PSGNSATAAFGNKTSLTAFDSGGAKVLYDFYYTKTGDNTWEVAVYRQDQSTNGGFPYTAT 239

Query: 241 P-----LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
           P        V++ FDP T  L  +S K+I+ +D  SG+ Q I ID+S+ TQ +  F P  
Sbjct: 240 PAANLVQTKVDLEFDPATNKLTTASPKSITIDDQVSGVPQAINIDLSQMTQFSAKFTPGT 299

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
           + +NG+ P + KD  + KDG V  +Y DG R  IY+LA+ATVPS DNL   +GN YLP+ 
Sbjct: 300 AVLNGNGPSQIKDVEIGKDGLVTAVYQDGGRRNIYQLALATVPSVDNLTPQNGNVYLPSN 359

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           DSG ++IGFP     G I  GALE +NVDIASELT++IE+QR Y  NSKVFQTGSD MD+
Sbjct: 360 DSGVVTIGFPQSGSFGYIQKGALEGSNVDIASELTDMIESQRIYTANSKVFQTGSDLMDV 419

Query: 416 LISLKR 421
           LI+LKR
Sbjct: 420 LINLKR 425


>gi|220934394|ref|YP_002513293.1| flagellar basal body FlaE domain protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995704|gb|ACL72306.1| flagellar basal body FlaE domain protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 408

 Score =  258 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 102/417 (24%), Positives = 175/417 (41%), Gaps = 14/417 (3%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEIS 63
            +TA+SG++A S  +    +NIAN  T G+K++   F+ +   S      + +  G+ +S
Sbjct: 3   FRTALSGLNAASADLRVTGNNIANSGTTGFKQSRAEFADVFALSYGGISQTAIGTGVRLS 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG++  T +N DLA+ G+GFF++         +RAG F +N EG++ N  G  
Sbjct: 63  AVTQQFSQGNIEFTGNNLDLAMNGQGFFVLND-SGTQVYSRAGAFQVNREGYVVNTQGQR 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L  Y  +NA       +   L  + +  +E     TT   +  NL      I P      
Sbjct: 122 LQVYTPQNAEG--TQFNTGSLADLQLSLSEAPPSATTDVNVRLNLSSVVEPIDPAIAF-D 178

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
               + + + +S   YDTLG +    +Y+  T   +W+  +           P       
Sbjct: 179 VADPSSFHYSTSLTVYDTLGQAHTASLYFRNTDTLQWDSYLAIDGNLAGGPLPLEFNSDG 238

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
           T+  +                 +       D  I  D++  TQ  G F       NG   
Sbjct: 239 TLNTATTTTPLNFGT-------YALTNGADDLNIDFDLANATQYGGAFNVTSLSQNGFTT 291

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+     +   G V   + +G    + R+A+A   +   L+    N +  +  +GD+ +G
Sbjct: 292 GRLNSIDIDPTGVVFARFTNGQSQALGRVALANFANPQGLQQLGDNAWGESFAAGDVILG 351

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
                  G I +G LE++NVDIA +L +LI AQRN+  N++V  T       +I+++
Sbjct: 352 EADTGNFGLIQAGGLESSNVDIAEQLVKLITAQRNFQANAQVITTADAVTQTIINIR 408


>gi|302037613|ref|YP_003797935.1| flagellar hook protein FlgE [Candidatus Nitrospira defluvii]
 gi|300605677|emb|CBK42010.1| Flagellar hook protein FlgE [Candidatus Nitrospira defluvii]
          Length = 407

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 112/425 (26%), Positives = 185/425 (43%), Gaps = 22/425 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YV 56
           MGIL SM TA++G+ +  N +  + +NIANV T G+K +   FS L+  S         +
Sbjct: 1   MGILTSMFTAVTGLSSYGNAMGVIGNNIANVGTAGFKSSRATFSDLISSSLGGGSGSDQI 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
             G+ ++       QGS+  T +  DLAI G GF++V+     N  +RAG F +++ G +
Sbjct: 61  GLGVFLNDVQTNFSQGSMTTTGNTFDLAIDGNGFYLVRNTSGANFYSRAGQFKVDSLGQV 120

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
            + +G +L GY                L       + +  + TT+  I  NL+ NAT  T
Sbjct: 121 VDSSGALLQGYQADTNGNITSTIGGITL-----TSSAVPPVATTSAEILGNLNANATAPT 175

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
              +         Y   +    YD+LG+S    +Y+ KT    W V              
Sbjct: 176 AAFSITDTT---SYNFSTGMTFYDSLGNSHQMQLYFRKTAANAWGVYSQID--------- 223

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
              A      ++F+      A  +    +   N +   Q +T+D+S  TQ          
Sbjct: 224 -GGAAAAQTNMTFNASGAVTAGGTQTVTATLTNGATTPQAMTVDLSSLTQFGAASGVASQ 282

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             +G++ G     SV K+G V   + +G    + ++ ++   + D L     N +L T +
Sbjct: 283 TQDGYSSGTLDRISVDKEGRVMAQFTNGETRALAQVVLSRFTNPDGLVNVGDNHFLETVE 342

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG    G P  N  G + SG +E +NVD+  E  ++I  QR +  NS+   T  + +  L
Sbjct: 343 SGAALAGAPTINGLGRVLSGTVEQSNVDLGKEFVDMIITQRAFQANSRAITTSDEMLQEL 402

Query: 417 ISLKR 421
           ++LKR
Sbjct: 403 VNLKR 407


>gi|203284204|ref|YP_002221944.1| flagellar hook protein [Borrelia duttonii Ly]
 gi|201083647|gb|ACH93238.1| flagellar hook protein [Borrelia duttonii Ly]
          Length = 441

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 103/444 (23%), Positives = 181/444 (40%), Gaps = 30/444 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NI+NV+TVG+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNISNVNTVGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 +  G+ ++  D I  QGS   T   +DL I G GFFI++  DN    TRAG F 
Sbjct: 61  GVNPKQIGLGMTVAAVDTIHTQGSFQSTQKASDLGISGNGFFILRDGDNS-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGL--ERINVKHAELSAMPTTTGFISNN 167
           +++   L N A G+ +   +  +     V +      + I     +  A  T     + N
Sbjct: 120 VDSNRHLVNPANGMRIQGWMAESVGGEQVFNTSSDIRDLIIPIGDKEGAKATEYITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   ++          R    T   +   YD+ G++ V ++   K        +    
Sbjct: 180 LDKRLPVVQQGANEVDIARG---TWVVNKTVYDSFGNTNVVELRVLKDATTPNTWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS----- 282
                NS            +S +   G   +     I+F    +   +     ++     
Sbjct: 237 VNGEENSNFTMGFDNEGALLSLNGQAGQPGDLLEFPITFGVIDANAGEGGEQTVNLRLGT 296

Query: 283 ------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
                   TQ A     +    NG+  G  +++ + ++G +  +Y +G R  I ++A+A+
Sbjct: 297 VGSYADSITQFADASTTKAIVQNGYGMGYMENYEIDQNGVITGVYSNGIRRTIGKIALAS 356

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L       +  T +SG   IG  G    G I SG LE +NVD+A + T++I  Q
Sbjct: 357 FVNPGGLAKAGDTNFTETSNSGQARIGETGFAGLGTIRSGVLEMSNVDLAEQFTDMIVTQ 416

Query: 397 RNYAVNSKVFQTGSDFMDILISLK 420
           R +  N+K   T    +  L+ LK
Sbjct: 417 RGFQANAKTITTSDQLLQELVRLK 440


>gi|30248322|ref|NP_840392.1| flagellar hook protein FlgE [Nitrosomonas europaea ATCC 19718]
 gi|30138208|emb|CAD84216.1| Flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
          Length = 410

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 98/417 (23%), Positives = 181/417 (43%), Gaps = 11/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS--YVSGGLEIS 63
             +  +SG+ A S ++    +NIAN +TVG+K++   F+ +   +       +  G +++
Sbjct: 2   GFQHGLSGLKAASAKLDVTGNNIANANTVGFKQSQAQFADVYANALGGGRNQIGIGTQLA 61

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG++  T +  D+AI G GFF     +     TR G FH++ +GFL N +   
Sbjct: 62  AVAQEFNQGNVTPTNNPLDVAITGNGFFR-MDNNGSISFTRNGQFHLDKDGFLVNASNYN 120

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           + G+    +   +          + +  A+++  PTT+     NLD  A ++T       
Sbjct: 121 VTGFGADASGQIIPNI----PVNLRLPTADMTPNPTTSFMTGVNLDARADVVTDPFNV-- 174

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP-YNVAPL 242
                 YTH +S   +D+ G+S + ++Y+ KT    W V         + S         
Sbjct: 175 -ANPDTYTHSTSGEIFDSFGNSHILNLYFQKTAASTWGVYTAVDGTVVDPSTGLSGTDSP 233

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
            T+  +   +     +S+    +             +D++++TQ    F       +G A
Sbjct: 234 ITLSFNPSGIMTSTGSSTINVAASVLGAGVSPLAFELDLTRSTQFGSKFGVNVMSQDGFA 293

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   +S+S DG +   Y +     + +L +A   + + LK    N +  T +SG   +
Sbjct: 294 SGRLAGYSISDDGQIRASYSNNVTRTVGQLVLAGFSNPNGLKPLGSNQWGETAESGLPLV 353

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           G P     G + S A+E +NVD+ +EL  LI  QR Y  N+K  +T    M  ++++
Sbjct: 354 GTPETGVLGSLQSSAVEESNVDLTTELVTLIMTQRVYQANAKTIETQDAVMQTIMNI 410


>gi|238796904|ref|ZP_04640408.1| Flagellar basal body FlaE domain protein [Yersinia mollaretii ATCC
           43969]
 gi|238719164|gb|EEQ10976.1| Flagellar basal body FlaE domain protein [Yersinia mollaretii ATCC
           43969]
          Length = 407

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 106/414 (25%), Positives = 178/414 (42%), Gaps = 9/414 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A S  +  V +NIAN  TVG+K  +IAF+ +       S V  G+++S+ 
Sbjct: 2   GFSQGLSGLNAASQALDVVGNNIANSQTVGFKSGSIAFADVFA----GSQVGMGVQVSSV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
           +     G L   AS+ D+ IQG GFF +         +R G F  +  GF+ N  G  L 
Sbjct: 58  NQNFSDGVLGSGASSLDMGIQGNGFFRLTNEAGRVFYSRNGQFKQDENGFIINNQGMFLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY    +  P  +     +  I +   ++ A  +  G +S NLD    ++ P        
Sbjct: 118 GYQA--SGTPPAIQPGAAVGPIQIPSGQMPARASDGGSLSGNLDSGTEVVDPAI-KFDPA 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y+  S    YD+LG+    +VYY KT D +W+           ++          +
Sbjct: 175 DNKSYSSVSQVDGYDSLGNRHTINVYYVKTSDNEWKAYSSDTTSPKLDN--NGDPVYQEL 232

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           E+ FD         +  ++       G      +D+   TQ A           G+APG+
Sbjct: 233 ELKFDTSGQLTTKPAKLSVQSAAYNGGEPLDFELDMDGMTQQASDTAMASPTTTGYAPGQ 292

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              ++V  +G +   Y +G +  + ++ ++   +   L     N +  T  SG    G  
Sbjct: 293 MNGYTVGDNGQIIASYSNGQQQLLGQVVLSNFTNPGGLSSQGDNCWSETPASGQPVDGIA 352

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           G    G +F   LE +NVD++ E+  +I  QRNY  NS+  +T S+ + IL +L
Sbjct: 353 GTGNLGNLFGNRLEASNVDLSKEMVNMIVYQRNYQSNSQTIKTQSELLQILANL 406


>gi|254524254|ref|ZP_05136309.1| flagellar biosynthesis hook protein [Stenotrophomonas sp. SKA14]
 gi|219721845|gb|EED40370.1| flagellar biosynthesis hook protein [Stenotrophomonas sp. SKA14]
          Length = 407

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 100/419 (23%), Positives = 179/419 (42%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
               ++SG++A ++ +S  ++N+ANV+T G+K +   F+ L   +      + V  G+ +
Sbjct: 2   GFNVSLSGINAANSDLSVTANNVANVNTTGFKESRAEFADLFSATGYGLSKNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S      +QG    T  + D+AI G+GFF     +     +RAG+F  +  GF+ N  G 
Sbjct: 62  SNVAQQFKQGHNEQTGRSLDMAISGEGFFT-MNMNGTRVYSRAGNFQTDASGFVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +                L+ +        + P  T  +       A    P  T  
Sbjct: 121 RLQVFAPNADGTNFDSGRIVDLQLL-----TTDSAPKQTSEVKVGFTLPANAKPPTVTTF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                  Y H S     YD+LG S +   Y+ K      E ++           P  V  
Sbjct: 176 DPTDSNTYNHSSGGITVYDSLGVSHIQVSYFVKG-ANPNEWTVRNYVDGQPAGTPTPVTF 234

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            N+ ++          +      +F  NT      +T+DI+ +TQ    F  + ++ +G+
Sbjct: 235 DNSGKLIAPT------DGKVSLGTFTPNTGAGQLNMTLDITGSTQYGEKFALRNTQQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + +VS+ G V   Y +G   P+ ++A+ T  +   L+    N ++ T  SG   
Sbjct: 289 AAGKLNEITVSETGVVYARYSNGADKPLGQVALTTFNNPQGLESKGNNLWVDTFSSGTPR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G+I +G+LE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 349 TGMPDTSNLGKIQAGSLEASTVDLTEQLVNMITAQRNFQANAQMITTQDQITQTVINIR 407


>gi|301168104|emb|CBW27690.1| putative flagellar hook protein [Bacteriovorax marinus SJ]
          Length = 426

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 104/436 (23%), Positives = 178/436 (40%), Gaps = 25/436 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----SNSYV 56
           MGIL S    ++G++A    +  + DNIAN  T G+K +   F  ++  S          
Sbjct: 1   MGILRSFNIGVTGLNAVGQGMGVIGDNIANAGTNGFKSSRAEFQDVLATSLKGIDGGDQF 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
             G +++    +  QG +  T + TDLA+ G GFF V         TR G FH N EG L
Sbjct: 61  GAGTKLAHIKTLMTQGDVARTDNITDLAVNGDGFFKVNAPFGK-GFTRDGSFHFNKEGEL 119

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT 176
            N  G  ++G+            +      + +    + A  +     + NLD  A I  
Sbjct: 120 VNSDGYQVIGFEADETGKITNKEA-----PVKLGSTTIPAKASEKVNFNLNLDSRAEIKE 174

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
            +               +S   YD +G++ +  +YY KTGD +W                
Sbjct: 175 FNIADPDA----TSNFSNSVTVYDNVGTARLVTMYYNKTGDNQWTYRALVDGADVEGGES 230

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS-----------KTT 285
                +    + F+                 +  +  DQ+IT +              +T
Sbjct: 231 GQFVEMAQGNIIFNNKGQLQEEVEGSNSFNFNKGAAPDQKITFNFGESISEGGEGIGAST 290

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
           Q   G    +   +G +       S +  G +  +YD+G    I ++A+A   + + L  
Sbjct: 291 QYGSGSAIARHSQDGFSAATLASMSFNDAGILTAVYDNGESRDISQIAVAKFENNEGLFK 350

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N    +R+SG+ ++G PG +  GE+ S ++E +NVDIA+E   L+ AQRN+  N+K 
Sbjct: 351 VGKNLMKESRNSGEAAMGKPGESGRGEVLSKSIELSNVDIANEFVGLMTAQRNFQANAKT 410

Query: 406 FQTGSDFMDILISLKR 421
             T  + +  ++++KR
Sbjct: 411 LTTADEMLQQVLNIKR 426


>gi|296126058|ref|YP_003633310.1| fagellar hook-basal body protein [Brachyspira murdochii DSM 12563]
 gi|296017874|gb|ADG71111.1| fagellar hook-basal body protein [Brachyspira murdochii DSM 12563]
          Length = 441

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 95/445 (21%), Positives = 172/445 (38%), Gaps = 30/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  V +NIANV+T G+KR  + F  ++  S S +        
Sbjct: 1   MMRSLFAGVSGLQNHQTRMDVVGNNIANVNTYGFKRGRVTFKDMISQSLSGAAKPQEDRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+L  T  NTDLAIQG+GFFI K  +N    TR G F 
Sbjct: 61  GINPQQVGLGMMVATIDTIHTQGALQVTGVNTDLAIQGEGFFIEKRGNNS-YYTRNGAFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGL----ERINVKHAELSAMPTTTGFIS 165
           ++ +G+L N + G  +       +               + I    ++  A  T      
Sbjct: 120 LDRDGYLVNPSIGYKVQGWNAVLNPETGEMELNTAAGVEDLIIPVGSKDPARATANTKYF 179

Query: 166 NNLDKNATIITPDKTPKHNGR---------DAEYTHKSSFAAYDTLGSSVVYDVYYTKTG 216
            NL K+      D T   +                ++          +     V      
Sbjct: 180 CNLQKSGETHQSDLTIYDSTGIPRQLRATFTRTDVNRWDMTIDIPDATEGSVSVSAGDPV 239

Query: 217 DKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ 276
           +     +         +    +       E    P   +    +   ++   N   +   
Sbjct: 240 EGGGNNTFQLVFNDAGSLISVSDGTNTQTEGVLMPNVSFTYQGTEGEVNQTIN---LTMG 296

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
                +  TQ       +  E +G+  G  + FS    G +  ++ +G R  + ++A+A 
Sbjct: 297 EVGLFNGITQFESPSTTKAIEQDGYTMGMLEGFSFDDSGQITGVFTNGNRKTLGQVALAK 356

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L+      ++ + +SG  +IG       G + +GALE +NVD++ + T++I  Q
Sbjct: 357 FNNAGGLEKAGDTLFVASNNSGAANIGTAAAEGRGSLKAGALEMSNVDLSEQFTDMIVTQ 416

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           R +  N++   T    +  +I+LKR
Sbjct: 417 RGFQSNARTITTADQMLQEVIALKR 441


>gi|319764539|ref|YP_004128476.1| flagellar hook-basal body protein [Alicycliphilus denitrificans BC]
 gi|330826755|ref|YP_004390058.1| flagellar hook-basal body protein [Alicycliphilus denitrificans
           K601]
 gi|317119100|gb|ADV01589.1| flagellar hook-basal body protein [Alicycliphilus denitrificans BC]
 gi|329312127|gb|AEB86542.1| flagellar hook-basal body protein [Alicycliphilus denitrificans
           K601]
          Length = 426

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 96/426 (22%), Positives = 173/426 (40%), Gaps = 12/426 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF---PSTSNSYVSGGLEI 62
             +  +SG++A S  +  +  NIAN +TVG+K +   F+S+V     + S      G+++
Sbjct: 2   GFQQGLSGLNASSKNLDVIGHNIANSNTVGFKASRTEFASMVATAIGTASTGNAGIGVQV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                   QG++  T +N D+AI G GFF ++  D     TRAG+F ++++G +    GG
Sbjct: 62  GAVAQQFTQGNITVTGNNLDVAINGNGFFKIQQPDGSFAYTRAGNFKLDDKGNVITNNGG 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GYP+   +     ++ Q L              +     + +         P  TP 
Sbjct: 122 KVMGYPMDPITQTRTASTPQPLVFPTGAPIPAKQTTSIKATFNLDARAPDAAGNPSATPP 181

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                   T+ +S   YD+ G +    +Y+ KTG         R D              
Sbjct: 182 IAATPRS-TYGTSLNVYDSQGVATPVSLYFQKTGTANTWDVYDRLDDPNATPPVVATPIG 240

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGI--------DQQITIDISKTTQLAGGFIPQ 294
                +   +TG  A             +             + +++   TQ    F   
Sbjct: 241 QITFDNNGQITGPAATPPATGFQLPITIAPPTPNPNNLPAYTVQVNLDGVTQFGAKFAVS 300

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G+  G+    ++  DG +   Y +G      ++A+A+  +   L     N ++ T
Sbjct: 301 DLTQDGYTAGQLTGINIGDDGTIMTSYSNGVTRAEGQIALASFRNAQGLADIGNNLWVET 360

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SG   +G       G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T    M 
Sbjct: 361 FESGQPVMGVATEGAFGALRSGALEDSNVDLTAELVNMMTAQRAYQANAQTIKTQDQVMS 420

Query: 415 ILISLK 420
            L++L+
Sbjct: 421 TLVNLR 426


>gi|86157813|ref|YP_464598.1| hypothetical protein Adeh_1387 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774324|gb|ABC81161.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 428

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 104/435 (23%), Positives = 173/435 (39%), Gaps = 21/435 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS--TSNSYVSG 58
           M +L ++ +  +G+ A S  +S V DNIAN +TVG+K    AF   +  +    +  V  
Sbjct: 1   MSLLTALSSGTTGLQASSLELSVVGDNIANANTVGFKSGRAAFEDALSQTVIGGSGQVGL 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFF---IVKGRDNVNCLTRAGDFHINNEGF 115
           G  ++    I  QG+L  T   TDLA+QG GFF              TR G F ++++G+
Sbjct: 61  GARLAGVQKILTQGALASTGLATDLALQGNGFFVVRGAHAGQTGTFYTRDGQFTVDDDGY 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L N+ G  + G+P                + + V  A      TT   +  NL  +A + 
Sbjct: 121 LVNLEGLRVQGFPAD-----PSGAVAGLPDDLLVGTASAQPRATTRLTLKANLQADAAVP 175

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
                P + G        ++   YD LG+     VY+ KTGD  W+              
Sbjct: 176 AAAWDPANPGA--TSNFSTTMTVYDALGAGHAVQVYFRKTGDGAWDWHALTDGAGVAGGT 233

Query: 236 PYNVAPLNTVEVSFDP---------VTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQ 286
              +  +    ++F            + +           + +           ++  TQ
Sbjct: 234 AGQLTQIAGGTLAFGDGGELTSMTQTSSFTPAGQAAPQPLDFSFGDPTSAGGTGLAGVTQ 293

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            +          +G+  G+     V  +G +  ++ +G    + ++A+A   + D L   
Sbjct: 294 FSATSASTFIGQDGYGSGQLASVRVGPEGVISGVFTNGQTRVLGQVAVAGFAAPDQLDRA 353

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN    T  SG   +G  G      I +G+LE +NVD+A +   LI AQR +  NSK  
Sbjct: 354 GGNLLQQTPGSGQPVVGAAGAGGRASIVAGSLEQSNVDLAEQFVRLIAAQRAFQANSKTI 413

Query: 407 QTGSDFMDILISLKR 421
            T    +  LI++KR
Sbjct: 414 TTADQLLSELIAMKR 428


>gi|190574263|ref|YP_001972108.1| flagellar hook protein FlgE [Stenotrophomonas maltophilia K279a]
 gi|190012185|emb|CAQ45808.1| putative flagellar hook protein [Stenotrophomonas maltophilia
           K279a]
          Length = 407

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 98/419 (23%), Positives = 179/419 (42%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
               ++SG++A ++ +S  ++N+ANV+T G+K +   F+ L   +      + V  G+ +
Sbjct: 2   GFNVSLSGINAANSDLSVTANNVANVNTTGFKESRAEFADLFSATGYGLSKNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S      +QG    T  + D+AI G+GFF     +     +RAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFKQGHNEQTGRSLDMAISGEGFFT-MNMNGTRVYSRAGNFQTDASGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +                L+ +        + P  T  +       A    P  T  
Sbjct: 121 RLQVFAPNADGTNFDAGRMVDLQLL-----TTDSPPKQTSEVKVGFTLPANAKQPTVTTF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                  Y H S     YD+LG S +   Y+ K      E ++           P  V  
Sbjct: 176 DPTDSNSYNHSSGGITVYDSLGVSHIQVSYFVKG-ANPNEWTVRNYVDGQPAGAPTPVTF 234

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            N+ +++         +      +F   T      +T+D+S +TQ    F  + ++ +G+
Sbjct: 235 DNSGKLTAPA------DGKVSLGTFTPTTGAGVLNMTLDVSGSTQYGEKFALRNTQQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + +VS+ G V   Y +G   P+ ++A+ T  +   L+    N ++ T  SG   
Sbjct: 289 AAGKLNEITVSETGVVYARYSNGADKPLGQVALTTFNNPQGLESKGNNLWVDTFSSGTPR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G+I +G+LE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 349 TGMPDTSNLGKIQAGSLEASTVDLTEQLVNMITAQRNFQANAQMITTQDQITQTVINIR 407


>gi|268316347|ref|YP_003290066.1| hypothetical protein Rmar_0780 [Rhodothermus marinus DSM 4252]
 gi|262333881|gb|ACY47678.1| protein of unknown function DUF1078 domain protein [Rhodothermus
           marinus DSM 4252]
          Length = 415

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 109/433 (25%), Positives = 190/433 (43%), Gaps = 32/433 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ S++T +SG+ +   R+  +S+NIANV+T  +KR   AF+ L+  +            
Sbjct: 1   MIRSLRTGVSGLKSHQVRMDVISNNIANVNTTAFKRGRAAFNELLGQTLLGVGRTAGGRG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHI 110
            + SYV  G+ + + D+   QG+L +T   TDL I G GFF+V+G D    LTRAG+F I
Sbjct: 61  INPSYVGLGVSVGSIDVNFAQGALENTGVATDLGINGDGFFVVRGGD-RIYLTRAGNFTI 119

Query: 111 NNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           N  G L   +G  + G+                        A      T   ++  NL+ 
Sbjct: 120 NRFGELVTNSGLQVQGWAFDENGELQSAALEDVRVPF---SATAPPKQTENIYVRGNLNA 176

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQ 229
                               T   S   YD  G +    + +T+T    +W+ ++  +D 
Sbjct: 177 ELAAGE--------------TVTVSTVVYDPQGKAKTIIIEFTRTSNPNEWQWNLLDEDG 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
           +       +   L T +   +        +    I  +         +       TQ AG
Sbjct: 223 NPLGVTITSGDNLITFDTQGNLDPTEALQTFDWDIDNDGTLESFTLNLAGADDALTQYAG 282

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                  + +G  PG    FS++++G V++ + +G +  IY+LA+ +V + + L+    N
Sbjct: 283 STTATVRDQDGQPPGSLIGFSINQEGIVELNFSNGYQQKIYQLALGSVNNVNGLQQVGDN 342

Query: 350 TYLPTRDSGDISIGFPGHN-QHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
            +  T  SGD+++G  G       I +G LE +NVD+A+E T++I  QR Y  ++++  T
Sbjct: 343 LWSLTSSSGDLALGRAGVELNRTVIVAGTLEMSNVDLATEFTDMIVTQRGYQASARIITT 402

Query: 409 GSDFMDILISLKR 421
             + +  L+ LKR
Sbjct: 403 SDEMLQELVQLKR 415


>gi|312147981|gb|ADQ30640.1| flagellar hook protein FlgE [Borrelia burgdorferi JD1]
          Length = 442

 Score =  256 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------ 281
                NS             S +   G   +     I+FN   + + +            
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEAGEQQTVNLKLG 296

Query: 282 ------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                    TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFINPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|187918157|ref|YP_001883720.1| flagellar hook protein FlgE [Borrelia hermsii DAH]
 gi|119861005|gb|AAX16800.1| flagellar hook protein FlgE [Borrelia hermsii DAH]
          Length = 442

 Score =  256 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 104/445 (23%), Positives = 185/445 (41%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QGS   T   +DL I G GFFI++  +N    TRAG F 
Sbjct: 61  GVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFFILRDGNNS-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASA--PLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           ++++  L N A G+ +   +  +     +I  S    + +     +  A  T     + N
Sbjct: 120 VDSDRRLVNPANGMKIQGWMAKSIGGEQVINTSADVEDLVIPIGDKEGAKSTEYITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   I+    +     R    T   +   YD+ G++ V ++   K        +    
Sbjct: 180 LDKRLPIVEEGASEVDIARG---TWVVNKTIYDSFGNTSVVELRVVKDATTPNTWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS            +S +   G + +     I+F+   +                
Sbjct: 237 VNGEANSNFTMGFNNEGALLSLNGQAGQVGDLLEFPITFDVVNANAGEVGEQQTVNLRLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  +Y +G R  I ++A+A
Sbjct: 297 NVGSYTDSITQFADASTTKAIVQDGYGMGYMENYEIDQNGVITGVYSNGIRRDIGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       +  T +SG   IG  G    G I +G LE ANVD+A + T++I  
Sbjct: 357 SFVNPGGLAKAGDTNFSETSNSGQARIGETGFAGLGTIRAGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|111115108|ref|YP_709726.1| flagellar hook protein FlgE [Borrelia afzelii PKo]
 gi|216263795|ref|ZP_03435789.1| flagellar hook protein FlgE [Borrelia afzelii ACA-1]
 gi|110890382|gb|ABH01550.1| flagellar hook protein [Borrelia afzelii PKo]
 gi|215979839|gb|EEC20661.1| flagellar hook protein FlgE [Borrelia afzelii ACA-1]
          Length = 442

 Score =  256 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 102/445 (22%), Positives = 186/445 (41%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDVRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++  D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVAAIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGGNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +     R    T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPVIQEGASSADIARG---TWVVNKSLYDSFGNVSVLELRVVKDPNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +       +     I+FN   + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPSQKGDVLQIPITFNVLGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADASSTKAIIQDGYGMGYMENYEIDQNGIIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG   IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQARIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|51598543|ref|YP_072731.1| flagellar hook protein FlgE [Borrelia garinii PBi]
 gi|51573114|gb|AAU07139.1| flagellar hook protein [Borrelia garinii PBi]
          Length = 442

 Score =  256 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 104/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDSRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++++   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVIHTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   II    +     R    T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPIIEEGASSADIARG---TWVVNKSLYDSFGNVSVLELTVVKDLNTPNLWNAPVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTIGFDNEGALASLNGQPGQKEDILQIPITFNVVGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|194365680|ref|YP_002028290.1| flagellar hook protein FlgE [Stenotrophomonas maltophilia R551-3]
 gi|194348484|gb|ACF51607.1| flagellar basal body FlaE domain protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 407

 Score =  256 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 99/419 (23%), Positives = 179/419 (42%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
               ++SG++A ++ +S  ++N+ANV+T G+K +   F+ L   +      + V  G+ +
Sbjct: 2   GFNVSLSGINAANSDLSVTANNVANVNTTGFKESRAEFADLFSATGYGLSKNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S      +QG    T  + D+AI G+GFF     +     +RAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFKQGHNEQTGRSLDMAISGEGFFT-MNMNGTRVYSRAGNFQTDPSGYVINPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +                L+ +        + P  T  +       A    P  T  
Sbjct: 121 RLQVFAPNADGTNFDAGRMVDLQLL-----TTDSAPKQTSEVKVGFTLPANAKQPTVTTF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                  Y H S     YD+LG S +   Y+ K      E ++           P  V  
Sbjct: 176 DPTDSNSYNHSSGGITVYDSLGVSHIQVSYFVKG-ANPNEWTVRNYVDGQPAGAPTPVTF 234

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            N+ +++         N      +F   T      +T+D+S +TQ    F  + ++ +G+
Sbjct: 235 DNSGKLTAPA------NGKVSLGTFTPTTGAGVLNMTLDVSGSTQYGEKFALRNTQQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + +VS+ G V   Y +G   P+ ++A+ T  +   L+    N ++ T  SG   
Sbjct: 289 AAGKLNEITVSETGVVYARYSNGADKPLGQVALTTFNNPQGLESKGNNLWVDTFSSGTPR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G+I +G+LE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 349 TGMPDTSNLGKIQAGSLEASTVDLTEQLVNMITAQRNFQANAQMITTQDQITQTVINIR 407


>gi|89902477|ref|YP_524948.1| hypothetical protein Rfer_3717 [Rhodoferax ferrireducens T118]
 gi|89347214|gb|ABD71417.1| protein of unknown function DUF1078-like [Rhodoferax ferrireducens
           T118]
          Length = 404

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 101/418 (24%), Positives = 180/418 (43%), Gaps = 18/418 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGG---LEI 62
           S +T +SG++A S  +  + +NIAN +T G K +   F  LV  S      SG    + +
Sbjct: 2   SFQTGLSGLNASSRSLDVIGNNIANANTTGMKSSRAEFGDLVASSLGAGGSSGAGIGVAV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
            +      QG++  T ++ D+AI G GFF +   D     TR G F ++  G+++  +G 
Sbjct: 62  GSISQQFSQGNINITGNDLDVAINGGGFFQLALPDGSAAYTRDGSFKLDANGYIKTNSGA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            +LGYP         V                SA    +   + + + N     P  T  
Sbjct: 122 NVLGYPTDKTGKTTSVKPEILQLP-------TSAPIAASATTAISAELNLDARAPIATSV 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                   T+ +S  AYD+ G ++  ++Y++K          +    S   +   ++   
Sbjct: 175 TPPTPRS-TYGTSLTAYDSQGVTMPVNLYFSKVTPTTAGTDQWAVYDSPTGASVGSLVFD 233

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
            +  +    +       +  +I             T+D+SK TQ    F       +G+A
Sbjct: 234 ASGALQSSTMGSLTLTPAPPSIVPAFPV-------TVDVSKVTQFGAAFAVSNLTQDGYA 286

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
           PG+     + ++G +   Y +G      +L++A   +   L    GN+++ +  SGD  +
Sbjct: 287 PGELTGLKIGENGQITARYSNGQTQIAGQLSLADFRNVQGLSPIGGNSWVASYTSGDPVL 346

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G PG  + G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T    M  L++L+
Sbjct: 347 GSPGVGKFGALRSGALEESNVDLTAELVNMMTAQRAYQANAQTIKTQDQVMSTLVNLR 404


>gi|224533123|ref|ZP_03673723.1| flagellar hook protein FlgE [Borrelia burgdorferi WI91-23]
 gi|224511850|gb|EEF82251.1| flagellar hook protein FlgE [Borrelia burgdorferi WI91-23]
 gi|312149691|gb|ADQ29762.1| flagellar hook protein FlgE [Borrelia burgdorferi N40]
          Length = 442

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|195941363|ref|ZP_03086745.1| flagellar hook protein FlgE [Borrelia burgdorferi 80a]
 gi|221217779|ref|ZP_03589247.1| flagellar hook protein FlgE [Borrelia burgdorferi 72a]
 gi|224533707|ref|ZP_03674295.1| flagellar hook protein FlgE [Borrelia burgdorferi CA-11.2a]
 gi|225549062|ref|ZP_03770037.1| flagellar hook protein FlgE [Borrelia burgdorferi 94a]
 gi|225550122|ref|ZP_03771082.1| flagellar hook protein FlgE [Borrelia burgdorferi 118a]
 gi|226320584|ref|ZP_03796144.1| flagellar hook protein FlgE [Borrelia burgdorferi 29805]
 gi|221192456|gb|EEE18675.1| flagellar hook protein FlgE [Borrelia burgdorferi 72a]
 gi|224513000|gb|EEF83363.1| flagellar hook protein FlgE [Borrelia burgdorferi CA-11.2a]
 gi|225369234|gb|EEG98687.1| flagellar hook protein FlgE [Borrelia burgdorferi 118a]
 gi|225370288|gb|EEG99726.1| flagellar hook protein FlgE [Borrelia burgdorferi 94a]
 gi|226234003|gb|EEH32724.1| flagellar hook protein FlgE [Borrelia burgdorferi 29805]
          Length = 442

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|216264643|ref|ZP_03436635.1| flagellar hook protein FlgE [Borrelia burgdorferi 156a]
 gi|215981116|gb|EEC21923.1| flagellar hook protein FlgE [Borrelia burgdorferi 156a]
          Length = 442

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------ 281
                NS             S +   G   +     I+FN   + + +            
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEAGEQQTVNLKLG 296

Query: 282 ------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                    TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|300870390|ref|YP_003785261.1| flagellar hook protein FlgE [Brachyspira pilosicoli 95/1000]
 gi|300688089|gb|ADK30760.1| flagellar hook protein, FlgE [Brachyspira pilosicoli 95/1000]
          Length = 441

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 94/445 (21%), Positives = 174/445 (39%), Gaps = 30/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  V +NI+NV+T G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLFAGVSGLQNHQTRMDVVGNNISNVNTYGFKKGRVTFKDMISQSLSGAAKPQEDRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G++++T D I  QG+L  T  NTDLAIQG+GFFI K  +  +  TR G F 
Sbjct: 61  GINPQQVGLGMQVATIDTIHTQGALQVTGVNTDLAIQGEGFFIEKKGN-SSYYTRNGAFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGL----ERINVKHAELSAMPTTTGFIS 165
           I+  G+L N + G  +       +    +          + I    ++  A  T      
Sbjct: 120 IDKNGYLVNPSNGYKVQGWNAVLNPETGMMELNTAAGVEDLIIPVGSKDPARATQNTKFF 179

Query: 166 NNLDKNATIITPDKTPKHNGR---------DAEYTHKSSFAAYDTLGSSVVYDVYYTKTG 216
            NL KN+     D T   +           +    ++          +     V      
Sbjct: 180 CNLQKNSDTHQADLTIYDSTGIPRQLRATFNRTDVNRWDMVIEIPEATEGSVSVSAGDPV 239

Query: 217 DKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ 276
           +     +         +    +       E    P   +    +   ++   N   +   
Sbjct: 240 ENGGNNTFQLVFNDAGSLISVSDGTNTQTEGVLMPNVSFTYTGTDGEVNQTIN---LTMG 296

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
                +  TQ       +  E +G+  G  + FS    G +  ++ +G R  + ++A+A 
Sbjct: 297 EVGLFNGITQFESPSTTKAIEQDGYTMGMLEGFSFDDSGQITGVFTNGNRKTLGQVALAK 356

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L+      ++ + +SG  +IG       G I +G LE +NVD++ + T++I  Q
Sbjct: 357 FANAGGLEKAGDTLFVESNNSGAANIGVAAAEGRGSIKAGTLEMSNVDLSEQFTDMIVTQ 416

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           R +  N++   T    +  +I+LKR
Sbjct: 417 RGFQANARTITTADQLLQEVIALKR 441


>gi|218249383|ref|YP_002374806.1| flagellar hook protein FlgE [Borrelia burgdorferi ZS7]
 gi|218164571|gb|ACK74632.1| flagellar hook protein FlgE [Borrelia burgdorferi ZS7]
          Length = 442

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 188/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I            A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAN---PADIARGTWVVNKSLYDSFGNVGVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|15594628|ref|NP_212417.1| flagellar hook protein FlgE [Borrelia burgdorferi B31]
 gi|223889009|ref|ZP_03623600.1| flagellar hook protein FlgE [Borrelia burgdorferi 64b]
 gi|226321601|ref|ZP_03797127.1| flagellar hook protein FlgE [Borrelia burgdorferi Bol26]
 gi|2494528|sp|Q44767|FLGE_BORBU RecName: Full=Flagellar hook protein flgE
 gi|1165267|gb|AAA85606.1| FlgE [Borrelia burgdorferi]
 gi|2688183|gb|AAC66665.1| flagellar hook protein (flgE) [Borrelia burgdorferi B31]
 gi|223885825|gb|EEF56924.1| flagellar hook protein FlgE [Borrelia burgdorferi 64b]
 gi|226232790|gb|EEH31543.1| flagellar hook protein FlgE [Borrelia burgdorferi Bol26]
          Length = 442

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 188/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I            A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAN---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|225552055|ref|ZP_03772995.1| flagellar hook protein FlgE [Borrelia sp. SV1]
 gi|225371053|gb|EEH00483.1| flagellar hook protein FlgE [Borrelia sp. SV1]
          Length = 442

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGKKVINTASDIEDLIIPIGDKEGARSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------ 281
                NS             S +   G   +     I+FN   + + +            
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEAGEQQTVNLKLG 296

Query: 282 ------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                    TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSVTQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRELGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|219684598|ref|ZP_03539541.1| flagellar hook protein FlgE [Borrelia garinii PBr]
 gi|219671960|gb|EED29014.1| flagellar hook protein FlgE [Borrelia garinii PBr]
          Length = 442

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDSRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   II    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPIIEEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTIGFDNEGALASLNGQPGQKGDVLQIPITFNVVGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  +Y +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGVYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|219685755|ref|ZP_03540566.1| flagellar hook protein FlgE [Borrelia garinii Far04]
 gi|219672694|gb|EED29722.1| flagellar hook protein FlgE [Borrelia garinii Far04]
          Length = 442

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/445 (23%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDSRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   II    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPIIEEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------ 281
                NS             S +   G   +     I+FN   + + +            
Sbjct: 237 INGEQNSNFTIGFDNEGALASLNGQPGQKGDVLQIPITFNVVGANVGEAGEQQTVNLKLG 296

Query: 282 ------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                    TQ A     +    +G+  G  +++ + ++G +  +Y +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGVYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|121997319|ref|YP_001002106.1| flagellar basal body FlaE domain-containing protein [Halorhodospira
           halophila SL1]
 gi|121588724|gb|ABM61304.1| flagellar basal body FlaE domain protein [Halorhodospira halophila
           SL1]
          Length = 418

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 100/423 (23%), Positives = 185/423 (43%), Gaps = 14/423 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY---VSGGLEI 62
           S   +++G+++ S  +   S+N+AN  T G+K +   F+ L            V  G  +
Sbjct: 2   SFNISLTGINSASKDLETTSNNLANAGTTGFKESRAEFNDLFAMGPMGIPQLAVGQGSRL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +  QGS   T  + DL I+G+GFF ++  D     TRAG F ++ +G++ N  G 
Sbjct: 62  ANVGQMFSQGSFDFTERSLDLGIEGRGFFRMED-DGEVSYTRAGQFEVDRDGYIVNNTGK 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L G+               G +++ +    + A  +    I+ NL  +A +I  +    
Sbjct: 121 RLTGFQTDEDG----SRIGDGRDQLQLPTDGIPARASENVEIAANLSADADVID-EGVAF 175

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP- 241
               +  +T  ++   YD+ GS+     Y+ K G+ +W+V           +        
Sbjct: 176 DPDDNETFTESTTTTLYDSQGSARDATFYFRKVGNNEWDVYTQVDGVDYEQADTEGDYFG 235

Query: 242 ----LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
                     S     G                   D  + ID  + TQ A  F      
Sbjct: 236 PHRLSFDTSGSLVDAEGDDEGRIASLEDVPLLAEVDDLDLDIDFGEMTQFARPFNVTNVS 295

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+A G+ ++ +V  DG +   Y +G    + ++A+ + PSE+ L+     ++  TRD+
Sbjct: 296 QDGYAAGEFENINVEGDGTILARYSNGEAQAVGQVALTSFPSEEKLQSVGETSWQATRDA 355

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           GD  IG PG  Q G + +GALE +NV+++ +L  +I AQRN++ N+++  T       ++
Sbjct: 356 GDPLIGVPGQGQFGRVENGALEQSNVEVSDQLVNMITAQRNFSANAQMVSTQDQVTQEIL 415

Query: 418 SLK 420
           +++
Sbjct: 416 NIR 418


>gi|119503644|ref|ZP_01625727.1| flagellar hook protein [marine gamma proteobacterium HTCC2080]
 gi|119460706|gb|EAW41798.1| flagellar hook protein [marine gamma proteobacterium HTCC2080]
          Length = 410

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 118/417 (28%), Positives = 182/417 (43%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY-VSGGLEIST 64
           +  TA+SG+ A    +  +S+NIAN  TVG+K +   F+ +   S S       G+E++ 
Sbjct: 2   AFSTAISGIKAAQANLDVISNNIANASTVGFKASRAQFAEIYASSVSGGSNAGQGVELTE 61

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QGSL  T S  DLAI G GFFIV      +  TRAG F ++ +GFL N +G  L
Sbjct: 62  IRAEFSQGSLDFTGSGLDLAISGNGFFIV-SNAGASEYTRAGSFQVDRDGFLTNESGNRL 120

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY                L  + +    +    T+   I++NLD    +  P       
Sbjct: 121 QGYQ-----GNTDGVITGELGDLFIDTTLVDPKVTSKVTITSNLDSREAV--PTTATFAP 173

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVAPLN 243
                Y   +S   YD+LG+S V  +YY K      W+V       +   +         
Sbjct: 174 TDPTSYNSTTSTTIYDSLGNSHVLQLYYVKQSAANTWKVHTSVDGGTPPAATTITFDSDG 233

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
           T+  +          ++    +    T       ++DI  TTQL   F    +  +G+  
Sbjct: 234 TLATNSANAISITTPANELLSASGVATGAAALAYSVDILATTQLGSDFSVNSAIQDGYGA 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+   F     G     Y +G    I ++A+A+  + + L+   G+ Y+ +  SG  +IG
Sbjct: 294 GQLISFEFDDSGTAFARYTNGQSRAIGQVALASFRNNNGLQPVGGSNYVESFGSGGPNIG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            PG++  G I S A+E ANVDI  EL  LI AQRN+  N++V  T       +I+L+
Sbjct: 354 VPGNSGRGNIQSSAVEQANVDITQELVNLIVAQRNFQANAQVISTEDQATQAVINLR 410


>gi|15964432|ref|NP_384785.1| flagellar hook protein FlgE [Sinorhizobium meliloti 1021]
 gi|307311574|ref|ZP_07591215.1| fagellar hook-basal body protein [Sinorhizobium meliloti BL225C]
 gi|20141447|sp|Q9X5Y0|FLGE_RHIME RecName: Full=Flagellar hook protein flgE
 gi|15073609|emb|CAC45251.1| Flagellar hook protein [Sinorhizobium meliloti 1021]
 gi|306899591|gb|EFN30220.1| fagellar hook-basal body protein [Sinorhizobium meliloti BL225C]
          Length = 406

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 169/422 (40%), Positives = 232/422 (54%), Gaps = 17/422 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + SY SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +   +  IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N +
Sbjct: 61  QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAS 120

Query: 121 GGVLLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P +V +   GL R+N+    L A  +T G +  NL   A +     
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASDGLIAAGSTKGSMGANLPSGAPVGDVST 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T                  YD+ G++ + D  Y KTG   W + I  +      + P   
Sbjct: 181 TS--------------LVVYDSQGNTRILDFNYEKTGANAWTLEIVDRASGDALTVPPVT 226

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
              N            +AN +   I     T  +   ITID SKTTQL   F      I+
Sbjct: 227 LAFNAAGELTTSPATVVANGA--LIVPPPATGAVVGSITIDFSKTTQLGYAFNADGGSID 284

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP K   + +  DG V + Y++G   P YR+A+A V S D L+   GN Y    DSG 
Sbjct: 285 GNAPSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLRPESGNVYSQGVDSGV 344

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L++L
Sbjct: 345 IITGFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVLVNL 404

Query: 420 KR 421
           KR
Sbjct: 405 KR 406


>gi|253990127|ref|YP_003041483.1| flagellar hook protein FlgE [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781577|emb|CAQ84740.1| flagellar hook protein flge [Photorhabdus asymbiotica]
          Length = 404

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 101/417 (24%), Positives = 181/417 (43%), Gaps = 16/417 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K ++ AF+ +       S V  G+++S  
Sbjct: 2   AFSQAVSGLNAAAANLDVIGNNIANAATYGFKSSSAAFADIFA----GSQVGLGVKMSGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
           +   + G+   T    D+AI   GFF ++  D     +R G+F ++    + N+ G  L 
Sbjct: 58  NQNFKDGTPTTTNRTLDMAITQGGFFRMQSSDGTIRYSRNGEFKLDENRNIINMQGMKLT 117

Query: 126 GYP-LKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP +        +      E I +    LSA  TT   ++ NL+      T   +P+  
Sbjct: 118 GYPAVSVNGGAPEIQKGANPEPITISQDMLSAKATTKVTMTANLNSMHKKTTGAFSPEEA 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y + +S   +D+LG+     V++ KT D +W+V           +          
Sbjct: 178 D---SYNYTTSVTTFDSLGNPHNVRVFFVKTNDNEWQVHAQDSTVEGAKAASLGT----- 229

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF-IPQKSEINGHAP 303
             + FD     + +++    +           ITID + + Q           + +G+A 
Sbjct: 230 --LKFDGNGKLIGDNNQFTFNVPSLNGSNAADITIDFNGSKQQKIDADSILAPKQDGYAA 287

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           GK   + + KDG V   Y +     + ++ +    + + L     N ++ T  SG   IG
Sbjct: 288 GKFNGYRIEKDGRVIGTYSNLQSQVLGQIVLTNFANPEGLAAQGDNVWVETGASGSSIIG 347

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G    GE+ S  LE +NVD++ EL  +I AQRNY  N++  +T    +  L+S++
Sbjct: 348 IAGSGGFGELLSSTLEASNVDMSKELVNMIVAQRNYQSNAQTIKTQDQILQTLVSMR 404


>gi|239817165|ref|YP_002946075.1| flagellar basal body FlaE domain protein [Variovorax paradoxus
           S110]
 gi|239803742|gb|ACS20809.1| flagellar basal body FlaE domain protein [Variovorax paradoxus
           S110]
          Length = 404

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/417 (25%), Positives = 175/417 (41%), Gaps = 16/417 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG+ A +  +  + +NIAN  TVG+K  A  F  +       S V  G+ +S  
Sbjct: 2   GFSQGISGLSAAAANLDVIGNNIANSGTVGFKSGAATFQDVYA----GSRVGLGVAVSGI 57

Query: 66  DMISEQGSLMHTASNTDLAI-QGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                QGS+  ++   D+AI  G GFF +         +R G F  + +GF+ N AG  L
Sbjct: 58  VQNFTQGSVQTSSRPLDVAILNGDGFFRLSSPSGEVMYSRNGQFTRDKDGFIVNAAGLRL 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +                 + V+   +S   TT    + NLD   T+ T       +
Sbjct: 118 TGYGVSATGGL----DGGTPGPLQVQTTAMSPKATTAINATFNLDARGTVPTKTPFSATD 173

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y++      +D+LG+     V++ KTG   W+V       + N   P +    + 
Sbjct: 174 SATFNYSNALG-PVFDSLGNPHELGVFFVKTGANAWDVYGAADGSALNGGAPISTMSFDG 232

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                 P  G L        + N     +    T+D+S TTQ       +  + +G+  G
Sbjct: 233 NGNLLTPAGGKL-----TLPTMNFGNGSVALNATVDLSGTTQFGNVNEIKTLKQDGYTSG 287

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               FS++ DG +   + +     + ++ + +  + + L+    N +  T  SG    G 
Sbjct: 288 TLTSFSINPDGTITGKFSNEQTTLMGQVVLTSFANPNGLEPMGENVWGETLASGQPLTGT 347

Query: 365 PGHNQH-GEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           PG     G + SGALE +NVD+ SEL  LI AQR+Y  N++  +T    +  LI+++
Sbjct: 348 PGAGTKQGSLASGALEASNVDLTSELVNLIVAQRSYQANAQTVKTQDQVVQTLINIR 404


>gi|226327746|ref|ZP_03803264.1| hypothetical protein PROPEN_01619 [Proteus penneri ATCC 35198]
 gi|225203450|gb|EEG85804.1| hypothetical protein PROPEN_01619 [Proteus penneri ATCC 35198]
          Length = 406

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 180/415 (43%), Gaps = 10/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NI+N  T G+K  +++F+ +   S +      G++++  
Sbjct: 2   SFSQAVSGLNAAAANLDTIGNNISNSATYGFKGASVSFADVFAGSGA----GLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + GS+  T   TD+AI G GFF ++ ++     +R G+F  +  GFL N+ G  + 
Sbjct: 58  SQNFKDGSITTTNRPTDVAISGGGFFRIEDQNGGVFYSRNGEFGKDKNGFLTNMQGMRVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+++     +V        I +    ++A  T    ++ NL+     I       +  
Sbjct: 118 GYPVQSVDGKNVVQKGATPTPIVIPTDMMNASATDKVDMTVNLNSAEEPIDQTTHAFNPK 177

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y   ++   YD+LG+    ++++ KT D +WEV                +   N  
Sbjct: 178 DNDSYNFSTNVTTYDSLGNEHNLNLFFVKTKDNEWEVHAQDSTTGEPAQNLGKLVYKNNG 237

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            +         A S     + +   S            T Q        K   NG+  G+
Sbjct: 238 VLD------ETATSIKNFTTVSYKGSETMDMAMNFTGSTQQKVAESSVSKLAQNGYQAGE 291

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
             +F + +DG +   Y +     + ++A+A   +   L     N +  T  SG   +G  
Sbjct: 292 FTNFRIEQDGSIMATYSNQQSQVVGQIALANFANAGGLSSQGDNMWSETNGSGSPIVGVA 351

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ + ALE +NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 352 GSGVFGKLTNNALEASNVDMSQELVNMIVAQRNYQSNAQTIKTQDQILQTLVSLR 406


>gi|200390428|ref|ZP_03217039.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199602873|gb|EDZ01419.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 403

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 174 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPTTAST 228

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 229 TLKFNENGILESGGTVDIETGEINGATKATFSLSFLNSMQQNTGANNIVATNQNGYKPGD 288

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 289 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 348

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 349 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 403


>gi|237653583|ref|YP_002889897.1| flagellar basal body FlaE domain protein [Thauera sp. MZ1T]
 gi|237624830|gb|ACR01520.1| flagellar basal body FlaE domain protein [Thauera sp. MZ1T]
          Length = 450

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 110/450 (24%), Positives = 181/450 (40%), Gaps = 36/450 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YVSGGLE 61
           S +  +SG+   S  +  +S+N+AN +T+G+K  +  FS +   S + S     V  G  
Sbjct: 2   SFQQGLSGLSVSSKALDIISNNVANTNTIGFKTGSAIFSDVFAASLTGSISGKQVGVGAT 61

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           +        QG+L  T +  DLAI G GFF+V   +  +  TR G F ++ EGF+    G
Sbjct: 62  LGAVRQTFTQGNLTTTNNPLDLAINGDGFFVVSRENGPDVYTRNGQFELDKEGFIRTPTG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA--------- 172
             L G+        L      GL+ + V       MPT+   I  NLD N          
Sbjct: 122 ERLKGFQSPVTPGALPT-PIGGLKDVQVPIVGSQPMPTSRVEIGGNLDANDLSAAQRYPQ 180

Query: 173 ----TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK----------TGDK 218
               T   P    ++      Y   +S  AYD+LG S     Y+ K          T + 
Sbjct: 181 LFGSTFTFPLPAGENWQDARTYNFSTSIKAYDSLGKSHELTYYFAKVTPTPNDPVNTNEN 240

Query: 219 KWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANS--------SHKAISFNDNT 270
            W+V                     +V  S         N+        +  AI  +   
Sbjct: 241 TWKVFTSVDGGYPLGVGTDGSIEDPSVIWSLTFNEKGTVNTPIVGPTAANPLAIPASYTP 300

Query: 271 SGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
                +  +D S   Q+ G ++  +   +G+  G+    SV +DG V   Y +G    + 
Sbjct: 301 GADRIRFHVDFSDMRQIGGSYLITELTQDGYTGGELAGVSVGRDGIVTGRYTNGETRELA 360

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
           +LA+ T  + + L     N +  T +SG  +    G    G + +G +E ANV++ +EL 
Sbjct: 361 QLALQTFRNPNALLSIGNNFWEATTESGLTAPSKAGEGVAGVVSAGMIEDANVELTNELV 420

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ++I  QRNY  N++  +     +  L++L+
Sbjct: 421 QMIVQQRNYQANAQSIKAQDQVLQTLVNLR 450


>gi|203287743|ref|YP_002222758.1| flagellar hook protein [Borrelia recurrentis A1]
 gi|201084963|gb|ACH94537.1| flagellar hook protein [Borrelia recurrentis A1]
          Length = 441

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 106/444 (23%), Positives = 182/444 (40%), Gaps = 30/444 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NI+NV+TVG+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNISNVNTVGFKKGRVNFQDMISQSISGASRPTDGRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 +  G+ ++T D I  QGS   T   +DL I G GFFI++  DN    TRAG F 
Sbjct: 61  GVNPKQIGLGMTVATVDTIHTQGSFQSTQKASDLGISGNGFFILRDGDNS-FYTRAGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGL--ERINVKHAELSAMPTTTGFISNN 167
           +++   L N A G+ +   +  +     V +      + I     +  A  T     + N
Sbjct: 120 VDSNRHLVNPANGMRIQGWMAESVGGEQVFNTSSDIRDLIIPIRDKEGAKATEYITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   I+          R    T   +   YD+ G++ V ++   K        +    
Sbjct: 180 LDKRLPIVQQGANEVDIARG---TWVVNKTIYDSFGNTNVVELRVLKDATAPNTWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS----- 282
                NS            +S +   G   +     I+F    +   +     ++     
Sbjct: 237 VNGEENSNFTMGFDNEGALLSLNGQAGQPGDLLEFPITFGVIDANAGEGGEQTVNLRLGT 296

Query: 283 ------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
                   TQ A     +    NG+  G  +++ + ++G +  +Y +G R  I ++A+A+
Sbjct: 297 VGSYADSITQFADASTTKAIVQNGYGMGYMENYEIDQNGVITGVYSNGIRRTIGKIALAS 356

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L       +  T +SG   IG  G    G I SG LE ANVD+A + T++I  Q
Sbjct: 357 FVNPGGLAKAGDTNFTETSNSGQARIGETGFAGLGTIRSGVLEMANVDLAEQFTDMIVTQ 416

Query: 397 RNYAVNSKVFQTGSDFMDILISLK 420
           R +  N+K   T    +  L+ LK
Sbjct: 417 RGFQANAKTITTSDQLLQELVRLK 440


>gi|163856435|ref|YP_001630733.1| hypothetical protein Bpet2124 [Bordetella petrii DSM 12804]
 gi|163260163|emb|CAP42465.1| flgE [Bordetella petrii]
          Length = 413

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 99/425 (23%), Positives = 176/425 (41%), Gaps = 23/425 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A +  +  + +NIAN  TVG+K    +F+ +   S     V  G+++S  
Sbjct: 2   GFGQGLSGLNAAAQNLDVIGNNIANSGTVGFKSATASFADVYASS----RVGLGVKVSAI 57

Query: 66  DMISEQGSLMHTASNTDLAIQG-KGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
           +     G++  T    D+AI G KGFF +         +R G+F ++ + +L N  G  L
Sbjct: 58  NQRFSVGNVTVTGGEYDIAIDGPKGFFRLTDPSGGVFYSRNGEFLVDKDFYLVNAQGYRL 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY                   + +    ++  PT    +  NL+ NA  I P  +P   
Sbjct: 118 TGYAAGA--------VGSAPVDLRLPQGNIAPKPTDAAGLQTNLNANADAIDPATSPFDP 169

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK------WEVSIFRQDQSTNNSFPYN 238
              + YT       YD+LG++     Y+ K           +EV      ++ + +    
Sbjct: 170 TLASTYTDSVPTTVYDSLGNAHQLTQYFVKRAGDTVTNESVYEVYYTLDGEAMDPTTEAA 229

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS---GIDQQITIDISKTTQLAGGFIPQK 295
                   ++FD      +  +          +        IT+     TQ    F P+ 
Sbjct: 230 GVWGGATTLTFDAAGRLTSAPTVDLSFATPGGTTSPADPLAITMSYDGVTQYGSDFSPK- 288

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              NG++ G+    S++ DG +   Y +G    I  LA+A   +   L+    N +  T 
Sbjct: 289 ITQNGYSSGEYSGLSINSDGTLQANYTNGETAIIGTLALANFNNVQGLQPVGNNAWAETG 348

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG  ++G PG N    +   A+E +NVD++ EL  +I AQR Y  N++  +T  + M +
Sbjct: 349 ASGQPTLGQPGTNGLATVVGQAVEASNVDMSKELVNMIVAQRTYQANAQTIKTQDEVMQV 408

Query: 416 LISLK 420
           L++++
Sbjct: 409 LMNMR 413


>gi|114320057|ref|YP_741740.1| flagellar basal body FlaE domain-containing protein
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226451|gb|ABI56250.1| flagellar basal body FlaE domain protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 430

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 104/444 (23%), Positives = 182/444 (40%), Gaps = 44/444 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           S  T+++G++A  + ++   DNIAN  T G+K +   F+ L   S    +   +  G+ +
Sbjct: 2   SFGTSLTGLNAAQSELNITGDNIANSSTWGFKESRPEFADLFASSNLGVTGLAIGQGVRL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                   QG    T ++ DL I GKGFF +   D     TR+G F ++ EG++ N AG 
Sbjct: 62  QNVGQQFSQGQFDFTENSLDLGISGKGFFRLSD-DGDISYTRSGAFQLDREGWITNSAGK 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP----- 177
            L G+        +      G + + V+   ++   TT   I  NL+  A I        
Sbjct: 121 RLTGFAADGDGNIV----GDGQQELRVETGNVAPEATTEARIQANLNAGAEIPPAYTLDA 176

Query: 178 ---------------------DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG 216
                                          A +   +S   +D+LG     + Y+ K  
Sbjct: 177 DDRLADFDQLEWVGPDENNPVPGAVFDPRDTATFNESTSTTFFDSLGRQHTANFYFIKGN 236

Query: 217 DKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ 276
           D  W V      +  NN  P  ++      +  +    Y    +             D  
Sbjct: 237 DNDWYVHTEVDGEVLNNGQPQPISFGPNGLIEGNATFDYTRALAD----------AEDLD 286

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
             +D+   TQ    F       +G A G+     VS+DG +   + +G    + R+ +  
Sbjct: 287 FELDLESLTQFGTPFAVSDITQDGFAAGEFSSLDVSEDGTIFARFTNGQSEVLGRVGVTK 346

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
            PS++NL+      ++ T ++G+  +G  G +  G I SGALE +NVDI+ +L ++I AQ
Sbjct: 347 FPSQENLQPVGDTEWVATFEAGEPVVGTAGTSDFGSIESGALEQSNVDISEQLVKMIVAQ 406

Query: 397 RNYAVNSKVFQTGSDFMDILISLK 420
           RN++ N+K+  T       +++++
Sbjct: 407 RNFSANAKMISTEDQITQEILNIR 430


>gi|326791535|ref|YP_004309356.1| flagellar hook-basal body protein [Clostridium lentocellum DSM
           5427]
 gi|326542299|gb|ADZ84158.1| flagellar hook-basal body protein [Clostridium lentocellum DSM
           5427]
          Length = 432

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 178/438 (40%), Gaps = 25/438 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----------- 51
           ++ SM +A+SG+     R+  + +NIANV+T+GYK   + F+ +   +            
Sbjct: 1   MMRSMFSAVSGLRVHQTRMDVIGNNIANVNTIGYKSQRVTFNDVFSQTLSSASAASDETG 60

Query: 52  ----SNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
               +   V  G+ +S+ DM+  QG+   T +  DL I G+GF +V   +     TRAG 
Sbjct: 61  RGGRNPMQVGLGVNVSSIDMLMTQGAAQRTDNPFDLMINGEGFIVVGDTNG-TYFTRAGA 119

Query: 108 FHINNEGFLENVAGGVLLGYPLK----NASAPLIVNSFQGLERINVKHAELSAMPTTTGF 163
              + +G L    G  + G+  +         ++      +   +          T    
Sbjct: 120 LRADVDGNLIIANGMKVKGWTAQLNEETNKYEIVKGEAGSINLADPNFVSSKPKVTDKLQ 179

Query: 164 ISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS 223
           +S NL+  +T    +     +  +      +   + D +    V+++      D      
Sbjct: 180 LSGNLNSTSTKEETNFRFYDSLGNYYSLATTLTPSTDKVDGYSVWEMKLGDIKDANGNKL 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                  T     ++         +    TG   +   +  + +  TS   ++ITID S 
Sbjct: 240 NGTLSPDTAVKLYFDTNGKLASVGAVPGATGNATSIDLEIENTDK-TSTFAEKITIDFSS 298

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQ A         ING+A GK   + +  DG +   YD+G    + ++ +A   + + L
Sbjct: 299 MTQYASASTIDPKTINGNAAGKMIGYEIGGDGVITASYDNGDMRILAQVVVAKFDNPEGL 358

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
           +    N Y  T +SG+      G    G   +G LE +NVD++SE T++I  QR +  NS
Sbjct: 359 EKVGDNLYKVTPNSGEF----DGIGTVGTFNTGVLEMSNVDLSSEFTDMIVTQRGFQANS 414

Query: 404 KVFQTGSDFMDILISLKR 421
           ++     + +  L +LKR
Sbjct: 415 RIISVSDEMLQELTNLKR 432


>gi|320353949|ref|YP_004195288.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
 gi|320122451|gb|ADW17997.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
          Length = 423

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 115/428 (26%), Positives = 194/428 (45%), Gaps = 12/428 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF----PSTSNSYV 56
           MG+  ++ TA+SG+   S  ++   +NIAN  TVG+K ++  FS L+      S+ NS V
Sbjct: 1   MGLSSALFTAISGLQGSSQAMTVTGNNIANSSTVGFKTSSTVFSDLLSANIASSSGNSQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR-DNVNCLTRAGDFHINNEGF 115
             G ++ T      QG    T S TD+AI+G GFFIV     + +  TR G+F  +++G+
Sbjct: 61  GRGSQVQTVQTSFSQGGFESTESATDIAIEGSGFFIVGDPLSDTSLYTRNGNFSFDDDGY 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L    G  + G            N            +++ A  T    +  NLD N+ ++
Sbjct: 121 LVTADGYRVQGSTYNANGVLASGNLSD---IQVDLVSQIKAKRTENVTLQTNLDSNSEVL 177

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
                      +    + ++   YD+LG++ +   Y+TK  D+ W  ++           
Sbjct: 178 N-AGVFDSTAPEDTSNYATTTTVYDSLGTAHLLTCYFTKVNDQTWNWNLTVDGADLTGGT 236

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAIS--FNDNTSGIDQQITIDISKTTQLAGGFIP 293
              +  + +  + FD        S+    S            Q    +  TTQ       
Sbjct: 237 SGVLEIIGSGTLVFDQDGNLSTGSTGTTTSGILTWANGADQTQQLAYVFDTTQFDSDSTV 296

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
              + +G+A G+  D  ++ DG V  +Y +G  +P+  +A+AT  + D L     + Y  
Sbjct: 297 FSQDQDGYASGEVTDVDIAADGTVSAVYSNGETIPVAMIALATFINSDGLDAVGSSLYRE 356

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T +SG  +IG+PG    G + + ALE +NVD+A+E  +LI  Q  Y+ NSKV  T ++ +
Sbjct: 357 TGESGTPTIGYPG-ASQGTLITQALELSNVDLATEFVDLITIQNAYSANSKVITTTNEML 415

Query: 414 DILISLKR 421
           D L++L R
Sbjct: 416 DELVNLIR 423


>gi|157146226|ref|YP_001453545.1| flagellar hook protein FlgE [Citrobacter koseri ATCC BAA-895]
 gi|157083431|gb|ABV13109.1| hypothetical protein CKO_01983 [Citrobacter koseri ATCC BAA-895]
          Length = 401

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 99/415 (23%), Positives = 182/415 (43%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+ +  +  P KTP    
Sbjct: 118 GYPA--TGTPPTIQQGANPGPITIPNTLMAAKATTTASMQINLNSSDEL--PSKTPFDPS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   +D+ G++   +V++ KT D  WEV           S      P  + 
Sbjct: 174 DADSYNKKGTVTVFDSQGNAHDVNVFFVKTQDNTWEVHTMD-------SSDPTATPTLST 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+     ++  S   ++   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TMEFNENGMLVSGGSANIVTGAINGADPASFSLSFLNSMQQNTGANNIVATNQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGKLTNGALESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|205373385|ref|ZP_03226189.1| flagellar hook protein FlgE [Bacillus coahuilensis m4-4]
          Length = 426

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 114/432 (26%), Positives = 203/432 (46%), Gaps = 19/432 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           +L SM + +SGM     ++  + +NIANV+T G+K+  + F  L+  + S +        
Sbjct: 1   MLRSMYSGISGMKNAQTKLDVIGNNIANVNTYGFKKGRVTFQDLMNQTMSGATTPTENRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 +  G  I++ D+IS QGSL  T  + D+AI G G+F+V+        TRAG+F+
Sbjct: 61  GQNAKQIGLGGTIASIDIISTQGSLQTTGRSLDVAISGDGYFVVRN-GQNEMYTRAGNFY 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           +++ G L +  G ++ GY      A  +++     + +    + ++   T+    + NL 
Sbjct: 120 LDSNGSLVDGNGNLIQGYQAD---ANGVIDYGGMTDIVIDSDSTMAPRSTSEVTFNGNLK 176

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A I                     ++  D+LGS +   V +TKT    W+ +I   D 
Sbjct: 177 ASAPIYDATNATTQAATADG-RVTVDYSVKDSLGSDIPLKVTFTKTASNSWDTTISYTDT 235

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
                     A   + +   DP T     + +  ++  +  +   Q I ID ++ TQ   
Sbjct: 236 LGATQTITGPALSFSSDGKLDPATVTTLANINLPVNNINPGAVSPQAIDIDFAQITQFDS 295

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                 + ING++ G  + F++S  G ++ IY +G    I +L +AT  +   L    GN
Sbjct: 296 STSANINTINGNSEGYLESFTISSSGEINGIYSNGEVQAISQLVMATFSNAGGLLSQGGN 355

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
           T+  + +SG  + G       G I SG+LE +NVD++ E TE+I AQR++  N+++  T 
Sbjct: 356 TFTASNNSGLPNYGIANE-GRGAIQSGSLEMSNVDLSEEFTEMITAQRSFQANTRIITTS 414

Query: 410 SDFMDILISLKR 421
            + +  L++LKR
Sbjct: 415 DEILQELVNLKR 426


>gi|1184296|gb|AAA87351.1| flagellar hook protein [Borrelia burgdorferi]
          Length = 442

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 102/445 (22%), Positives = 189/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+      +  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTIMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDARG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+   T   +DL + G GFFI+K        TRAG F+
Sbjct: 61  GTNPKQVGLGMNVASIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFY 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNITFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +       A  T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPLIQEGAS---PADIARGTWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             S +   G   +     I+FN   + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPGQKGDILQIPITFNVLGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG + IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|289666047|ref|ZP_06487628.1| flagellar hook protein FlgE [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 407

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/419 (24%), Positives = 183/419 (43%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
              T++SG++A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   GFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAISGEGFFTV-SSNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
               D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 DPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGAAVGA 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             T++ S        AN       F  +T      + +++S +TQ    F  + +  +G+
Sbjct: 229 PTTLQFSDTGALTTPANGIIAMDPFTPSTGAGVLNMQLNVSGSTQYGEAFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G++ SG+LE + VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 TGAPNTSDLGQVESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|241203124|ref|YP_002974220.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857014|gb|ACS54681.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 432

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 186/433 (42%), Positives = 242/433 (55%), Gaps = 13/433 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S+TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGPDGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G +L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I      
Sbjct: 121 GFMLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGIFKGNLDSNAKIAPVAPA 180

Query: 181 PKHNGR---DAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
              +         T K S  AYD LG+ V+YD Y+TK        +      +   S   
Sbjct: 181 TLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKKTVVTPPPATPATAATWEVSMFR 240

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG---------IDQQITIDISKTTQLA 288
           N         SF   T  +   +    +    T+G           Q I +D S  TQL 
Sbjct: 241 NADAAVGGTTSFPYSTASVGTGTLSFDANGKLTAGGAVNIVDPVTGQTIAMDFSAFTQLG 300

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
             F       NG A    KD +V  DG V   Y+DG+  P+YR+ +A V S D L L  G
Sbjct: 301 ADFSGTG-TPNGQAATPVKDVTVDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLMSG 359

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  NSKVFQT
Sbjct: 360 NVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTANSKVFQT 419

Query: 409 GSDFMDILISLKR 421
           GSD MD+L++LKR
Sbjct: 420 GSDIMDVLVNLKR 432


>gi|86356330|ref|YP_468222.1| flagellar hook protein FlgE [Rhizobium etli CFN 42]
 gi|86280432|gb|ABC89495.1| flagellar hook protein [Rhizobium etli CFN 42]
          Length = 434

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 185/435 (42%), Positives = 239/435 (54%), Gaps = 15/435 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S VSDNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVSDNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFQKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + +  ++VN F GL  +NV    L+A+ +T+G    NLD  A I      
Sbjct: 121 GFQLMGYSYDSGAPAVVVNGFDGLVPVNVNQEGLTAIASTSGVFKGNLDSGANIAPVAPA 180

Query: 181 PKH---NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----------GDKKWEVSIFRQ 227
                        T K S  AYD LG+ V+YD Y+TKT              WEV++FR 
Sbjct: 181 TLPSANAATTTADTKKFSMVAYDHLGNKVMYDFYFTKTSVVTPPPATGTASTWEVAVFRN 240

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSH-KAISFNDNTSGIDQQITIDISKTTQ 286
             +                V       +  N       +     +     I +D+S  TQ
Sbjct: 241 ADAATGGTTSFPYTGGAGAVVASGNLTFDRNGKMLTGGALPIADTKNALSINMDLSGFTQ 300

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
           L   F       NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D L L 
Sbjct: 301 LGAAFAGTG-TPNGQAASPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLM 359

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  NSKVF
Sbjct: 360 SGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTANSKVF 419

Query: 407 QTGSDFMDILISLKR 421
           QTGSD MD+L++LKR
Sbjct: 420 QTGSDIMDVLVNLKR 434


>gi|224534234|ref|ZP_03674812.1| flagellar hook protein FlgE [Borrelia spielmanii A14S]
 gi|224514336|gb|EEF84652.1| flagellar hook protein FlgE [Borrelia spielmanii A14S]
          Length = 442

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 101/445 (22%), Positives = 186/445 (41%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDVRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++  D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVAAIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDIEDLIIPIGDKEGAKSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +     R    T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPVIQEGASSADIARG---TWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------ 281
                NS             S +       +     I+FN + + + +            
Sbjct: 237 INGEQNSNFTLGFDNEGALASLNGQPSQKGDILQIPITFNVSEANVGEAGEQQTVNLKLG 296

Query: 282 ------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
                    TQ A     +    +G+  G  + + + ++G +  +Y +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMESYEIDQNGVIVGVYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG   IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQARIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|183598617|ref|ZP_02960110.1| hypothetical protein PROSTU_02017 [Providencia stuartii ATCC 25827]
 gi|188020796|gb|EDU58836.1| hypothetical protein PROSTU_02017 [Providencia stuartii ATCC 25827]
          Length = 406

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 97/416 (23%), Positives = 180/416 (43%), Gaps = 12/416 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S  + ++ +NIAN  T G+K    +F+ +       S V  G+ ++  
Sbjct: 2   SFSQAVSGLNAASAGLDSIGNNIANSATNGFKGATTSFADMFA----GSGVGLGVNVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G +  T   TD+AI G GFF V+ ++     +R G F  +  G L N  G  + 
Sbjct: 58  TQNFKDGPITRTDRPTDVAISGNGFFRVQDQNGDIFYSRDGQFIRDKSGNLVNNQGMTVT 117

Query: 126 GYPLKNA-SAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           GYP     +  ++V S    + +N+    + A  +    ++ NL+    + +      + 
Sbjct: 118 GYPAGLDENGNVVVQSGGVPQGLNIPTDMMDAQASDLAKLTINLNSEDKVKSKPFDINNP 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y   ++  A+D+ G++    VY+ KT D KW             +       L  
Sbjct: 178 DDTGSYNFSTTMTAFDSQGNTHEISVYFVKTDDNKWTAYAKD-------AGDKVAKKLGD 230

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
           +E   +       N+         N +              Q          ++NG+  G
Sbjct: 231 MEFDGNGRLNSPTNAVFAFDYQGLNGANNGTLQIDLNKTRQQKVSESSVSAIDVNGYPAG 290

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +  +F V  +G +   Y +  +  + ++A++   + + L    GN + P+  SG+   G 
Sbjct: 291 EYTNFKVEDNGLIVANYSNQQKRVVGQVALSAFANPNGLVSQGGNVWAPSNASGNPMDGV 350

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           PG  Q G++ SGALE++NVD++ EL  +I  QRNY  N++  +T    +  +++L+
Sbjct: 351 PGVGQFGKLTSGALESSNVDMSQELINMIVMQRNYQSNAQTIKTQDQMLQTMVNLR 406


>gi|262273529|ref|ZP_06051343.1| flagellar hook protein FlgE [Grimontia hollisae CIP 101886]
 gi|262222507|gb|EEY73818.1| flagellar hook protein FlgE [Grimontia hollisae CIP 101886]
          Length = 401

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 112/413 (27%), Positives = 190/413 (46%), Gaps = 15/413 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S+   +SG+ A S++++ +S NI+NV TVGYK +   F  +  P        G +E+S  
Sbjct: 2   SINIGLSGLRATSDQINTISHNISNVGTVGYKSSRTEFQDVYAPQFGGGEFGG-VEVSNV 60

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T  N+DLAI G+GFF+V+ ++     TR G F+++++G+L    G  L 
Sbjct: 61  RQSFTSGAATSTGRNSDLAINGEGFFMVQ-QNGQRMYTRNGIFNLDSDGYLVTADGLRLQ 119

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY +    +         L  + +  A+++A  TT   +  NLD +A +I P +      
Sbjct: 120 GYGV----SETGSIQNGALTDLQISTADMAAKVTTKVSLGVNLDASAAVIVPKEKKFDKD 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
             + +T  +S   YD+LG       Y+ KT +  W V      +  +             
Sbjct: 176 DPSTFTCSASTTVYDSLGGEHEITQYFVKTDENTWSVHYVADGKELD---------PKNT 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ FD     +      +++          +I +D+S+ TQ    F   +S+ +G+APGK
Sbjct: 227 QLEFDENGKLIKPEDPISVTLTPKNGSATMKIEMDVSEFTQFGSDFSINESKQDGYAPGK 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              +    DG V   Y +G      +L +A  P+++ L+   G  +  +  SG    G P
Sbjct: 287 LAGWYFDADGSVYARYSNGKTQLQGQLVLARFPNQEGLQQAGGTRWTESFSSGTALFGQP 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           G  Q G +  GA E++NVD+  E+  L+ AQ NY  N+K  Q   + + IL  
Sbjct: 347 GTGQFGALRVGAYESSNVDLTEEMVSLMSAQSNYQANAKTIQASQEMVQILFQ 399


>gi|21231397|ref|NP_637314.1| flagellar hook protein FlgE [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768550|ref|YP_243312.1| flagellar hook protein FlgE [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991641|ref|YP_001903651.1| flagellar hook protein FlgE [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113063|gb|AAM41238.1| flagellar biosynthesis, hook protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573882|gb|AAY49292.1| flagellar biosynthesis, hook protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733401|emb|CAP51602.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 407

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 103/419 (24%), Positives = 184/419 (43%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG++A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   AFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAISGEGFFAV-SSNGAKMYTRAGNFQTDANGYVINPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNASAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
           +   D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGSAVGA 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             T++ S        AN       F  +T      + +++S +TQ    F  + +  +G+
Sbjct: 229 PTTLQFSDTGSLTTPANGIVAMDPFTPSTGAGVLSMQLNVSGSTQYGEAFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G    + ++A+ +  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKALGQVALNSFVNPQGLQSQGNNMWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 VGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|325921024|ref|ZP_08182906.1| flagellar hook protein FlgE [Xanthomonas gardneri ATCC 19865]
 gi|325548506|gb|EGD19478.1| flagellar hook protein FlgE [Xanthomonas gardneri ATCC 19865]
          Length = 407

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 102/419 (24%), Positives = 184/419 (43%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG++A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   AFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAISGEGFFAV-SSNGAKMYTRAGNFQTDANGYVINPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
           +   D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGAAVGA 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
              ++ S        AN       F  +T      + ++++ +TQ    F  + +  +G+
Sbjct: 229 PTALQFSDTGALTNPANGIIAMDPFTPSTGAGVLNMQLNVTGSTQYGEAFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G    + ++A+++  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKALGQVALSSFVNPQGLQSQGNNMWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           IG P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 IGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|121607561|ref|YP_995368.1| flagellar basal body FlaE domain-containing protein
           [Verminephrobacter eiseniae EF01-2]
 gi|121552201|gb|ABM56350.1| flagellar basal body FlaE domain protein [Verminephrobacter
           eiseniae EF01-2]
          Length = 426

 Score =  253 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 91/426 (21%), Positives = 163/426 (38%), Gaps = 12/426 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
             +  +SG++A S  +  +  N+AN +TVG+K     F+ +V     S        G+++
Sbjct: 2   GFQQGLSGLNAASKSLDVIGHNVANANTVGFKSGRAEFAEMVASAIGSADGLNAGIGVDV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QGSL  T +N D+AI G GFF +   D     TR+G+F ++ +G +      
Sbjct: 62  AAVSQQFGQGSLTITGNNLDVAINGAGFFTLTLPDGTPAYTRSGNFKLDKDGNMITNDAA 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GYP+  A+         G+              T T   + +         P   P 
Sbjct: 122 RVMGYPVDPATGLRTGAEPVGMVFPTSAPIPAKQTGTITAAFNLDARAPDAAGNPAAQPP 181

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   T+ +S   YD+ G +   ++Y+ KT     W V     D             
Sbjct: 182 VPATPRT-TYGTSINVYDSQGVAKPVNLYFQKTATANTWAVYDRLDDPGATPPVQAMPIG 240

Query: 242 LNTVEVSFDPVTGYLANSSHKA-------ISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
             T +             +           +  +        + + +   TQ    F   
Sbjct: 241 QITFDNDGKITGPAAPAPATGFALPLTIDPTPPNPNGLPAYTVQLKLDGVTQFGTRFAVS 300

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G+  G+     +  +G +   Y +G      +LA++ + +   L     N ++ T
Sbjct: 301 SLSQDGYTVGELAGIDIESNGMLMTRYSNGVTRSEGQLALSRIRNAQGLAAVGSNNWVAT 360

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   +G       G + SGALE +NVD+ +EL  ++ AQR Y  N++  +T    M 
Sbjct: 361 HASGPAVVGTASDGNFGALRSGALEDSNVDLTAELVNMMTAQRTYQANAQTVKTQDQVMS 420

Query: 415 ILISLK 420
            L++L+
Sbjct: 421 TLVNLR 426


>gi|166712062|ref|ZP_02243269.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 407

 Score =  253 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 104/419 (24%), Positives = 185/419 (44%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG+ A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   AFNTSLSGISAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAISGEGFFTV-SSNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
           +   D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGAAVGS 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             T++ S        AN       F  +T      + +++S +TQ    F  + +  +G+
Sbjct: 229 PTTLQFSDTGALTTPANGIIAMAPFTPSTGAGVLSMQLNVSGSTQYGEQFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G+I SG+LE++ VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 TGAPNTSDLGQIESGSLESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|332799182|ref|YP_004460681.1| flagellar hook-basal body protein [Tepidanaerobacter sp. Re1]
 gi|332696917|gb|AEE91374.1| flagellar hook-basal body protein [Tepidanaerobacter sp. Re1]
          Length = 411

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 107/431 (24%), Positives = 182/431 (42%), Gaps = 33/431 (7%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------- 50
           + SM + ++G+     ++  + +NIANV+TVG+K++ + F   +  +             
Sbjct: 1   MRSMFSGVTGLRNHQVKMDVIGNNIANVNTVGFKKSRVTFQDTLSQTMRGAASPQGNRGG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHI 110
           T+   V  G+ I++ D I    S  +T + TDL+I+G G+FIV    +    TRAG+F  
Sbjct: 61  TNPMQVGLGMTIASIDTIHSPSSAEYTGNMTDLSIEGDGYFIVGDGLD-MFYTRAGNFGF 119

Query: 111 NNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +  G L N A G+ +          +  +      R       +    + T  I+   + 
Sbjct: 120 DENGNLINTANGLKVMGWQDTEKHEVPADKSPQSIRSIEIRKGMMIPASATTEINFAKNL 179

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS 230
           NA                  T+   F  YD+LG +    + +TKT   +W  +I   D +
Sbjct: 180 NAETENNG------------TYSLPFKVYDSLGCAHNLTIEFTKTNANEWNYNITFTDSN 227

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
             N            + + +   G           F+      +  I+ID S TTQ A  
Sbjct: 228 VTNIANNTGTITFDNDGNCNIPAGGTMT-------FDLANGADNMSISIDFSGTTQYAKE 280

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
                S  NG+  G   D +    G +  I+D+G    + ++A+A   +   L     N 
Sbjct: 281 TNVDLSYQNGYPAGTLTDVTTDTTGVITGIFDNGYNRQLAQVALANFDNPAGLIKAGQNM 340

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y  + +SG+  IG  G    G I  G LE +NVD++ E T++I  QR +  NS++  T  
Sbjct: 341 YRYSNNSGEPQIGESGTGGRGAIAPGYLEMSNVDLSEEFTQMIITQRGFQANSRIITTSD 400

Query: 411 DFMDILISLKR 421
           + +  L++LKR
Sbjct: 401 EMLQELVNLKR 411


>gi|58582195|ref|YP_201211.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624088|ref|YP_451460.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58426789|gb|AAW75826.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368028|dbj|BAE69186.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 407

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 104/419 (24%), Positives = 185/419 (44%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG+ A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   AFNTSLSGISAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLAI G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAISGEGFFTV-SSNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
           +   D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGAAVGS 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             T++ S        AN       F  +T      + +++S +TQ    F  + +  +G+
Sbjct: 229 PTTLQFSDTGALTTPANGIIAMAPFTPSTGAGVLSMQLNVSGSTQYGEQFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
              PG +  G+I SG+LE++ VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 TSAPGTSDLGQIESGSLESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|190890382|ref|YP_001976924.1| flagellar hook protein [Rhizobium etli CIAT 652]
 gi|190695661|gb|ACE89746.1| flagellar hook protein [Rhizobium etli CIAT 652]
          Length = 433

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 184/434 (42%), Positives = 237/434 (54%), Gaps = 14/434 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S VSDNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVSDNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I     T
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVSQDGLTAIASTSGVFKGNLDSNAKIPVAPAT 180

Query: 181 PKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----------GDKKWEVSIFRQ 227
                       T K S  AYD LG+ V+YD Y+TK                       +
Sbjct: 181 LPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKQSVAAAPPPAPPATAATWEVAMYR 240

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
           + +       +        V    +T         + +   N     Q I +D S  TQL
Sbjct: 241 NANAATGGTTSFPYTAGGAVGTGSLTFDANGKMTSSGAVTINDGVTGQSIAMDFSGLTQL 300

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F       NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D L L  
Sbjct: 301 GADFSGTG-TPNGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLMS 359

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  NSKVFQ
Sbjct: 360 GNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTANSKVFQ 419

Query: 408 TGSDFMDILISLKR 421
           TGSD MD+L++LKR
Sbjct: 420 TGSDIMDVLVNLKR 433


>gi|304316900|ref|YP_003852045.1| fagellar hook-basal body protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778402|gb|ADL68961.1| fagellar hook-basal body protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 420

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 105/436 (24%), Positives = 181/436 (41%), Gaps = 33/436 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A    +  + +NIANV+TVG+K + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKAHQAEMDVIGNNIANVNTVGFKASRMTFKEIFNQTIKGASAPQGSGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   V  G+ I++ D +   G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQVGLGVAIASIDTLFTNGGSQRTDNPTDLSIDGNGFFIV-NNGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            ++ G L    G  ++G+  ++               I    +   A             
Sbjct: 120 FDSNGDLVTPDGYKVMGWISQDGKTVNTDTGNLSPISIKNWSSTSPA------------- 166

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
             +T +         G     +   +   YD+ G S V  + +TK  +     +      
Sbjct: 167 --STKLIQLGGNLDAGTSIGSSVSYNVTIYDSQGGSHVATIQFTKKDNAGNWDAAITNFD 224

Query: 230 STN----NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT 285
             +         ++   +   ++    + +  N S   I+  + T G    ITID+S  T
Sbjct: 225 GNDLSASPVTIGSIQFDSNGLITNPAGSIFSVNVSSLPITNTNATLGDGTNITIDLSNLT 284

Query: 286 QLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKL 345
             +     ++   +G+  G  +  ++ + G V  IY +G    I ++A+A   +   L+ 
Sbjct: 285 MYSSSTDIRELSKDGNEAGSIESINIDQYGVVSGIYSNGRTQVIGQIALADFQNTQGLEK 344

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
                ++ T +SGD  IG       G I  G LE +NVD+A+E   +I  QR +  NSKV
Sbjct: 345 VGNTMFINTVNSGDPMIGAANTGTRGTINPGTLEMSNVDLANEFANMITTQRGFEANSKV 404

Query: 406 FQTGSDFMDILISLKR 421
             T  + +  L++LKR
Sbjct: 405 ITTSDEILQDLVNLKR 420


>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On
           Docking An X-Ray Derived Structure And Terminal Two
           Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem
           Map
          Length = 402

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 1   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 57  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 117 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 173 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPTTAST 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 TLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|295097203|emb|CBK86293.1| fagellar hook-basal body proteins [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 404

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 102/415 (24%), Positives = 175/415 (42%), Gaps = 12/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A +  +  V +NIAN  T G+K  ++AF+ +   +T       G++++  
Sbjct: 2   SFSQGLSGLNAAAKALDVVGNNIANSQTAGFKAGSVAFADIFAGTT-----GLGVQVAGV 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G L    S+ D+ +QGKGFF +          R G F  +  G + N   G+ L
Sbjct: 57  TQNFGDGGLTAGNSSLDMGLQGKGFFRMVSEGGAVYYGRNGQFKQDQNGNIINSTNGLYL 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
               +    P  +     +  I +   ++    +T G ++ NL  + T I  D       
Sbjct: 117 TG-YQATGTPPTIAPGAPVGPIRIPTEDMPPAASTAGSLTGNLKSDDTTIITDS--FDYS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y ++S   A DTLG+     VY+ +T   +W+     +          +V  L+  
Sbjct: 174 DPKTYNYQSQIEATDTLGNKHTVKVYFVQTAAGEWKAYARDE----TAPGTPDVTSLDLK 229

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             S   +      S+   I+           I +D+S  T+ A   + +   I+G APGK
Sbjct: 230 FDSNGNMDTAAMASTKMTINGAAFNGSAPLSIDMDLSSLTRRATDSLVKVDTIDGQAPGK 289

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
            + F +   G V   Y +G R  + ++ +A   +   L     N +  T  SG   +G  
Sbjct: 290 YQSFVIGDSGEVVATYSNGQRQTVAQIVLADFANSGGLAAEGNNVWSETPQSGQPFLGTS 349

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G I    LE +NVD+  E+  +I  QRNY  NS+  +T S+ +  L++L+
Sbjct: 350 GSGSFGTINGNMLEQSNVDLGQEMVNMIVYQRNYQSNSQTIKTQSELLQTLVNLR 404


>gi|292492363|ref|YP_003527802.1| flagellar basal body FlaE domain protein [Nitrosococcus halophilus
           Nc4]
 gi|291580958|gb|ADE15415.1| flagellar basal body FlaE domain protein [Nitrosococcus halophilus
           Nc4]
          Length = 425

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 108/427 (25%), Positives = 204/427 (47%), Gaps = 15/427 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY---VSGGLEI 62
           S  T++SG++A S+ +  VS+NIAN +T G+KR+   F+ +   S+  S    V  G+ +
Sbjct: 2   SFNTSLSGLNAASSDLDVVSNNIANANTTGFKRSRAEFADIFAVSSFGSPKTAVGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           +      +QG+L  T +  DLA+ G+GFF +     +N    +RAG F IN +G++ N A
Sbjct: 62  NRAAQQFDQGNLDFTQNILDLAVSGRGFFALSPNLTNNELVYSRAGAFSINKDGYVVNGA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  YP+      +  +S +  + + +  +  +   T+   I  NL  +A  + P   
Sbjct: 122 GQFLRTYPVNQD-GTVTASSLESSQPVRLPTSAGTPQATSQVSIGANLPADAASLDPAN- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS---TNNSFPY 237
                    +T  +S   +D+LG+S +  +Y+ K  +   + +++          +    
Sbjct: 180 -FDPLDADTFTASTSTTVFDSLGNSHISTLYFVKDTNSPNQWAVYNALDGALVNVSGGTA 238

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS----KTTQLAGGFIP 293
               +    ++FD   G +  +    ++           +T+ ++     TTQ+A  F  
Sbjct: 239 GAGGIQYGTLNFDSSGGLMGTTPSPLVTDPIVLGNGANDMTLTLNFPSTNTTQVASPFNV 298

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
              + +G   G+     +S+ G +   + +G  + + ++A+A  P+E  L+    N++  
Sbjct: 299 TALDQDGFTSGRLTGLDISETGVIRANFSNGQNLALGKVALAQFPNEQGLRQLGNNSWAG 358

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T DSG    G  G+   G I  GALE++NVD+ +EL  LI AQRN+  N++  +T S   
Sbjct: 359 TIDSGAAIAGEAGNGSFGLIQGGALESSNVDLTAELVHLITAQRNFQANARAIETASTLT 418

Query: 414 DILISLK 420
           D +++++
Sbjct: 419 DSILNIR 425


>gi|224532235|ref|ZP_03672867.1| flagellar hook protein FlgE [Borrelia valaisiana VS116]
 gi|224511700|gb|EEF82106.1| flagellar hook protein FlgE [Borrelia valaisiana VS116]
          Length = 442

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 101/445 (22%), Positives = 187/445 (42%), Gaps = 31/445 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SG+     R+  V +NIANV+T+G+K+  + F  ++  S S +        
Sbjct: 1   MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSISGASRPTDTRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++  D I  QG+   T   +DL + G GFFI+K        TRAG F 
Sbjct: 61  GTNPKQVGLGMNVAAIDTIHTQGAFQSTQKASDLGVSGNGFFILK-EGKNLFYTRAGAFD 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS-AMPTTTGFISNN 167
           ++++  L N   G  + G+  ++     ++N+   +E + +   +   A  T     + N
Sbjct: 120 VDSDRHLVNPANGMRIQGWMARDLEGEKVINTASDVEDLIIPIGDKEGARSTKNVTFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK   +I    +     R    T   + + YD+ G+  V ++   K  +     +    
Sbjct: 180 LDKRLPVIQEGASSADIARG---TWVVNKSLYDSFGNVSVLELRVVKDLNTPNLWNATVL 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID------------Q 275
                NS             + +       +     I+FN + + +              
Sbjct: 237 INGEQNSNFTLGFDNEGALATLNGQPSQKGDILQIPITFNVSGANVGEVGEQQTVNLKLG 296

Query: 276 QITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            +       TQ A     +    +G+  G  +++ + ++G +  IY +G R  + ++A+A
Sbjct: 297 TVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVGIYSNGIRRDLGKIALA 356

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
           +  +   L       ++ T +SG   IG  G    G+I SG LE ANVD+A + T++I  
Sbjct: 357 SFMNPGGLAKSGDTNFVETSNSGQARIGETGLAGLGDIRSGVLEMANVDLAEQFTDMIVT 416

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QR +  N+K   T    +  L+ LK
Sbjct: 417 QRGFQANAKTITTSDQLLQELVRLK 441


>gi|270262401|ref|ZP_06190672.1| flagellar hook protein FlgE [Serratia odorifera 4Rx13]
 gi|270043085|gb|EFA16178.1| flagellar hook protein FlgE [Serratia odorifera 4Rx13]
          Length = 410

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 101/417 (24%), Positives = 179/417 (42%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K   ++F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATSGFKSGTVSFADMFA----GSQVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G+   T+   D+AI   GFF ++ +D     +R G F ++    L N+ G  L 
Sbjct: 58  TQNFKGGTTTGTSRALDVAISDNGFFRLQDKDGGIFYSRNGQFKLDENRNLTNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           G+P   A +P  +        +++    ++A  TT+G +  NL     +  PD       
Sbjct: 118 GFPA--AGSPPTIQQGANPVPLSIPEGMMTAKSTTSGTMVANLKSTHKV--PDNKTFDPA 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y + +S  AYD+LG+    + Y+ KT D  W+V     +   +          +T 
Sbjct: 174 KQDSYNYVNSITAYDSLGNVHNINAYFVKTSDNNWQVYTQEGNIPGSPVTDAGTMAFDTS 233

Query: 246 E--VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
              VS     G     S        N +              Q        K   +G+  
Sbjct: 234 GNLVSTTSKQGTTGEFSMLIPMSATNGAPAQNFSLSFAKSMQQSVSSDSVSKVSQDGYTA 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G+  +F ++ DG V  IY +     + ++ +    + + L     N +  T  SG   +G
Sbjct: 294 GEYTNFQINNDGSVVGIYSNQQTQLLGQIVLTNFSNPEGLSSQGDNVWQETGASGQPRVG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 354 LAGSGGFGKLTSGALEASNVDLSQELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 410


>gi|78047586|ref|YP_363761.1| flagellar hook protein FlgE [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78036016|emb|CAJ23707.1| flagellar hook protein FlgE [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 407

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 103/420 (24%), Positives = 187/420 (44%), Gaps = 19/420 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
              T++SG++A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   GFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAVSGEGFFTVW-SNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTNNSFPYNVA 240
           +   D  Y+H +     YD+LG S V   Y+ KT    +W+V  +             V 
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVYNYVD--------GAAVG 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
              T++ S        AN       F  +T      + ++++ +TQ    F  + +  +G
Sbjct: 228 APTTLQFSDTGALTTPANGIIAMDPFTPSTGAGVLNMQLNVTGSTQYGEAFALRDTRQDG 287

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG  
Sbjct: 288 YASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTSGAA 347

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 348 RTGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|327193059|gb|EGE59971.1| flagellar hook protein [Rhizobium etli CNPAF512]
          Length = 434

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 185/435 (42%), Positives = 237/435 (54%), Gaps = 15/435 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S VSDNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVSDNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGPDGTPVLTRAGDFQKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA +      
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGVFKGNLDSNANVAPVAPA 180

Query: 181 PKHNGR---DAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTNNSFP 236
              +         T K S  AYD LG+ V+YD Y+TKT        +      +   +  
Sbjct: 181 TLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKTAVAAAPPPAPPAAAATWEVAMF 240

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAIS----------FNDNTSGIDQQITIDISKTTQ 286
            N         SF    G    +                 N       Q I +D S  TQ
Sbjct: 241 RNANAATGGTTSFPYSAGGAVGTGSITFDRDGKLLTGGAINITDGVTGQTIAMDFSGLTQ 300

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
           L   F       NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D L L 
Sbjct: 301 LGAAFSGTG-TPNGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLM 359

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
            GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IEAQR+Y  NSKVF
Sbjct: 360 SGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIEAQRSYTANSKVF 419

Query: 407 QTGSDFMDILISLKR 421
           QTGSD MD+L++LKR
Sbjct: 420 QTGSDIMDVLVNLKR 434


>gi|319787121|ref|YP_004146596.1| flagellar hook-basal body protein [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465633|gb|ADV27365.1| flagellar hook-basal body protein [Pseudoxanthomonas suwonensis
           11-1]
          Length = 406

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 101/420 (24%), Positives = 176/420 (41%), Gaps = 20/420 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           S   ++SG++A +  ++  S+NIAN +TVG+K +   F+ L   ++     + V  G+++
Sbjct: 2   SFNASLSGINAANADLNVTSNNIANSNTVGFKSSRAEFADLFSSTSYGLASNAVGSGVKV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + D AI G+G F V  ++     TRAG+F  +N GF+    G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDFAIDGEGLFTV-SKNGDTFYTRAGNFQPDNRGFVVTPDGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  Y         +  +         + A   + P  TG +   +        P   P 
Sbjct: 121 RLQVYAPNANGGFDVGRTTDL------QLATSDSPPRQTGLVELMVTLPGAAAEPTVQPF 174

Query: 183 HNGRDAEYT-HKSSFAAYDTLGSSVVYDVYYTKTGD-KKWEVSIFRQDQSTNNSFPYNVA 240
                  Y         YD+LG + V   Y+ KT +  +W+V  +             V 
Sbjct: 175 DPSESNSYNASSGGVTVYDSLGVAHVQTSYFVKTENANEWQVYNYVDGNQ--------VG 226

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
              T++   +      A+       +   T     ++ +DIS +TQ    F  +    +G
Sbjct: 227 EPTTLQFDSNGSLVSPADGRIAMDPYTPGTGAGQLELGLDISGSTQYGNSFALRSINQDG 286

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            A GK     V++DG V   Y +G  V + ++ +    +   L+    N +  T  SG  
Sbjct: 287 FASGKLTTIDVAEDGVVYARYSNGDDVALGQIVLTNFVNPQGLQAVGNNMWAATHSSGTP 346

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G P  +  G I +GALE + VD+  +L  +I AQRN+  N+++  T       +I+++
Sbjct: 347 RSGAPDSSDFGRIQAGALEASTVDLTEQLVNMITAQRNFQANAQMISTQDQATQTVINIR 406


>gi|296103611|ref|YP_003613757.1| Flagellar basal body FlaE domain protein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295058070|gb|ADF62808.1| Flagellar basal body FlaE domain protein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 399

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 103/415 (24%), Positives = 174/415 (41%), Gaps = 17/415 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG+ A +  +  V +NIAN  TVG+K  +++F+ +   ST       G++++  
Sbjct: 2   GFSQGLSGLSAAAKALDVVGNNIANSQTVGFKAGSVSFADIFAGST-----GMGVQVAGV 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+LM+ AS  D+ I G+GFF +          R G F  +  GF+ N   G+ L
Sbjct: 57  SQNFGDGALMNGASALDMGISGRGFFRMVDEAGSVFYGRNGQFEQDQNGFIVNKTNGLFL 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
                  +   ++N    +  I +   ++    +T G ++ NL  +  +I P        
Sbjct: 117 TG---YQATDGVINPGAQVGPIRIPTDDMPPAASTKGSVAGNLKSDDKVI-PATPAFDPD 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y + S   A D+LG+     VYY  T + +W+            + P      +  
Sbjct: 173 NADTYNYVSEVTATDSLGNKHAIKVYYVHTAEGEWKAHAQDS------TAPGAAGGWSEQ 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F       A  +        N S             TQ A     +  EI+G APGK
Sbjct: 227 TLKFGTDGKLTAPVTLNIKGAAYNGSAALDLNLD--LNITQNASDTQVKLDEIDGQAPGK 284

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + VS  G V  IY +G R  + ++ +A   +   L+    N +  T  SG   +G  
Sbjct: 285 FNSYQVSDTGEVIAIYSNGKRQTVAQVVLADFANAGGLEQQGNNLWAETSQSGQPFLGTS 344

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G+I    LE++NV++  E+  +I  QRNY  NS+  +T S+ +  L++L+
Sbjct: 345 GSGSFGDISGNMLESSNVNLGDEMVNMIVYQRNYQSNSQTIKTQSEVLQTLVNLR 399


>gi|320354325|ref|YP_004195664.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
 gi|320122827|gb|ADW18373.1| flagellar hook-basal body protein [Desulfobulbus propionicus DSM
           2032]
          Length = 434

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 120/437 (27%), Positives = 203/437 (46%), Gaps = 19/437 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP----STSNSYV 56
           MGI  ++ + +SG++  S  +S + +N+AN +T+G+K +   FS L+      S   S V
Sbjct: 1   MGIQSALYSGVSGLNTNSQAMSVIGNNLANTNTLGFKGSRSIFSDLLSSNVFGSGGTSQV 60

Query: 57  SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGF 115
             G+ +S  D I  QG+   T+S+TD+AI+G GFF++K   ++    +RAG F  ++EG+
Sbjct: 61  GRGVGLSIVDSIYSQGTFETTSSDTDVAIEGVGFFVLKEAGNDTAYYSRAGAFRFDDEGY 120

Query: 116 LENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
           L N  G  + G           +      +        + A PT+    + NLD+N+T+I
Sbjct: 121 LVNPEGFRVQGKLFDPT-NNSTLLPMDPTDIQVANVGLIEANPTSELTFTTNLDENSTVI 179

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY--TKTGDKKWEVSIFRQD----- 228
           +   TP     +A Y + +S   +D+LG S +  VY+         WE +    +     
Sbjct: 180 S-SATPIDPNNNATYNYSASSQIFDSLGESHLITVYWRLVNDATNTWEAAYTIDNDAATI 238

Query: 229 ---QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS-KT 284
                 + S   N A             G                +      TI++S   
Sbjct: 239 TAITDFDASTAGNQAMSFDNIGKAPDTNGDGVPDPFTTTVGPITWANGAATSTIELSFDC 298

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           TQ     I    + NG+A G+  + S++ +G V   Y +G ++ I +L +A   +   LK
Sbjct: 299 TQYDSDSIVIGQQQNGYAAGELTNVSINSEGVVVASYSNGRQINISQLVLAKFQNPGGLK 358

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
           L   N Y+   ++G I +G PG    G++F+ +LE +NVD+  E  ++I  QR +  NSK
Sbjct: 359 LAGANRYIAPAEAGTIRVGLPGPE-LGKLFTNSLEQSNVDMGQEFVKMITTQRGFQANSK 417

Query: 405 VFQTGSDFMDILISLKR 421
           +  T  + +  LI+LKR
Sbjct: 418 IITTVDEMLSELINLKR 434


>gi|237731007|ref|ZP_04561488.1| flagellar hook protein FlgE [Citrobacter sp. 30_2]
 gi|226906546|gb|EEH92464.1| flagellar hook protein FlgE [Citrobacter sp. 30_2]
          Length = 417

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 93/424 (21%), Positives = 176/424 (41%), Gaps = 17/424 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    + N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRMVDSNGSVFYSRNGQFKLDENRNIVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        I + +  ++A  TTT  +  NL+    +  P KTP +  
Sbjct: 118 GYPA--TGTPPTVQQGANPAPITIPNTLMAAKSTTTASMQVNLNSTDKV--PTKTPFNPS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++   +++Y K  +        +   + +          +  
Sbjct: 174 DADSYNKKGSVTVFDSQGNAHDMNIFYVKNKESNTWEVFTQDASTGDAEKSAGFMRFDNN 233

Query: 246 EVSF---------DPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
            +            P    +     K  +   N +         ++   Q  G      +
Sbjct: 234 GLFLGISATAAEVPPTAPAVWPKDIKITTGPINGAVPANFSLSFLNSMQQNTGANNIVAT 293

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+ PG    + ++ DG V   Y +  +  + ++ +A   + + L     N +  T+ 
Sbjct: 294 NQNGYKPGDLVSYQINNDGTVVGNYSNEQQQVLGQIVLANFANNEGLASQGDNVWAATQS 353

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG   +G  G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L
Sbjct: 354 SGVALLGTAGEGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTL 413

Query: 417 ISLK 420
           ++L+
Sbjct: 414 VNLR 417


>gi|56413836|ref|YP_150911.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362759|ref|YP_002142396.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56128093|gb|AAV77599.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094236|emb|CAR59741.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 403

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 174 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPTTAST 228

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 229 TLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGD 288

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 289 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGAALLGTA 348

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 349 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 403


>gi|299531286|ref|ZP_07044696.1| flagellar hook protein FlgE [Comamonas testosteroni S44]
 gi|298720693|gb|EFI61640.1| flagellar hook protein FlgE [Comamonas testosteroni S44]
          Length = 422

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 176/422 (41%), Gaps = 8/422 (1%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
             +  +SG++A S  +  +  NIAN +T G+K +   F+ +V     S S      G+ +
Sbjct: 2   GFQQGLSGLNAASKNLDVIGHNIANSNTTGFKASRADFAEMVASAIGSASGQSSGIGVNV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           ++      QGS+  T +N D+AI G GFF+VK  D     TRAG+F ++ EG L+ V   
Sbjct: 62  ASVSQQFRQGSITSTGNNLDIAINGNGFFVVKQSDGSIAYTRAGNFGLDKEGNLKTVDND 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GY +  ++  +   +             + A  T+   +  NLD  AT    D T  
Sbjct: 122 NVMGYVVDPSTGKIQSGATPVPMSFPTGQP-IPAKQTSKVNVELNLDARATAAAGDATAT 180

Query: 183 HN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV---SIFRQDQSTNNSFPYN 238
                    T+ +S   YDT G+++  ++Y+ K           S+         +    
Sbjct: 181 PPVAATPRATYGTSLNVYDTQGTAIPVNLYFEKDATGNTWNVFNSLDATATPIGKAVFDA 240

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L +V  +          +   +    +        +  D    TQ    F     + 
Sbjct: 241 SGKLTSVTPNAPTTGSGTTLNLSVSGGTANPNGLQPFDVAFDFGGLTQFGTKFAVSSLKQ 300

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G     +V +DG +   Y +G      ++A+A   +   L     N ++ T DSG
Sbjct: 301 DGYTSGALTGINVGRDGSIVASYSNGVTRTEGQIALAAFTNTQGLGSIGNNKWVATSDSG 360

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
               G       G + SGALE +NVD+ +EL  ++ AQR+Y  N++  +T       L++
Sbjct: 361 PALNGSAQTGTFGSLQSGALEESNVDLTAELVNMMTAQRSYQANAQTIKTQDQVFSTLVN 420

Query: 419 LK 420
           L+
Sbjct: 421 LR 422


>gi|322616547|gb|EFY13456.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620512|gb|EFY17376.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622506|gb|EFY19351.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629657|gb|EFY26432.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632623|gb|EFY29369.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636882|gb|EFY33585.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641580|gb|EFY38218.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644070|gb|EFY40616.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650030|gb|EFY46448.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653955|gb|EFY50278.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658487|gb|EFY54749.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663345|gb|EFY59547.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670079|gb|EFY66219.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674857|gb|EFY70948.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676673|gb|EFY72740.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682595|gb|EFY78614.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686652|gb|EFY82631.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195766|gb|EFZ80942.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198342|gb|EFZ83446.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203174|gb|EFZ88204.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209177|gb|EFZ94114.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323209681|gb|EFZ94610.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217863|gb|EGA02578.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222151|gb|EGA06535.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224923|gb|EGA09181.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229665|gb|EGA13788.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232890|gb|EGA16986.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240625|gb|EGA24667.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242939|gb|EGA26960.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250256|gb|EGA34145.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252631|gb|EGA36469.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258841|gb|EGA42494.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261030|gb|EGA44623.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266939|gb|EGA50424.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269980|gb|EGA53429.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 403

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 174 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPTTAST 228

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 229 TLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIIATNQNGYKPGD 288

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 289 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 348

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 349 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 403


>gi|269836573|ref|YP_003318801.1| hypothetical protein Sthe_0541 [Sphaerobacter thermophilus DSM
           20745]
 gi|269785836|gb|ACZ37979.1| protein of unknown function DUF1078 domain protein [Sphaerobacter
           thermophilus DSM 20745]
          Length = 413

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 105/434 (24%), Positives = 179/434 (41%), Gaps = 37/434 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST----------- 51
           +  SM +A+SG+ A    +  + +NIAN+ T G+K + + F  ++  +            
Sbjct: 2   LNRSMASAVSGLKAYQTWLDVIGNNIANLATPGFKASRVRFEDVMSHTLRGASVPDPAQG 61

Query: 52  ----SNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGD 107
               + + V  G+  +  D     G+   T   + +AIQG+G+F+V         TR G 
Sbjct: 62  RGGRNPAQVGLGVLAAGIDTDYAPGTPTATGKMSHMAIQGEGYFVVAD-GFRTYYTRDGS 120

Query: 108 FHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           F +  +G L N + G+ +     +A+  +  +             E+ AMP+ +  I  N
Sbjct: 121 FDLGIDGRLVNPSTGLYVMGWQADANGAIDTSQPLSP-IRIPIGEEMDAMPSMSIVIPGN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+  A   T   T                   D+LG      + + KTG   W  +    
Sbjct: 180 LNAAAATGTTYTTDV--------------TVIDSLGFRHSVSLTFEKTGTNTWSWTYSSS 225

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
           +     +         TVE         + ++    I + +  +        D ++ TQL
Sbjct: 226 EAGVTLTNATG-----TVEFDDQGNVLNVTSAGDLTIQWGNGAADTVIPGGGDFTRLTQL 280

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
           A G        +G   G    F++S DG V  IY +G    + ++A+AT  +   L    
Sbjct: 281 AAGSDAVGV-ADGWTAGALTSFAISVDGVVTGIYSNGATKALGQIALATFANPGGLLKEG 339

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
            N   P+ +SG   IG P     G+I +G LE +NVD+A E T +I A+R +  NS+V  
Sbjct: 340 QNLLSPSPNSGQAVIGTPVTGGRGQIAAGYLEMSNVDLAEEFTNMILAERGFQANSRVVT 399

Query: 408 TGSDFMDILISLKR 421
           T  + +  L++LKR
Sbjct: 400 TSDEVLQDLVNLKR 413


>gi|16760053|ref|NP_455670.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16764533|ref|NP_460148.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142176|ref|NP_805518.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62179694|ref|YP_216111.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167553035|ref|ZP_02346785.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167994041|ref|ZP_02575133.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168264030|ref|ZP_02686003.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168467129|ref|ZP_02700971.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822620|ref|ZP_02834620.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194442954|ref|YP_002040431.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|197250199|ref|YP_002146866.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197265088|ref|ZP_03165162.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198245171|ref|YP_002215960.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204930842|ref|ZP_03221715.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205353085|ref|YP_002226886.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857315|ref|YP_002243966.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213161844|ref|ZP_03347554.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213424680|ref|ZP_03357445.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213582037|ref|ZP_03363863.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213648926|ref|ZP_03378979.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213865505|ref|ZP_03387624.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224584319|ref|YP_002638117.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238911003|ref|ZP_04654840.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289806609|ref|ZP_06537238.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289828580|ref|ZP_06546405.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|60392287|sp|P0A1J1|FLGE_SALTY RecName: Full=Flagellar hook protein flgE
 gi|60392288|sp|P0A1J2|FLGE_SALTI RecName: Full=Flagellar hook protein flgE
 gi|25511789|pir||AB0640 flagellar hook protein FlgE [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|47673|emb|CAA36022.1| flgE protein (AA 1-403) [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|16419694|gb|AAL20107.1| hook protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16502347|emb|CAD08301.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137806|gb|AAO69367.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62127327|gb|AAX65030.1| flagellar biosynthesis, hook protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194401617|gb|ACF61839.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195630413|gb|EDX49039.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197213902|gb|ACH51299.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243343|gb|EDY25963.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197939687|gb|ACH77020.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204320301|gb|EDZ05505.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205272866|emb|CAR37795.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322416|gb|EDZ10255.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205328054|gb|EDZ14818.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205341012|gb|EDZ27776.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347322|gb|EDZ33953.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206709118|emb|CAR33451.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224468846|gb|ACN46676.1| flagellar hook protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261246388|emb|CBG24197.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992951|gb|ACY87836.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157718|emb|CBW17210.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912164|dbj|BAJ36138.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320086383|emb|CBY96156.1| Flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321223795|gb|EFX48858.1| Flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322714164|gb|EFZ05735.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323129447|gb|ADX16877.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326623708|gb|EGE30053.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326628165|gb|EGE34508.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332988068|gb|AEF07051.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 403

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 174 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPTTAST 228

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 229 TLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGD 288

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 289 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 348

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 349 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 403


>gi|325918877|ref|ZP_08180954.1| flagellar hook protein FlgE [Xanthomonas vesicatoria ATCC 35937]
 gi|325534914|gb|EGD06833.1| flagellar hook protein FlgE [Xanthomonas vesicatoria ATCC 35937]
          Length = 407

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 102/419 (24%), Positives = 183/419 (43%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG++A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   AFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  ++ G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAVSGEGFFTV-SSNGAKMYTRAGNFQTDSNGYVINPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +           L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDAGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
               D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 SPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGTAVGA 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             T++ S        AN       F  +T      + +++S  TQ    F  + +  +G+
Sbjct: 229 PTTLQFSDTGALTTPANGVIAMDPFTPSTGAGVLNMQLNVSGATQYGEAFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 TGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|221069322|ref|ZP_03545427.1| flagellar basal body FlaE domain protein [Comamonas testosteroni
           KF-1]
 gi|220714345|gb|EED69713.1| flagellar basal body FlaE domain protein [Comamonas testosteroni
           KF-1]
          Length = 422

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 172/422 (40%), Gaps = 8/422 (1%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
             +  +SG++A S  +  +  NIAN  T G+K +   F+ ++     S S      G+ +
Sbjct: 2   GFQQGLSGLNAASKNLDVIGHNIANSSTTGFKASRADFAEMIASAIGSASGQSSGIGVNV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QGS+  T +N DLAI G GFF+VK  D     TRAG+F ++ EG L+ V   
Sbjct: 62  AAVSQQFRQGSITSTGNNLDLAINGNGFFVVKQSDGSIAYTRAGNFGLDKEGNLKTVDND 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GY +   +  +   +             + A  T+T  +  NLD  AT    D T  
Sbjct: 122 NVMGYVVDPTTGKIQSGATPVPMSFPTGQP-IPAKQTSTVNVELNLDARATDAAGDATAT 180

Query: 183 HN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                    T+ +S   YDT G+++  ++Y+ K             D S           
Sbjct: 181 PPVAATPRATYGTSLNVYDTQGTAIPVNLYFEKDATGNTWNIFNSLDASATPIGTAVFDA 240

Query: 242 LNTVEVSFDPVTGYLANSS---HKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              +           + ++     +    +        +  D    TQ    F     + 
Sbjct: 241 SGKLTSVTPNAPTTGSGTTLDLSISGGTANPNGLPAFDVAFDFGGLTQFGTKFAVSSLKQ 300

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G     +V +DG +   Y +G      ++A+A   +   L     N ++ T DSG
Sbjct: 301 DGYTSGALTGINVGRDGSIVASYSNGVTRTEGQIALAAFTNTQGLGSIGNNKWVATSDSG 360

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
               G       G + SGALE +NVD+ +EL  ++ AQR+Y  N++  +T       L++
Sbjct: 361 PALNGSAQTGTFGSLQSGALEESNVDLTAELVNMMTAQRSYQANAQTIKTQDQVFSTLVN 420

Query: 419 LK 420
           L+
Sbjct: 421 LR 422


>gi|264676570|ref|YP_003276476.1| FlgE [Comamonas testosteroni CNB-2]
 gi|262207082|gb|ACY31180.1| FlgE [Comamonas testosteroni CNB-2]
          Length = 422

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 176/422 (41%), Gaps = 8/422 (1%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
             +  +SG++A S  +  +  NIAN +T G+K +   F+ +V     S S      G+ +
Sbjct: 2   GFQQGLSGLNAASKNLDVIGHNIANSNTTGFKASRADFAEMVASAIGSASGQSSGIGVNV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           ++      QGS+  T +N D+AI G GFF+VK  D     TRAG+F ++ EG L+ V   
Sbjct: 62  ASVSQQFRQGSITSTGNNLDIAINGNGFFVVKQSDGSIAYTRAGNFGLDKEGNLKTVDND 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            ++GY +  ++  +   +             + A  T+   +  NLD  AT    D T  
Sbjct: 122 NVMGYVVDPSTGKIQSGATPVPMSFPTGQP-IPAKQTSKVNVELNLDARATAAAGDATAT 180

Query: 183 HN-GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV---SIFRQDQSTNNSFPYN 238
                    T+ +S   YDT G+++  ++Y+ K           S+         +    
Sbjct: 181 PPVAATPRATYGTSLNVYDTQGTAIPVNLYFEKDATGNTWNVFNSLDATATPIGKAVFDA 240

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
              L +V  +          +   +    +        +  D    TQ    F     + 
Sbjct: 241 SGKLTSVTPNAPTTGSGTTLNLSVSGGTANPNGLQPFNVAFDFGGLTQFGTKFAVSSLKQ 300

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G     +V +DG +   Y +G      ++A+A   +   L     N ++ T DSG
Sbjct: 301 DGYTSGALTGINVGRDGSIVASYSNGVTRTEGQIALAAFTNTQGLGSIGNNKWVATSDSG 360

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
               G       G + SGALE +NVD+ +EL  ++ AQR+Y  N++  +T       L++
Sbjct: 361 PALNGSAQTGTFGSLQSGALEESNVDLTAELVNMMTAQRSYQANAQTIKTQDQVFSTLVN 420

Query: 419 LK 420
           L+
Sbjct: 421 LR 422


>gi|317129200|ref|YP_004095482.1| flagellar hook-basal body protein [Bacillus cellulosilyticus DSM
           2522]
 gi|315474148|gb|ADU30751.1| flagellar hook-basal body protein [Bacillus cellulosilyticus DSM
           2522]
          Length = 397

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 96/432 (22%), Positives = 175/432 (40%), Gaps = 48/432 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ +M   + GM +   ++  V +NIANV+T G+K+  + F  LV    S +        
Sbjct: 1   MIRAMYAGIGGMKSFQTKLDVVGNNIANVNTSGFKKGRVTFQDLVSQQMSGAATPTDNRG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G  + + D I  QGSL  T  + D+ I G GFFIV      +  +RAG+F+
Sbjct: 61  GINPMQVGLGTSMGSIDTIHTQGSLQTTGRDLDIGITGDGFFIVND-GGQSYYSRAGNFY 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++  G L N  G  + GY + +                      +    T       NL+
Sbjct: 120 LDENGDLVNANGLRVQGYSVVDGELDTNTLG----PLQIASGQLIPPQATDEAQFKGNLN 175

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
               +                T    +   D+LG+    ++ + K    +W         
Sbjct: 176 SETQVGE--------------TVNVPYPVIDSLGNMHYLELTFQKQAGNEW--------- 212

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
                     A    +        G    +    ++FN   +     I +D S+ +Q A 
Sbjct: 213 -------TVQAGGQALGNVNFGNDGSFVAADDMTVNFNPGNNANPLNIELDFSRMSQYAR 265

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
                   ++G+  G  + +S+S+ G +  ++ +G    + ++A+AT  +   L     N
Sbjct: 266 NSTADIHYVSGNVDGTLESYSISQAGEIMGVFSNGEVRLLGQIALATFNNPGGLSKSGNN 325

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y+ + +SG+  +G  G    G +   +LE +NVD++ E TE+I AQR +  N+++  T 
Sbjct: 326 LYMVSNNSGNPQVGLAGDGGRGMLTGASLEMSNVDLSEEFTEMIVAQRGFQANTRMITTS 385

Query: 410 SDFMDILISLKR 421
            + +  L++LKR
Sbjct: 386 DEILQELVNLKR 397


>gi|114330361|ref|YP_746583.1| flagellar hook protein FlgE [Nitrosomonas eutropha C91]
 gi|114307375|gb|ABI58618.1| flagellar basal body FlaE domain protein [Nitrosomonas eutropha
           C91]
          Length = 419

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 100/426 (23%), Positives = 180/426 (42%), Gaps = 20/426 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS--YVSGGLEIS 63
             +  +SG+ A S ++    +NIAN +TVG+K++   FS +   S       +  G +++
Sbjct: 2   GFQHGLSGLKAASAKLDVTGNNIANANTVGFKQSQAQFSDVFANSLGGGKNQIGIGTQVA 61

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG++  + +  D+AI G GFF     +     TR G FH++ +GFL N     
Sbjct: 62  AIAQEFAQGNVTSSDNPLDVAITGNGFFRT-NNNGTISYTRNGQFHLDKDGFLVNANSYN 120

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           + G+    +   +          + +  ++L+  PT       NLD   ++ +       
Sbjct: 121 VTGFAADASGQIIPNI----PVNLRLPTSDLTPKPTANFATGVNLDARTSVTSVA---FD 173

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF-PYNVAPL 242
                 Y H +S   +D+LG+S + ++++ KT   +W V           +  P  V   
Sbjct: 174 ANNPLTYAHSTSGEIFDSLGNSHILNLFFQKTNSTEWGVFATVDGAVDTTNGLPLGVTFG 233

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDN---------TSGIDQQITIDISKTTQLAGGFIP 293
                S    +  +  +    I    +          +  D   + D++++TQ    F  
Sbjct: 234 GGGSTSLTFDSNGIMTTPTGPIDVTVDFQAIDATKWGAIPDLTFSFDLTRSTQFGNKFGV 293

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                +G   G+   +S+S +G +   Y +G    + +LA+A   + + LK    N +  
Sbjct: 294 NMMNQDGFTSGRLAGYSISDNGEIRGSYTNGVTRTLGQLALAGFSNPNGLKPMGNNQWAE 353

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T +SG   IG P     G + S A+E +NVD+ SEL  LI  QR Y  N+K  QT    M
Sbjct: 354 TAESGLPLIGTPETGVLGSLQSSAVEESNVDLTSELVSLIMTQRVYQANAKTIQTQDAVM 413

Query: 414 DILISL 419
             ++++
Sbjct: 414 QSIMNI 419


>gi|301051140|ref|ZP_07197970.1| flagellar hook protein FlgE [Escherichia coli MS 185-1]
 gi|300297161|gb|EFJ53546.1| flagellar hook protein FlgE [Escherichia coli MS 185-1]
          Length = 401

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD KW+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNKWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +        N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSDPTKDIPPGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|323967017|gb|EGB62443.1| fagellar hook-basal body protein [Escherichia coli M863]
 gi|327253475|gb|EGE65113.1| flagellar hook protein flgE [Escherichia coli STEC_7v]
          Length = 401

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  + +       N 
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPSVKGFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           + P         
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWDVYTLDSSDPKGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LLFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|317492428|ref|ZP_07950857.1| fagellar hook-basal body protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919767|gb|EFV41097.1| fagellar hook-basal body protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 414

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 100/421 (23%), Positives = 188/421 (44%), Gaps = 14/421 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A ++ +  + +NIAN  TVG+K  ++ F+ +       S V  G+++++ 
Sbjct: 2   GFNQAVSGLNAAASNLDVIGNNIANSQTVGFKSGSVTFADMFA----GSKVGLGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G    T    D+AI G GFF ++  +     +R G F  N + FL N  G  L 
Sbjct: 58  QQDFTDGITTTTNRGLDVAISGNGFFRMQDANGGVYYSRNGQFTKNQDNFLTNAQGVFLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A +P  +        I +    + A  +++G +S NL+ +  +  P  +P    
Sbjct: 118 GYPA--AGSPPTIQQGAQPSPIQIPTGMMPAKASSSGNMSMNLNSSHEV--PKNSPFKVD 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTK-----TGDKKWEVSIFRQDQSTNNSFPYNVA 240
               YT+ +S   YD+LG++   ++Y+ K            ++      S +++     A
Sbjct: 174 DVDSYTYATSITTYDSLGNTHNMNLYFVKGAPVAATPPATGMTTPWTVYSVDSAAAAGTA 233

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK-TTQLAGGFIPQKSEIN 299
           P N  ++ FD         +  A++   N     Q   +  +    Q  G         +
Sbjct: 234 PQNAGKLEFDQNGTLQNPGTPLALNMAANNGAPAQNFNLTFTGSMQQNTGKDGVTAKSQD 293

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+A G+   + ++ DG +   Y +     + ++ +A   + + L+    N +  +  SG 
Sbjct: 294 GYAAGEMTGYQINDDGTITGTYSNQQTQLLAQIVMANFANPEGLQSEGNNMWKESATSGQ 353

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
             +G  G +  G + SGA+E +NVD++ EL  +I AQRNY  N++  +T    +  L++L
Sbjct: 354 AIVGVAGASGLGALTSGAVEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILQTLVNL 413

Query: 420 K 420
           +
Sbjct: 414 R 414


>gi|21242727|ref|NP_642309.1| flagellar hook protein FlgE [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294625274|ref|ZP_06703913.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664591|ref|ZP_06729932.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325927875|ref|ZP_08189099.1| flagellar hook protein FlgE [Xanthomonas perforans 91-118]
 gi|21108203|gb|AAM36845.1| flagellar biosynthesis hook protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|292600448|gb|EFF44546.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605648|gb|EFF48958.1| flagellar biosynthesis hook protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325541715|gb|EGD13233.1| flagellar hook protein FlgE [Xanthomonas perforans 91-118]
          Length = 407

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 103/420 (24%), Positives = 187/420 (44%), Gaps = 19/420 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
              T++SG++A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   GFNTSLSGINAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAVSGEGFFTV-SSNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTNNSFPYNVA 240
           +   D  Y+H +     YD+LG S V   Y+ KT    +W+V  +             V 
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQVYNYVD--------GAAVG 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
              T++ S        AN       F  +T      + ++++ +TQ    F  + +  +G
Sbjct: 228 APTTLQFSDTGALTTPANGIIAMDPFTPSTGAGVLNMQLNVTGSTQYGEAFALRDTRQDG 287

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG  
Sbjct: 288 YASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNMWAESYTSGAA 347

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G P  +  G+I SG+LE + VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 348 RTGAPDTSDLGQIESGSLEASTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|323976551|gb|EGB71639.1| fagellar hook-basal body protein [Escherichia coli TW10509]
          Length = 401

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  + +       N 
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPSVKAFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           + P         
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWDVYTLDSSDPKGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|188576756|ref|YP_001913685.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188576947|ref|YP_001913876.1| flagellar hook protein FlgE [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188521208|gb|ACD59153.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521399|gb|ACD59344.1| flagellar biosynthesis hook protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 407

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 102/419 (24%), Positives = 184/419 (43%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG+ A +  ++  S+NIANV+T G+K +   F+ +   ++     + V  G+ +
Sbjct: 2   AFNTSLSGISAANADLNVTSNNIANVNTTGFKESRAEFADMFQSTSYGLSRNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  + DLA+ G+GFF V   +     TRAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRSLDLAVSGEGFFTV-SSNGAKMYTRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +    +     V     L+ +        + P +T  ++           P  TP 
Sbjct: 121 RLQVFAPNPSGNGFDVGRLSDLQLL-----TTDSPPKSTSTVNLAFTLPGNATAPTVTPF 175

Query: 183 HNGRDAEYTHKSS-FAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
           +   D  Y+H +     YD+LG S V   Y+ KT +              N      V  
Sbjct: 176 NPADDKTYSHSTGGINVYDSLGVSHVQTSYFVKTANPNEWQV-------HNYVDGAAVGS 228

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             T++ S        AN       F  +T      + +++S +TQ    F  + +  +G+
Sbjct: 229 PTTLQFSDTGALTAPANGIIAMTPFTPSTGAGVLSMQLNVSGSTQYGEQFALRDTRQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK  + S+   G V   Y +G   P+ ++A+++  +   L+    N +  +  SG   
Sbjct: 289 ASGKLNEISIDTSGVVFARYSNGADKPLGQVALSSFVNPQGLQSQGNNVWAESYTSGAAR 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
              P  +  G+I SG+LE++ VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 349 TSAPNTSDLGQIESGSLESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTIINIR 407


>gi|259907634|ref|YP_002647990.1| Flagellar hook protein FlgE [Erwinia pyrifoliae Ep1/96]
 gi|224963256|emb|CAX54740.1| Flagellar hook protein FlgE [Erwinia pyrifoliae Ep1/96]
 gi|283477476|emb|CAY73392.1| flgE [Erwinia pyrifoliae DSM 12163]
          Length = 410

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 102/417 (24%), Positives = 187/417 (44%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A ++ +  V +NIAN  T G+K  +I F+ +   +        G++++  
Sbjct: 2   SFSQGLSGLNAAASALDVVGNNIANSQTFGFKAGSIGFADIFAGAQ-----GMGVQVAGS 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G L  T  N D+ I G GFF +         +R G F  +  G++ N+  G+ L
Sbjct: 57  SQNFKDGGLTGTGRNMDMGINGNGFFRLMDEAGQAYYSRNGQFDTDVNGYITNLTNGLRL 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
               +    P  + +   +  I +    +  + +T+G ++ NL  +A ++T  KTP  + 
Sbjct: 117 TG-YQATGTPPAIQAGAAVAPIQIDKTGMPPVASTSGKLNGNLTASAEVVT--KTPFDHT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN-T 244
               +   S   A+D+LG+    D+YY KT   +W+           +  P         
Sbjct: 174 DGETFNSSSQIEAFDSLGNRHTIDIYYVKTATGEWKAYANDASAPVTSGTPPKSEYTELD 233

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL-AGGFIPQKSEINGHAP 303
           ++   +      A SS   +            + +D+S  TQ  +     +  + +GHA 
Sbjct: 234 IKFDENGKLTNDAASSILNVKSAGLNGATPLDLQLDLSGITQHESDASTFEPVKTDGHAA 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G   +F +  +G +   YD+G +  I ++ +A   +   L+    NT++ +  SG   IG
Sbjct: 294 GNYVNFQIGDNGEITANYDNGEKQLIAQVVLANFANPGGLQQNGNNTWVESPQSGGSIIG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G    G +  GALE +NVD+ SE+  +I  QRNY  NS+  +T S+ +  L++L+
Sbjct: 354 TAGTGSFGSLTGGALENSNVDLGSEMVNMIVYQRNYQSNSQTIKTQSEMLQTLVNLR 410


>gi|237755390|ref|ZP_04584017.1| flagellar basal body and hook protein FlgE [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692431|gb|EEP61412.1| flagellar basal body and hook protein FlgE [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 413

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 116/427 (27%), Positives = 182/427 (42%), Gaps = 22/427 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--------PSTSNS 54
           +L S  TA++G++     ++ +SDNIANV+T+G+K   + F  L+          +  N+
Sbjct: 1   MLQSFYTAITGLNGNQQWLNVISDNIANVNTIGFKSERVTFEDLIAHSLTTFANNTPKNT 60

Query: 55  YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEG 114
            + GG  I+       QGS M+T S TDLA+ G+GFF+VK        TRAG F +N +G
Sbjct: 61  EIGGGSFIALTTKDFSQGSFMNTNSPTDLALDGEGFFMVKDNQGTVYYTRAGQFRLNADG 120

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
            L NV G  L G+ L +    +       +                   +        + 
Sbjct: 121 DLVNVDGMKLQGWTLDDKGNIIGALDKINVPYAINPTITTKISLVEPTNL-------DSR 173

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
                          + + +S   YD+LG+      Y+ K      E S     +     
Sbjct: 174 SNVISATFDPTDSTTFNYVNSMTVYDSLGNPHTLSFYFQK----TNESSTGSTWKVYVYM 229

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
                  + +  ++FD      + S         N +   Q IT+D+SK  Q+A  FI  
Sbjct: 230 DNDLTTQVGSSTLNFDTNGNLTSGSPFTLSLTLTNGATSPQSITVDVSKIKQVASDFIFY 289

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G A G     +V++DG +  +Y +G    I RLA+AT   ++ L     N YLP 
Sbjct: 290 A-NQDGFAKGDLIGVAVAEDGIIKGMYSNGNVKNIARLAVATFKDKEMLVRKGNNLYLPN 348

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             +    I  PG     ++ SG LE +NVDI+ E   LI AQR Y  N++V  T    + 
Sbjct: 349 TQTFTPII-TPG-GILSKVRSGFLELSNVDISREFINLITAQRAYQANARVITTDDQILQ 406

Query: 415 ILISLKR 421
             +++KR
Sbjct: 407 EAMNIKR 413


>gi|284989548|ref|YP_003408102.1| flagellar hook-basal body protein [Geodermatophilus obscurus DSM
           43160]
 gi|284062793|gb|ADB73731.1| flagellar hook-basal body protein [Geodermatophilus obscurus DSM
           43160]
          Length = 408

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 123/434 (28%), Positives = 192/434 (44%), Gaps = 41/434 (9%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L SM +A+SG+ A   ++    +NIANV+TVGYK +   F   +               
Sbjct: 1   MLRSMNSAISGLRAHQTKLDVTGNNIANVNTVGYKASQTVFEDTLSQVVRNGSAPTAQAG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+ + V  G++++      EQGS  +T  +TD  I G GFFI +  +     TRAG F 
Sbjct: 61  GTNPAQVGLGVKVAGITTNFEQGSAQNTGRSTDFMISGDGFFITQAGN-EQLYTRAGSFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +  G L    G +L G+   +          Q           +    T  G +  NL 
Sbjct: 120 YDGAGNLVTPDGALLQGWMATDGVVNTNGPIRQLTVPFG---DVMQPTETDNGAVVGNLS 176

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
             A   T  +T                  YD LG +    + +TKTGD  W V    +++
Sbjct: 177 SAAANGTGVQTQ--------------MTMYDALGKAHQISLSFTKTGDNTWNVVARDENE 222

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT--SGIDQQITIDISKTTQL 287
           +   S            ++F+PV G L  +S       D +       Q+TID++   Q 
Sbjct: 223 AVLASTA--------GPLAFNPVAGTLPAASRTFQITPDASMAGSWPGQVTIDLADLRQF 274

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
            G      + ++G+A G  +  S+S DG V  +Y +  R PI +LA+AT  +   L    
Sbjct: 275 GGPSGLTPARVDGNAMGSLQSISLSGDGTVMGVYSNNLREPIGKLALATFANPGGLAKAG 334

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
            +++    +SG  +IG PG    G + +GALE +NVD+A E T LI AQR +  NS+V  
Sbjct: 335 NSSFRVGDNSGQPAIGEPGGGGRGSLVAGALEMSNVDLAEEFTGLIVAQRGFQANSRVIS 394

Query: 408 TGSDFMDILISLKR 421
           +  + +  L++LKR
Sbjct: 395 SSDEVLQDLVNLKR 408


>gi|161503735|ref|YP_001570847.1| flagellar hook protein FlgE [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160865082|gb|ABX21705.1| hypothetical protein SARI_01820 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 402

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 174/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    + T      +  
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQVNLNSTDPVPTKA---FNPA 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 173 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----TATAPTAAST 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 TLKFNENGILESGGTVNITTGTINGATAATFSLNFLNSMQQNTGANNIVATNQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|225628428|ref|ZP_03786462.1| flagellar hook protein FlgE [Brucella ceti str. Cudo]
 gi|225616274|gb|EEH13322.1| flagellar hook protein FlgE [Brucella ceti str. Cudo]
          Length = 456

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 171/421 (40%), Positives = 240/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 61  MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 120

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 121 LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 180

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 181 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 236

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 237 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 278

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 279 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 335

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 336 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 395

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 396 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 455

Query: 421 R 421
           R
Sbjct: 456 R 456


>gi|117620743|ref|YP_857343.1| flagellar hook protein FlgE [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117562150|gb|ABK39098.1| flagellar hook protein FlgE [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 444

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 104/444 (23%), Positives = 173/444 (38%), Gaps = 30/444 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+T G+K +   F+ +   S    + + V  G+  
Sbjct: 2   SFNNALSGVNAAQKDLNVTANNIANVNTTGFKESRAEFADVYANSIFVNAKTQVGNGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
                   QG+L  T +  DL+IQG GFF+      +     TRAG F +N   ++ N  
Sbjct: 62  GAVAQQFHQGALQFTNNALDLSIQGNGFFVTSDGLTNLDRTFTRAGAFKLNENSYMVNNQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +     P  V+     + I +         T     S NL   +       T
Sbjct: 122 GNYLQGYEINTDGTPKAVSINAT-KPIQIPDRAGEPKMTELVEASFNLSIESKTKPTSPT 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQDQS 230
                  A + H +S   YD+LG+  V   Y+ +               W + ++  ++ 
Sbjct: 181 AFDPTNSATFAHSTSVTIYDSLGAPHVITKYFVRHEDPAAPGTPLTPGTWSMYMYEGNKP 240

Query: 231 TNNSF--PYNVAPLNTVEVSFDPVTGYLANSSH------------KAISFNDNTSGIDQQ 276
            + +   P     + T         G L  +                     N +   Q 
Sbjct: 241 IDIAGGSPSPATGVPTGVKMEFTSGGKLDPTKTVPADPIKTVALGTTAGIITNGADPAQT 300

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           + I +   TQ +  F   K   +G   G      ++ DG V   Y + T + +  +A+A 
Sbjct: 301 LEIRLGDVTQYSSPFNVTKLTQDGATVGNLTKVEITPDGIVSATYSNATTLKVAMVALAK 360

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L      ++  +  SGD   G P     G I S ALE +NVD+ S+L  LI AQ
Sbjct: 361 FANSQGLTQVGDTSWRQSLLSGDALPGTPNSGTLGSIKSSALEQSNVDLTSQLVNLITAQ 420

Query: 397 RNYAVNSKVFQTGSDFMDILISLK 420
           RN+  NS+  +  S     ++ ++
Sbjct: 421 RNFQANSRSLEVNSSLQQTILQIR 444


>gi|149911702|ref|ZP_01900310.1| flagellar hook protein FlgE [Moritella sp. PE36]
 gi|149805232|gb|EDM65249.1| flagellar hook protein FlgE [Moritella sp. PE36]
          Length = 435

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 115/437 (26%), Positives = 184/437 (42%), Gaps = 25/437 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+T G+K +   F  +   S    + + V  G+  
Sbjct: 2   SFNIALSGINAAQKDLNTTANNIANVNTTGFKESRAEFGDVYATSIFSNAKTSVGNGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           S      +QGSL  T ++ DLAI G GFF++           TRAG F ++   F+ N A
Sbjct: 62  SHIAQQFQQGSLNFTENSLDLAINGNGFFVMADGLESMDRNYTRAGAFKLDANSFVTNSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  Y + +  +P  V+               + +P +TG +   ++  AT    D T
Sbjct: 122 GNYLQVYDVNDDGSPKAVSMASTKPLQIPDT---AGVPESTGNVDMTMNLPATSPLLDPT 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-----GDKKWEVSIFRQDQSTN--- 232
                    YT  +S + YD+LG S     YY K          W    +  DQ  +   
Sbjct: 179 KFDPVDSGTYTAATSVSIYDSLGESHTLSTYYVKDGTAGAPANSWLEFNYVDDQPVDIVG 238

Query: 233 ----NSFPYNVAPLNTVEVSFDPV-----TGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                S P        ++++FD          +   +    +   N +   Q I ++I+ 
Sbjct: 239 GQAVASAPGTPVKPAALQLTFDSSGLLQQQLPVIAETVPLGAILTNGADTSQTIKVNINN 298

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQ A  F   K E +G   G+     +  DG V   Y +G    +  +A+A   +E  L
Sbjct: 299 PTQFASAFEVSKLEQDGATVGRLTGIDIGPDGMVLASYSNGRNDKLGMIAMAKFANEQGL 358

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  +  ++ SG    G       G+I S ALE +NV++ SEL  LI AQRNY  NS
Sbjct: 359 SQTGDTGWRASQLSGAAIAGEANSGTFGKINSSALEQSNVNLTSELVNLITAQRNYQANS 418

Query: 404 KVFQTGSDFMDILISLK 420
           +  +  S   D ++ ++
Sbjct: 419 RTLEVNSKLQDTVLQIR 435


>gi|291613038|ref|YP_003523195.1| fagellar hook-basal body protein [Sideroxydans lithotrophicus ES-1]
 gi|291583150|gb|ADE10808.1| fagellar hook-basal body protein [Sideroxydans lithotrophicus ES-1]
          Length = 405

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 95/418 (22%), Positives = 179/418 (42%), Gaps = 17/418 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
             +  +SG++A S  +  + +N+AN  TVG+K++   F+ +   S   +S      G  +
Sbjct: 2   GFQQGLSGLNAASKSLDVIGNNVANASTVGFKQSQAQFADVYASSMAGSSGGQAGIGTRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +T      QG++  T ++ D+A+ G GFF     +     +R G F ++  GF+ N  G 
Sbjct: 62  ATVAQQFTQGNITTTNNSLDMAVSGSGFFR-MDNNGSITFSRNGQFQLDKNGFIVNSQGY 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L G+    A A +           +++ +    +P  T  ++  L+ +A    P   P 
Sbjct: 121 KLTGFLPNAAGAIVATT------PADIQVSTADLLPKATANVTAGLNLDARSTVPAIAPF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                A + + +S   YD+LG   V  +Y+ KT    W   +              +   
Sbjct: 175 DPNNPATFNNSTSSTIYDSLGGPHVASLYFVKTATNAWSSYLTVDGTQVGAGALTAMTFS 234

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           ++  ++           +  + +F     G  Q ++I+ S T+Q    F       +G+ 
Sbjct: 235 SSGVLT-------APAGAVTSAAFTPAGGGAAQTLSINFSGTSQFGSTFGVNSLSQDGYT 287

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G    FS   DG V   Y +G    + ++ +A   +   L+    N ++ T  SG   +
Sbjct: 288 SGHMTGFSTGSDGIVTGRYSNGQTKTLAQVVLANFSNAQGLQPLGNNQWVETSTSGTPLV 347

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G PG    G + + A+E +NVD+ +EL  +I AQR Y  N++  +T    +  +++L+
Sbjct: 348 GAPGSASLGVLQTSAVEDSNVDLTAELVNMITAQRVYQANAQTIKTQDQVLQTIVNLR 405


>gi|327192294|gb|EGE59259.1| flagellar hook protein FlgE [Rhizobium etli CNPAF512]
          Length = 483

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 185/431 (42%), Positives = 248/431 (57%), Gaps = 11/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 54  MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 113

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  ISEQG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 114 QTSVRQAISEQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNSA 173

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 174 GYTLMGYSYDSGVPAVVVNGFDGLVPVNVAQSGLSAIASTSAYFSGNLNSEATVVTDTTT 233

Query: 181 PK--HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW--------EVSIFRQDQS 230
               +     + T K S  AYD+LG++V YD Y+TKTG               +     +
Sbjct: 234 LPSANTSSVTDDTQKMSLVAYDSLGATVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 293

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
              +      P ++  VS   ++         A   +       Q I++D S  TQLA  
Sbjct: 294 DAATRGTTSFPYSSDAVSVSTLSFDADGQLTSATDTDIVDPTTAQTISMDYSSFTQLASD 353

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F       +G A       S+  DG V + Y +GT   +Y++ +ATV S DNL L  GN 
Sbjct: 354 FSATG-SADGQAASSVSSVSIDTDGVVSVSYANGTTKALYQIPLATVASPDNLTLLSGNV 412

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  NSKVFQTGS
Sbjct: 413 YTANGRSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKVFQTGS 472

Query: 411 DFMDILISLKR 421
           D MD+L++LKR
Sbjct: 473 DIMDVLVNLKR 483


>gi|161614600|ref|YP_001588565.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168237259|ref|ZP_02662317.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244776|ref|ZP_02669708.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449419|ref|YP_002045176.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194736988|ref|YP_002114176.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|161363964|gb|ABX67732.1| hypothetical protein SPAB_02350 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194407723|gb|ACF67942.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712490|gb|ACF91711.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197289882|gb|EDY29243.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|205336442|gb|EDZ23206.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 403

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 174 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPAAPST 228

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 229 TLVFNANGTLQSGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGD 288

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 289 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 348

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 349 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 403


>gi|85058011|ref|YP_453713.1| flagellar hook protein FlgE [Sodalis glossinidius str. 'morsitans']
 gi|84778531|dbj|BAE73308.1| flagellar hook protein FlgE [Sodalis glossinidius str. 'morsitans']
          Length = 404

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 93/419 (22%), Positives = 170/419 (40%), Gaps = 20/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A +  +  + +NIAN  TVG+K ++ +F+ +   S     +  G++++  
Sbjct: 2   GFAQGVSGLNAAAQALDVIGNNIANAQTVGFKSSSASFADMFSESM----IGLGVQLAGV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+++  A N ++AI G GFF +         +R G+F  N  G + N  G  L 
Sbjct: 58  QQDFNDGTMIAGAGNINMAIAGSGFFRLADNGGKIYYSRNGEFERNKYGEIVNKQGKYLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY                L  I V    +    +T G + +NL  N+    P        
Sbjct: 118 GYKAT----------GTPLGNITVPDTPMPGAVSTEGSLGDNLPSNSE--PPKVAEFDIK 165

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV---SIFRQDQSTNNSFPYNVAPL 242
               Y + + F AYD+LG+     VYY K  +                 + +       +
Sbjct: 166 EPKSYNYSTQFTAYDSLGNPHNIKVYYIKGKEAGQWTVKCYDETAPVLLDPNDKDKKPKI 225

Query: 243 NTVEVSFDPVTGYLANSSHK-AISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            + +++FD        ++ K            + +  I +    Q    +     + NG+
Sbjct: 226 FSQDITFDAYGNLDEKTTPKLPFESAKLNGANELKFDITLFGLKQQGTEWTMSLPQTNGY 285

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A GK   +SV  +G +   Y +     I ++ +A+  +   L+    N +  T  SG   
Sbjct: 286 AVGKFNGYSVGDNGEIIASYSNQQTQLIAQVVMASFTNTGGLQPSGDNCWTETGASGAPL 345

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           IG       G I    LE +NVD+++EL +++  QRNY  N++  +T    +  L+S++
Sbjct: 346 IGTSDTGSFGVIRGKMLEASNVDMSNELVKMMTQQRNYQSNAQTIKTQDQLLQTLVSMR 404


>gi|323705438|ref|ZP_08117013.1| fagellar hook-basal body protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535340|gb|EGB25116.1| fagellar hook-basal body protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 424

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 109/440 (24%), Positives = 185/440 (42%), Gaps = 37/440 (8%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L SM +A+SG+ A    +  + +NIANV+TVG+K + + F  +   +            
Sbjct: 1   MLRSMYSAVSGLKANQAEMDVIGNNIANVNTVGFKASRMTFKEIFNQTIKGASAPQDNGG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   +  G+ I++ D +   G    T + TDL+I G GFFIV      N  TRAG+F 
Sbjct: 61  GTNPQQIGLGVAIASIDTLFSNGGSQRTDNPTDLSIDGNGFFIV-NNGGANLYTRAGNFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            ++ G L    G  ++G+ +      +  ++           +  S   T T  +  NL 
Sbjct: 120 FDSNGDLVTPDGYKVMGW-ISQDGKTVNTDTGNLSPISIKNWSSTSPASTKTIQLGGNL- 177

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
                          G     +   +   YD+ G S V  + +TK  +     +      
Sbjct: 178 -------------DAGTSVGSSVSYNVTIYDSQGGSHVATIQFTKQDNAGNWNATITNFD 224

Query: 230 STNNSFPYNVAPL--------NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
            TN S P  +  +                PV  +    S   I+  + T G    IT+D+
Sbjct: 225 GTNLSTPVTIGTITFDSSGVIQQPAPPASPVGIFTVGVSSLPITNTNATLGDGTNITVDL 284

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           SK T  +     ++   +G++ G  +  ++ + G V  IY +G    I ++A+A   +  
Sbjct: 285 SKLTMYSNPTDIRELSKDGNSAGSIESINIDQYGVVSGIYSNGRTQVIGQIALADFQNTQ 344

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+      ++ T +SGD  IG       G I  G LE +NVD+A+E   +I  QR +  
Sbjct: 345 GLEKVGNTMFINTVNSGDPMIGAANTGTRGTIDPGTLEMSNVDLANEFANMITTQRGFEA 404

Query: 402 NSKVFQTGSDFMDILISLKR 421
           N+KV  T  + +  L++L R
Sbjct: 405 NAKVITTSDEILQDLVNLIR 424


>gi|310764860|gb|ADP09810.1| Flagellar hook protein FlgE [Erwinia sp. Ejp617]
          Length = 410

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 102/417 (24%), Positives = 187/417 (44%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A ++ +  V +NIAN  T G+K  +I F+ +   +        G++++  
Sbjct: 2   SFSQGLSGLNAAASALDVVGNNIANSQTFGFKAGSIGFADIFAGAQ-----GMGVQVAGS 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G L  T  N D+ I G GFF +         +R G F  +  G++ N+  G+ L
Sbjct: 57  SQNFKDGGLTGTGRNMDMGINGNGFFRLMDEAGQAYYSRNGQFDTDVNGYITNLTNGLRL 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
               +    P  + +   +  I +    +  + +T+G ++ NL  +A ++T  KTP  + 
Sbjct: 117 TG-YQATGTPPAIQAGAAVAPIQIDKTGMPPVASTSGKLNGNLTASAEVVT--KTPFDHT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN-T 244
               +   S   A+D+LG+    D+YY KT   +W+           +  P         
Sbjct: 174 DGETFNSSSQIEAFDSLGNRHTIDIYYVKTATGEWKAYANDASAPVTSGTPPKSEYTELD 233

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL-AGGFIPQKSEINGHAP 303
           ++   +      A SS   +            + +D+S  TQ  +     +  + +GHA 
Sbjct: 234 IKFDENGKLTNDAASSILNVKSAGLNGATPLDLQLDLSGITQHESDASTFEPVKTDGHAA 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G   +F +  +G +   YD+G +  I ++ +A   +   L+    NT++ +  SG   IG
Sbjct: 294 GNYVNFQIGDNGEITANYDNGEKQLIAQVVLANFANPGGLQQNGNNTWVESPQSGGSIIG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G    G +  GALE +NVD+ SE+  +I  QRNY  NS+  +T S+ +  L++L+
Sbjct: 354 MAGTGSFGSLTGGALENSNVDLGSEMVNMIVYQRNYQSNSQTIKTQSEMLQTLVNLR 410


>gi|226944492|ref|YP_002799565.1| flagellar basal body rod protein [Azotobacter vinelandii DJ]
 gi|226719419|gb|ACO78590.1| Flagellar basal body rod protein [Azotobacter vinelandii DJ]
          Length = 383

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 107/416 (25%), Positives = 185/416 (44%), Gaps = 34/416 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ ++ VS+NIAN  TVG+K +   F+ +   S     V  G++++  
Sbjct: 2   GFSQALSGLNAASSNLNVVSNNIANSQTVGFKSSTTQFADVYASS----RVGLGVQVAGV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+L  T  + DLAI G GFF    +      +R G   +  EG+L+N  G  LL
Sbjct: 58  VQNFTSGNLETTDRSLDLAISGSGFFR-FEQAGQVVYSRNGQLTLTPEGYLQNAQGARLL 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
                                I +    L A PTT    + NLD  + +IT         
Sbjct: 117 ----------------GSNGAIQIPADGLQAQPTTEFDATLNLDSGSDVITAA---FDAT 157

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y++ ++   +D+LG+S    +Y+TKTG  +W V+                   +  
Sbjct: 158 DENTYSYANTATVFDSLGNSHELTLYFTKTGTNEWAVNAALD----------GAVSASAA 207

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           +      +G L   +  +  F       D    +D++ +TQ    F     + +G+  G 
Sbjct: 208 QALEFTTSGLLDGYTPTSFDFAMTNGAADISFELDLTGSTQFGNDFEVSSLDQDGYTAGS 267

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              F++ ++G V   Y +   + + ++ +AT  S + L+    N ++ T  SG   +G  
Sbjct: 268 LVGFTIEENGNVVGNYSNEQSLVVGQIQLATFRSPEGLQPVGDNAWVETAASGQPLVGTA 327

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           G+ Q G + SG +E +NVD+  EL  LI AQRN+  N++   T S+ ++  ++L R
Sbjct: 328 GNGQFGSLESGVVEASNVDLTKELVNLIIAQRNFQANAQSVSTQSEVLEQAVNLGR 383


>gi|292489133|ref|YP_003532020.1| flagellar hook protein FlgE [Erwinia amylovora CFBP1430]
 gi|292900252|ref|YP_003539621.1| flagellar hook protein [Erwinia amylovora ATCC 49946]
 gi|291200100|emb|CBJ47226.1| flagellar hook protein [Erwinia amylovora ATCC 49946]
 gi|291554567|emb|CBA22181.1| Flagellar hook protein flgE [Erwinia amylovora CFBP1430]
 gi|312173291|emb|CBX81546.1| Flagellar hook protein flgE [Erwinia amylovora ATCC BAA-2158]
          Length = 410

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 102/417 (24%), Positives = 186/417 (44%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG++A ++ +  V +NIAN  T G+K  +I F+ +   +        G++++  
Sbjct: 2   SFSQGLSGLNAAASALDVVGNNIANSQTFGFKSGSIGFADIFAGAQ-----GMGVQVAGS 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G L  T  N D+ I G GFF +         +R G F  +  G++ N+  G+ L
Sbjct: 57  GQNFKDGGLTGTGRNLDMGINGNGFFRLMDEAGQAYYSRNGQFDTDVNGYITNLTNGLRL 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
               +    P  + +   +  I +    +  + +T+G ++ NL  ++ +IT  KTP  + 
Sbjct: 117 TG-YQATGTPPAIQAGAAVAPIQIDKTGMPPVASTSGKLNGNLTASSEVIT--KTPFDHT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN-T 244
               +   S   A+D+LG+    D+YY KT   +W+           +  P         
Sbjct: 174 DADTFNSSSQIEAFDSLGNRHTIDIYYVKTATGEWKAYANDASAPVTSGTPPKSEYTELA 233

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL-AGGFIPQKSEINGHAP 303
           +    +      A SS   +            + +D+S  TQ  +     +  + +GHA 
Sbjct: 234 ITFDENGKLTNDAASSILNVKSAGLNGATPLDLQLDLSGITQHESDASTFEPVKTDGHAA 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           G   +F +  +G +   YD+G +  I ++ +A   +   L+    NT++ +  SG   IG
Sbjct: 294 GNYVNFQIGDNGEITANYDNGEKQLIAQVVLANFANPGGLQQNGNNTWVESPQSGGSIIG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             G    G +  GALE +NVD+ SE+  +I  QRNY  NS+  +T S+ +  L++L+
Sbjct: 354 TAGSGSFGSLTGGALENSNVDLGSEMVNMIVYQRNYQSNSQTIKTQSEMLQTLVNLR 410


>gi|168234103|ref|ZP_02659161.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194468943|ref|ZP_03074927.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455307|gb|EDX44146.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205331935|gb|EDZ18699.1| flagellar hook protein FlgE [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 425

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 100/432 (23%), Positives = 174/432 (40%), Gaps = 25/432 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+       P K P    
Sbjct: 118 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQVNLNSTDA--KPAKNPFDPS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ-------------DQSTN 232
               Y  K S   YD+ G++    +YY K    KW+V                    + N
Sbjct: 174 DANTYNKKGSITVYDSQGNAHDMSIYYVKNDSNKWDVWTLDSSVAGATANKAAQMHFTEN 233

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSH----KAISFNDNTSGIDQQITIDISKTTQLA 288
            +         T      P        +     + I+   N +         ++   Q  
Sbjct: 234 GTLDEIYNYRLTSTPPASPTWDLATTPNPEKQIQIITGTINGATPADFSLSFLNSMQQNT 293

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
           G      +  NG+ PG    + ++ DG V   Y +     + ++ +A   + + L     
Sbjct: 294 GSNNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGD 353

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N +  T+ SG   +G  G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T
Sbjct: 354 NVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKT 413

Query: 409 GSDFMDILISLK 420
               ++ L++L+
Sbjct: 414 QDQILNTLVNLR 425


>gi|170683341|ref|YP_001744104.1| flagellar hook protein FlgE [Escherichia coli SMS-3-5]
 gi|300938641|ref|ZP_07153370.1| flagellar hook protein FlgE [Escherichia coli MS 21-1]
 gi|170521059|gb|ACB19237.1| flagellar hook protein FlgE [Escherichia coli SMS-3-5]
 gi|300456426|gb|EFK19919.1| flagellar hook protein FlgE [Escherichia coli MS 21-1]
          Length = 401

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  + +       N 
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPSVKAFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWDVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|311992301|gb|ADQ26724.1| flagellar hook protein [Aeromonas hydrophila]
          Length = 443

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 104/444 (23%), Positives = 175/444 (39%), Gaps = 30/444 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+T G+K +   F+ +   S    + + V  G+  
Sbjct: 1   SFNNALSGVNAAQKDLNVTANNIANVNTTGFKESRAEFADVYANSIFVNAKTQVGNGVAT 60

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
                   QG+L  T +  DL+IQG GFF+      +     TRAG F +N   ++ N  
Sbjct: 61  GAVAQQFHQGALQFTNNALDLSIQGNGFFVTSDGLTNLDRTFTRAGAFKLNENSYMVNNQ 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +     P  V+     + I +         T     S NL   +        
Sbjct: 121 GNYLQGYEINTDGTPKAVSINAT-KPIQIPDRAGEPKMTELVEASFNLSIESKTKPTSPA 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG----------DKKWEVSIFRQDQS 230
                  A + H +S   YD+LG+  V   Y+ +               W + ++  ++ 
Sbjct: 180 AFDPTNSATFAHSTSVTIYDSLGAPHVITKYFVRHEDPAAPGTPLTPGTWSMYMYEGNKP 239

Query: 231 TNNSF--PYNVAPLNTVEVSFDPVTGYLANSSHKAIS------------FNDNTSGIDQQ 276
            + +   P   A + T         G L  +    +               +N +   Q 
Sbjct: 240 IDIAGGSPSPAAGIPTGVKMTFTSGGKLDPTLTVPVDPIKTVALGTTAGIINNGADPTQT 299

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           + I +   TQ +  F   K   +G   G      ++ DG V   Y + T + +  +A+A 
Sbjct: 300 LEIRLGDVTQYSSPFNVTKLTQDGATVGNLTKVEITPDGIVSATYSNATTLKVAMVALAK 359

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L      ++  +  SGD   G P     G I S ALE +NVD+ S+L  LI AQ
Sbjct: 360 FANSQGLTQVGDTSWRQSLLSGDALPGTPNSGTLGSIKSSALEQSNVDLTSQLVNLITAQ 419

Query: 397 RNYAVNSKVFQTGSDFMDILISLK 420
           RN+  NS+  +  S     ++ ++
Sbjct: 420 RNFQANSRSLEVNSSLQQTILQIR 443


>gi|126668558|ref|ZP_01739512.1| flagellar hook protein E [Marinobacter sp. ELB17]
 gi|126626963|gb|EAZ97606.1| flagellar hook protein E [Marinobacter sp. ELB17]
          Length = 435

 Score =  249 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 103/440 (23%), Positives = 175/440 (39%), Gaps = 31/440 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP---STSNSYVSGGLEI 62
           +  T +SG+ A +  +    +NIAN  TVG+K + + F  L      S+ N+ V  G+ +
Sbjct: 2   AFNTGLSGLRAAAVDLDVTGNNIANASTVGFKGSRVQFGDLYANGFLSSGNAPVGDGISV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
            +      QG++  T +  D AI G GFF++         +RAG F  + +GF+ N    
Sbjct: 62  QSVKQSFGQGNVSFTDNGLDFAIDGDGFFVL-NNGGELRYSRAGQFGTDKDGFVVNNQNM 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK-TP 181
            + G+    A            + + +    LS   TT      NLD    ++T     P
Sbjct: 121 RVQGFVADAAGNL-----SGIRDDLQIGSDNLSPQRTTNLRTDLNLDAREQVLTATPPIP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   Y H ++   +D+LG+      +YTK        S +      +       A 
Sbjct: 176 FDPLDPTTYNHVTATNIFDSLGNPHEVTQFYTKQAPASGSQSNWLLHLQIDGEAVGGAAG 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTS---------------------GIDQQITID 280
             T   +F P       S + A + ++                        G      ++
Sbjct: 236 STTTPPNFVPYELVFDQSGNLASADSNANGVISIANWVPKDGDLNANGAASGAGAAFDLN 295

Query: 281 ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSE 340
           +   TQ    F       +G   G+     VS+ G +   Y +G    + ++A+A+  + 
Sbjct: 296 LGSATQYGANFGVNDQRQDGFTTGRLSGLDVSQQGVIFARYTNGQSKSLGQVALASFNNT 355

Query: 341 DNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYA 400
           D L      +++ T +SG   IG P     G I S ++E +NVD+++EL  LI AQRNY 
Sbjct: 356 DGLSPSGDTSWVETFESGQAVIGRPDSGTLGAIQSSSVEESNVDLSAELVNLIIAQRNYQ 415

Query: 401 VNSKVFQTGSDFMDILISLK 420
            N+K  +T       +I+L+
Sbjct: 416 ANAKTIETSDAVTQTIINLR 435


>gi|330830303|ref|YP_004393255.1| flagellar hook protein FlgE [Aeromonas veronii B565]
 gi|328805439|gb|AEB50638.1| Flagellar hook protein FlgE [Aeromonas veronii B565]
          Length = 450

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 106/450 (23%), Positives = 176/450 (39%), Gaps = 36/450 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+T+G+K +   F+ +   S    + + V  G+  
Sbjct: 2   SFNNALSGVNAAQKDLNVTANNIANVNTMGFKESRAEFADVYANSIFVNAKTQVGNGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
                   QG+L  T +  DLAIQG GFF+      +     TRAG F +N   ++ N  
Sbjct: 62  GAVAQQFHQGALQFTNNALDLAIQGNGFFVTSDGLTNLDRTYTRAGAFKLNENSYMVNNQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP--D 178
           G  L GY +     P  V+     + I +       + T+    S NL   +T      +
Sbjct: 122 GHYLQGYEINTDGTPKAVSINAT-KPIQIPDRAGEPIKTSKIEASFNLPSTSTTKPHLFN 180

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----------WEVSIFRQD 228
            +         Y+  +S   YD+LG       Y+ +  D            W + +++ D
Sbjct: 181 PSNFDPKDSKTYSSSTSVVIYDSLGEPHTITKYFVRDADTTDPTKPADPPSWRMYLYQGD 240

Query: 229 QSTNNSFPYNVAPLNT------------------VEVSFDPVTGYLANSSHKAISFNDNT 270
           +  +           T                    V+   +                N 
Sbjct: 241 KPIDIVGGAQPTMAPTLSQAPRAAQITFGSDGKMNAVTPLTLKTQPLGPGVGNAGIITNG 300

Query: 271 SGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
           +   QQ+ I     TQ A  F   K   +G   G+     ++ DG V   Y + T + + 
Sbjct: 301 ADPTQQVDIVFGTVTQYASPFEVSKLTQDGSTVGRLTKVEITPDGIVSATYSNATTIKVA 360

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
            +A+A   +   L      ++  +  SGD   G P     G I S ALE +NVD+ SEL 
Sbjct: 361 MVAMAKFANSQGLTQVGDTSWRQSLLSGDALPGTPNSGTFGTIKSSALEQSNVDLTSELV 420

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +LI AQRN+  NS+  +  S     ++ ++
Sbjct: 421 DLITAQRNFQANSRSLEVNSSLQQTILQIR 450


>gi|269796390|ref|YP_003315845.1| flagellar hook protein FlgE [Sanguibacter keddieii DSM 10542]
 gi|269098575|gb|ACZ23011.1| flagellar hook protein FlgE [Sanguibacter keddieii DSM 10542]
          Length = 394

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 94/432 (21%), Positives = 174/432 (40%), Gaps = 51/432 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ + +SG+      +    +NIANV+T G+K +   F   +               
Sbjct: 1   MLRSLFSGISGLRTHQTMLDVTGNNIANVNTTGFKASQTQFKDTLSQVLTNAGGAQGGVG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+ + V  G++++      +QG+   T  +TD+ I G GFF+V  ++  N  TR+G F 
Sbjct: 61  GTNPAQVGLGVQLAGVTTNFQQGAAQVTNRSTDMMISGDGFFVV-SKNGENFYTRSGAFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +  G L    G ++ G+   +                +V +    A  TT      NL 
Sbjct: 120 FDANGNLVTAEGALVQGWAAVDGVVDPNGALAPLRLPTSVLN---PASATTQVGFDGNLP 176

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            +A + T                      YD LG++    + +T+               
Sbjct: 177 SDAAVGT--------------VLNRDVEVYDALGNARNITLTFTQ--------------- 207

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
                        N  +++          + +   +     +     + + ++  T  A 
Sbjct: 208 -----AAGAAGAPNQWQLTTSDGGAAQPVAFNADGTLASPGTVTVDGVAVSLADVTGFAK 262

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               + +  +G   G  + F+++ DG +   + +G + P+ R+A+ T  +   L+   G+
Sbjct: 263 LTSIETASKDGQRAGSLQSFTINADGTIIGAFSNGLKSPVGRIALGTFANPVGLEKAGGS 322

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  T +SG+ +IG  G    G +  GALE +NVD++ E T LI AQR +  NS+V  T 
Sbjct: 323 LYTTTVNSGEAAIGTAGTGGRGSLVGGALEMSNVDLSQEFTNLIIAQRGFQANSRVITTS 382

Query: 410 SDFMDILISLKR 421
            + +  L++LKR
Sbjct: 383 DELLQELVNLKR 394


>gi|332284019|ref|YP_004415930.1| hypothetical protein PT7_0766 [Pusillimonas sp. T7-7]
 gi|330427972|gb|AEC19306.1| hypothetical protein PT7_0766 [Pusillimonas sp. T7-7]
          Length = 412

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 98/419 (23%), Positives = 166/419 (39%), Gaps = 12/419 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A +  +  + +NIAN  TVG+K    +F+ +   S     V  G ++++ 
Sbjct: 2   GFGQGLSGLNAAAQNLDVIGNNIANSGTVGFKAGTASFADVYASS----RVGLGTQVASI 57

Query: 66  DMISEQGSLMHTASNTDLAIQG-KGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
           +     GS+ +T +  D+AI G  G F V         TR G F  + +G+L N  G  L
Sbjct: 58  NQRFTIGSVSNTGNQFDMAIDGASGLFRVTDPSGSVLYTRNGQFSPDKDGYLVNAQGHRL 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY     +   I      +                   ++   D +AT   P  T    
Sbjct: 118 TGYEEGGTNLVPIRVPTGNIAPAATGVVTSKVNVDANAPLAGGADPSATPPVPAATF-DP 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YTH      YD+LG+S     Y+ K        +              +      
Sbjct: 177 AVPSTYTHSLPINVYDSLGNSHQMMQYFAKREGTATSSTW--DVYYRIGGQTVSAPLDGA 234

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGID---QQITIDISKTTQLAGGFIPQKSEINGH 301
            +++FD      A ++  A+                T+D + +TQ  G F       +G+
Sbjct: 235 TQMTFDQGGRLTAPTTPVAVQMTAVPGASPAEALNFTVDYADSTQFGGDFAF-SFGQDGY 293

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G+    +++ DG +   Y +G    +  L +    +   L+   GN ++ T  SG   
Sbjct: 294 PTGEYASMAIAADGSIVASYTNGETQTMGSLVLVDFANVQGLQPVGGNAWVETSTSGQPI 353

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG N    I   A+E +NVD++ EL  +I AQR Y  N++  +T    M  LIS++
Sbjct: 354 LGRPGSNGMARIKGQAVEESNVDMSQELVNMIIAQRTYQANAQTIKTQDQIMQTLISMR 412


>gi|74311638|ref|YP_310057.1| flagellar hook protein FlgE [Shigella sonnei Ss046]
 gi|157157539|ref|YP_001462310.1| flagellar hook protein FlgE [Escherichia coli E24377A]
 gi|191168462|ref|ZP_03030250.1| flagellar hook protein FlgE [Escherichia coli B7A]
 gi|193064513|ref|ZP_03045593.1| flagellar hook protein FlgE [Escherichia coli E22]
 gi|194438060|ref|ZP_03070153.1| flagellar hook protein FlgE [Escherichia coli 101-1]
 gi|209918330|ref|YP_002292414.1| flagellar hook protein FlgE [Escherichia coli SE11]
 gi|218694610|ref|YP_002402277.1| flagellar hook protein FlgE [Escherichia coli 55989]
 gi|253773900|ref|YP_003036731.1| flagellar hook protein FlgE [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254161182|ref|YP_003044290.1| flagellar hook protein FlgE [Escherichia coli B str. REL606]
 gi|256018667|ref|ZP_05432532.1| flagellar hook protein FlgE [Shigella sp. D9]
 gi|260843316|ref|YP_003221094.1| flagellar hook protein FlgE [Escherichia coli O103:H2 str. 12009]
 gi|260854559|ref|YP_003228450.1| flagellar hook protein FlgE [Escherichia coli O26:H11 str. 11368]
 gi|260867439|ref|YP_003233841.1| flagellar hook protein FlgE [Escherichia coli O111:H- str. 11128]
 gi|293433366|ref|ZP_06661794.1| flagellar hook protein FlgE [Escherichia coli B088]
 gi|300816778|ref|ZP_07096998.1| flagellar hook protein FlgE [Escherichia coli MS 107-1]
 gi|300821143|ref|ZP_07101292.1| flagellar hook protein FlgE [Escherichia coli MS 119-7]
 gi|300902467|ref|ZP_07120449.1| flagellar hook protein FlgE [Escherichia coli MS 84-1]
 gi|300922602|ref|ZP_07138702.1| flagellar hook protein FlgE [Escherichia coli MS 182-1]
 gi|300928372|ref|ZP_07143906.1| flagellar hook protein FlgE [Escherichia coli MS 187-1]
 gi|301304985|ref|ZP_07211087.1| flagellar hook protein FlgE [Escherichia coli MS 124-1]
 gi|301328554|ref|ZP_07221615.1| flagellar hook protein FlgE [Escherichia coli MS 78-1]
 gi|309798070|ref|ZP_07692445.1| flagellar hook protein FlgE [Escherichia coli MS 145-7]
 gi|331667476|ref|ZP_08368340.1| flagellar hook protein FlgE [Escherichia coli TA271]
 gi|331676867|ref|ZP_08377563.1| flagellar hook protein FlgE [Escherichia coli H591]
 gi|332279736|ref|ZP_08392149.1| flagellar hook protein FlgE [Shigella sp. D9]
 gi|73855115|gb|AAZ87822.1| flagellar hook protein [Shigella sonnei Ss046]
 gi|157079569|gb|ABV19277.1| flagellar hook protein FlgE [Escherichia coli E24377A]
 gi|190901481|gb|EDV61242.1| flagellar hook protein FlgE [Escherichia coli B7A]
 gi|192927765|gb|EDV82379.1| flagellar hook protein FlgE [Escherichia coli E22]
 gi|194422996|gb|EDX38990.1| flagellar hook protein FlgE [Escherichia coli 101-1]
 gi|209911589|dbj|BAG76663.1| flagellar hook protein FlgE [Escherichia coli SE11]
 gi|218351342|emb|CAU97048.1| flagellar hook protein [Escherichia coli 55989]
 gi|253324944|gb|ACT29546.1| flagellar basal body FlaE domain protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973083|gb|ACT38754.1| flagellar hook protein E [Escherichia coli B str. REL606]
 gi|253977297|gb|ACT42967.1| flagellar hook protein E [Escherichia coli BL21(DE3)]
 gi|257753208|dbj|BAI24710.1| flagellar hook protein FlgE [Escherichia coli O26:H11 str. 11368]
 gi|257758463|dbj|BAI29960.1| flagellar hook protein FlgE [Escherichia coli O103:H2 str. 12009]
 gi|257763795|dbj|BAI35290.1| flagellar hook protein FlgE [Escherichia coli O111:H- str. 11128]
 gi|291324185|gb|EFE63607.1| flagellar hook protein FlgE [Escherichia coli B088]
 gi|300405499|gb|EFJ89037.1| flagellar hook protein FlgE [Escherichia coli MS 84-1]
 gi|300421079|gb|EFK04390.1| flagellar hook protein FlgE [Escherichia coli MS 182-1]
 gi|300463630|gb|EFK27123.1| flagellar hook protein FlgE [Escherichia coli MS 187-1]
 gi|300526442|gb|EFK47511.1| flagellar hook protein FlgE [Escherichia coli MS 119-7]
 gi|300530552|gb|EFK51614.1| flagellar hook protein FlgE [Escherichia coli MS 107-1]
 gi|300839703|gb|EFK67463.1| flagellar hook protein FlgE [Escherichia coli MS 124-1]
 gi|300844946|gb|EFK72706.1| flagellar hook protein FlgE [Escherichia coli MS 78-1]
 gi|308118353|gb|EFO55615.1| flagellar hook protein FlgE [Escherichia coli MS 145-7]
 gi|313848602|emb|CAQ31597.2| flagellar hook protein FlgE, subunit of Flagellum [Escherichia coli
           BL21(DE3)]
 gi|315253877|gb|EFU33845.1| flagellar hook protein FlgE [Escherichia coli MS 85-1]
 gi|323156883|gb|EFZ43017.1| flagellar hook protein flgE [Escherichia coli EPECa14]
 gi|323163758|gb|EFZ49577.1| flagellar hook protein flgE [Escherichia coli E128010]
 gi|323165584|gb|EFZ51371.1| flagellar hook protein flgE [Shigella sonnei 53G]
 gi|323175693|gb|EFZ61287.1| flagellar hook protein flgE [Escherichia coli 1180]
 gi|323185801|gb|EFZ71162.1| flagellar hook protein flgE [Escherichia coli 1357]
 gi|323947622|gb|EGB43626.1| fagellar hook-basal body protein [Escherichia coli H120]
 gi|323962675|gb|EGB58253.1| fagellar hook-basal body protein [Escherichia coli H489]
 gi|323973335|gb|EGB68524.1| fagellar hook-basal body protein [Escherichia coli TA007]
 gi|324017420|gb|EGB86639.1| flagellar hook protein FlgE [Escherichia coli MS 117-3]
 gi|324117353|gb|EGC11260.1| fagellar hook-basal body protein [Escherichia coli E1167]
 gi|331065061|gb|EGI36956.1| flagellar hook protein FlgE [Escherichia coli TA271]
 gi|331075556|gb|EGI46854.1| flagellar hook protein FlgE [Escherichia coli H591]
 gi|332102088|gb|EGJ05434.1| flagellar hook protein FlgE [Shigella sp. D9]
          Length = 401

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/415 (23%), Positives = 179/415 (43%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|297538896|ref|YP_003674665.1| fagellar hook-basal body protein [Methylotenera sp. 301]
 gi|297258243|gb|ADI30088.1| fagellar hook-basal body protein [Methylotenera sp. 301]
          Length = 422

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 94/428 (21%), Positives = 175/428 (40%), Gaps = 20/428 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S +  +SG++A S ++  + +N+AN +TVG+K++   F+ +   S      + +  G  +
Sbjct: 2   SFQQGLSGLNAASKQLEVIGNNVANANTVGFKQSRAEFADVFANSLTGGGGTQIGIGTNL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           ST      QG++  T ++ D+AI G GFF     +     +R G F ++ +G++ + A  
Sbjct: 62  STVAQQFTQGNVTSTNNSLDIAINGGGFFR-MTNNGAVTYSRNGQFKMDKDGYIVDSASK 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY            + Q    +++K       P  T  I   ++ ++   TP  TP 
Sbjct: 121 HLTGYAAD------TTGAIQKGAPVDLKINTADLQPKATAKIVGLVNLDSRKATPAVTPF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF------- 235
                  YT  ++   +D+LG+S     Y+ K             D  +  +        
Sbjct: 175 SPTDPTTYTDSTAVTVFDSLGNSHTLQTYFVKDPAPNVWKVFTTADGISTTTLPTPTTTL 234

Query: 236 ---PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
                      T           L      A +    T      +TID S +TQ    + 
Sbjct: 235 TFPATGTGLGPTPATPTAVTFAPLNPPIPPATTPTIPTGAAPVTLTIDYSASTQFGSNYS 294

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G+  G+   F+   DG +   Y +G    + ++ +++  + + L+   GN + 
Sbjct: 295 INSLTQDGYTSGRLAGFNTGADGIITGRYSNGQSRALGQVVLSSFANPNGLQSLGGNAWS 354

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            +  SG    G P     G + S A+E +N D+ +EL  +I AQR Y  N++  +T    
Sbjct: 355 ESSTSGTPLTGVPNTGTLGVLQSSAVEDSNTDLTAELVNMITAQRYYQANAQTIKTQDQV 414

Query: 413 MDILISLK 420
           +  L++L+
Sbjct: 415 LQTLVNLR 422


>gi|324007916|gb|EGB77135.1| flagellar hook protein FlgE [Escherichia coli MS 57-2]
          Length = 401

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNHWDVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|95928662|ref|ZP_01311409.1| protein of unknown function DUF1078-like [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135452|gb|EAT17104.1| protein of unknown function DUF1078-like [Desulfuromonas
           acetoxidans DSM 684]
          Length = 425

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 111/431 (25%), Positives = 192/431 (44%), Gaps = 16/431 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-----Y 55
           MG+  ++ + +SG+   +  +S   +NI+N +T+GYK ++  FS ++  + S +      
Sbjct: 1   MGLTSTLYSGISGLQTNAEAMSVTGNNISNSNTIGYKSSSTVFSDMLSATISTTGTSVNQ 60

Query: 56  VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFHINNEG 114
           V  G E++T      QGS   T+S+TDLA++G GFF++     +    TR G FH +  G
Sbjct: 61  VGRGSELTTVRSNFSQGSFQSTSSDTDLAVEGAGFFMLSAAGTDEVVYTRNGAFHFDPGG 120

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
           +L N  G  + G        P        ++      +++ A+ T+   ++ NL+     
Sbjct: 121 YLVNADGYRVQGQLFDADGTPG---GGDPVDIKVDLTSQVPALQTSNIVLTTNLNSGTEE 177

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
           I                + +S   YD LG + +   Y+TKTGD+ WE +        + S
Sbjct: 178 IPGGFDLSDPS--ESSNYSTSTPIYDALGETHLATTYFTKTGDQTWEWNTVVDSADLDPS 235

Query: 235 FPYN--VAPLNTVEVSFDPVTGYLANSSHKAISFN--DNTSGIDQQITIDISKTTQLAGG 290
              +     + T  ++FD     +  S            +     Q       TTQ    
Sbjct: 236 VASSEESTVIGTGTLTFDDDGQLIGTSGFDLDETTLMWASGADPTQSIAIEFDTTQFGRT 295

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
                 + +G+A G+  + S++ DG V + Y +G    I  L +AT  +   L     + 
Sbjct: 296 STVYSQDQDGYAAGEVVETSINSDGVVSVSYSNGETRDIATLTLATFTNPGGLVKEGNSL 355

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y  +R SG+  IG PG    G I++ +LE +NVD++ E  ++I  Q  Y+ NSKV  T  
Sbjct: 356 YSASRYSGNPQIGTPG-ASQGIIYTNSLELSNVDLSQEFVDMITIQNGYSANSKVITTTD 414

Query: 411 DFMDILISLKR 421
           + +  +I+L R
Sbjct: 415 EMLQEVINLIR 425


>gi|323190588|gb|EFZ75860.1| flagellar hook protein flgE [Escherichia coli RN587/1]
          Length = 401

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDIIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNHWDVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTKDITTAAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|15801193|ref|NP_287210.1| flagellar hook protein FlgE [Escherichia coli O157:H7 EDL933]
 gi|15830708|ref|NP_309481.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. Sakai]
 gi|168747148|ref|ZP_02772170.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4113]
 gi|168758631|ref|ZP_02783638.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4401]
 gi|168767735|ref|ZP_02792742.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4486]
 gi|168773921|ref|ZP_02798928.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4196]
 gi|168783606|ref|ZP_02808613.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4076]
 gi|168790011|ref|ZP_02815018.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC869]
 gi|168802021|ref|ZP_02827028.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC508]
 gi|195935466|ref|ZP_03080848.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4024]
 gi|208809224|ref|ZP_03251561.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4206]
 gi|208814886|ref|ZP_03256065.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4045]
 gi|208822570|ref|ZP_03262889.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4042]
 gi|209395987|ref|YP_002269922.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4115]
 gi|254792458|ref|YP_003077295.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. TW14359]
 gi|261227019|ref|ZP_05941300.1| flagellar hook protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256253|ref|ZP_05948786.1| flagellar hook protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291282096|ref|YP_003498914.1| Flagellar hook protein FlgE [Escherichia coli O55:H7 str. CB9615]
 gi|12514614|gb|AAG55822.1|AE005317_11 flagellar biosynthesis, hook protein [Escherichia coli O157:H7 str.
           EDL933]
 gi|13360918|dbj|BAB34877.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. Sakai]
 gi|187770405|gb|EDU34249.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4196]
 gi|188018069|gb|EDU56191.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4113]
 gi|188999079|gb|EDU68065.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4076]
 gi|189354568|gb|EDU72987.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4401]
 gi|189363151|gb|EDU81570.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4486]
 gi|189370482|gb|EDU88898.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC869]
 gi|189375951|gb|EDU94367.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC508]
 gi|208729025|gb|EDZ78626.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4206]
 gi|208731534|gb|EDZ80222.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4045]
 gi|208738055|gb|EDZ85738.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4042]
 gi|209157387|gb|ACI34820.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4115]
 gi|209773378|gb|ACI85001.1| flagellar hook protein FlgE [Escherichia coli]
 gi|209773382|gb|ACI85003.1| flagellar hook protein FlgE [Escherichia coli]
 gi|209773384|gb|ACI85004.1| flagellar hook protein FlgE [Escherichia coli]
 gi|209773386|gb|ACI85005.1| flagellar hook protein FlgE [Escherichia coli]
 gi|254591858|gb|ACT71219.1| flagellar hook protein [Escherichia coli O157:H7 str. TW14359]
 gi|290761969|gb|ADD55930.1| Flagellar hook protein FlgE [Escherichia coli O55:H7 str. CB9615]
 gi|320189759|gb|EFW64415.1| Flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC1212]
 gi|320637527|gb|EFX07327.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. G5101]
 gi|320643088|gb|EFX12289.1| flagellar hook protein FlgE [Escherichia coli O157:H- str. 493-89]
 gi|320648546|gb|EFX17201.1| flagellar hook protein FlgE [Escherichia coli O157:H- str. H 2687]
 gi|320653860|gb|EFX21934.1| flagellar hook protein FlgE [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320659340|gb|EFX26909.1| flagellar hook protein FlgE [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320664475|gb|EFX31626.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. LSU-61]
 gi|326339298|gb|EGD63112.1| Flagellar hook protein FlgE [Escherichia coli O157:H7 str. 1125]
 gi|326344741|gb|EGD68489.1| Flagellar hook protein FlgE [Escherichia coli O157:H7 str. 1044]
          Length = 401

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|145298491|ref|YP_001141332.1| flagellar hook protein FlgE [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851263|gb|ABO89584.1| flagellar hook protein FlgE [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 446

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 107/446 (23%), Positives = 173/446 (38%), Gaps = 32/446 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+T+G+K +   F+ +   S    + + V  G+  
Sbjct: 2   SFNNALSGVNAAQKDLNVTANNIANVNTMGFKESRAEFADVYANSIFVNAKTQVGNGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
                   QG+L  T +  DLAIQG GFF+      +     TRAG F +N   ++ N  
Sbjct: 62  GAVAHQFHQGALQFTNNALDLAIQGNGFFVTSDGLTNLDRTYTRAGAFKLNENSYMVNNQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +     P  V+     + I V         T     S NL   +     D  
Sbjct: 122 GHYLQGYEINTDGTPKAVSINAT-KPIQVPDRAGEPKMTELVEASFNLSIESKTKPTDPA 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY----------TKTGDKKWEVSIF--RQD 228
                  A + H +S   YD+LG+  V   Y+          T      W + ++   + 
Sbjct: 181 AFDPTNSATFAHSTSVTIYDSLGAPHVITKYFVRHEDPVTPGTPMTPGTWSMYMYEGDKP 240

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFN--------------DNTSGID 274
               +  P     + T         G L  +                      +N +   
Sbjct: 241 IDIASGAPSPGPGIPTGVQMTFTSGGKLDPALTIPAPPAPIKTVTLGTAAGIINNGADPT 300

Query: 275 QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
           Q + I +S  TQ    F   K   +G   G      ++ DG V   Y + T + +  +A+
Sbjct: 301 QAVEIRLSDVTQYNSPFNVTKLTQDGATVGNLTKVEITPDGIVSATYSNATTLKVAMVAL 360

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A   +   L      ++  +  SGD   G P     G I S A+E +NVD+ S+L  LI 
Sbjct: 361 AKFANSQGLTQVGDTSWRQSLLSGDALPGTPNSGTLGSIKSSAVEQSNVDLTSQLVNLIT 420

Query: 395 AQRNYAVNSKVFQTGSDFMDILISLK 420
           AQRN+  NS+  +  S     ++ ++
Sbjct: 421 AQRNFQANSRSLEVNSSLQQTILQIR 446


>gi|115523193|ref|YP_780104.1| flagellar hook protein FlgE [Rhodopseudomonas palustris BisA53]
 gi|115517140|gb|ABJ05124.1| flagellar basal body FlaE domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 411

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 174/421 (41%), Positives = 236/421 (56%), Gaps = 10/421 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T  SGM+AQSN++S V+DNIANV+T GYKR +  FSSL+  S S SY SG +
Sbjct: 1   MSLYGVMRTGGSGMNAQSNKLSTVADNIANVNTTGYKRASTEFSSLILKSGSGSYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E   +  IS+ G+  +T S TDLAIQG GFF V        LTRAG F  + EG L N  
Sbjct: 61  ETQVRYAISDPGTTQYTTSATDLAIQGNGFFAVADARGTPFLTRAGSFVPDGEGNLVNAG 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLGY LKN    ++ N   GLE++N+    L   P+T G  S NLD NA I      
Sbjct: 121 GYYLLGYNLKNGPPNVVANGLTGLEKVNIGQTALEGNPSTKGTASANLDSNAAI------ 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    YT K+S   YD +G+ V  D+Y  KT    W + ++    ST   FPY+  
Sbjct: 175 ---TAGPPAYTSKTSLVTYDNIGNKVTLDIYAYKTAANTWNMEVYDNATSTAGGFPYSSP 231

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            L T   +FD            + +    T       T+D+S  TQ+A  F  +   ++G
Sbjct: 232 ALATDTFTFDVSATGKGRLDAASPTSLALTIPGGSAFTLDLSTMTQVAAEFQFKA-TVDG 290

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           ++P   +   V  DG +  IY+DGTR+  YR+ +ATVPS D L    GN Y    DSG++
Sbjct: 291 NSPSAIEKVEVDGDGTMYAIYNDGTRLATYRIPLATVPSPDKLVPEVGNVYSVGIDSGNV 350

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            + F G++  G + + ALE +NVD+ASELT +IE+QR Y  NSKVFQTG+D +D+L++LK
Sbjct: 351 QVDFAGNSGLGTVKAKALEQSNVDLASELTAMIESQRGYTANSKVFQTGADLLDVLVNLK 410

Query: 421 R 421
           R
Sbjct: 411 R 411


>gi|26247216|ref|NP_753256.1| flagellar hook protein FlgE [Escherichia coli CFT073]
 gi|227886566|ref|ZP_04004371.1| flagellar hook protein FlgE [Escherichia coli 83972]
 gi|300974380|ref|ZP_07172592.1| flagellar hook protein FlgE [Escherichia coli MS 45-1]
 gi|26107617|gb|AAN79816.1|AE016759_90 Flagellar hook protein flgE [Escherichia coli CFT073]
 gi|227836770|gb|EEJ47236.1| flagellar hook protein FlgE [Escherichia coli 83972]
 gi|300410623|gb|EFJ94161.1| flagellar hook protein FlgE [Escherichia coli MS 45-1]
 gi|307553078|gb|ADN45853.1| flagellar hook protein FlgE [Escherichia coli ABU 83972]
 gi|315291070|gb|EFU50433.1| flagellar hook protein FlgE [Escherichia coli MS 153-1]
          Length = 401

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD KW+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNKWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|88704306|ref|ZP_01102020.1| Flagellar hook protein FlgE [Congregibacter litoralis KT71]
 gi|88701357|gb|EAQ98462.1| Flagellar hook protein FlgE [Congregibacter litoralis KT71]
          Length = 429

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/429 (22%), Positives = 185/429 (43%), Gaps = 15/429 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           +  TA+SG++A +  +  VS+NIAN  T G+K +   F+ +   S     ++ +  G+ +
Sbjct: 2   AFSTAISGINAATADLGVVSNNIANASTTGFKASRAEFADVYATSLLGAGSNAIGKGVSL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++  T ++ DLAI G GFF +   +     TRAG+F ++ EGFL +    
Sbjct: 62  AGVTQEFGQGNITFTNNSLDLAINGNGFFQL-SVEGAVEYTRAGNFQVDREGFLVSNQNA 120

Query: 123 VLLGYPLKNASAPL-----IVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITP 177
            L G+ +            I      ++     +  L++   +    +            
Sbjct: 121 RLQGFQVDGGGDVTGQLGDIQIDTSLIDPNPTSNVSLTSNLDSREVTTGTGFATNGPYDA 180

Query: 178 DKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
              P      A++   +S   +D+LG+  V  +YY KT +          D  + +    
Sbjct: 181 FAVPPTAPSPADFNATTSTTIFDSLGNPHVLSLYYVKTANPNEFEVYSLIDGQSQDPGTG 240

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDN------TSGIDQQITIDISKTTQLAGGF 291
            V    T++ + +      +++     ++              Q   +D+ +TTQ    F
Sbjct: 241 TVGDPVTLQFTSNGQFDPASDTQIDVTAWTPVDSTGAVNGAAAQTFVVDLQQTTQFGTAF 300

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G A G+ +   + + G     Y +G    + ++A+A+  +++ L+      +
Sbjct: 301 AVSSVIQDGFAAGQLRGLEIDESGIAFARYTNGESRALGQIALASFNNQNGLQPVGDTNW 360

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T  SG  ++G PG +  G + S ALE +NV+I  EL +LI AQRN+  N++V Q    
Sbjct: 361 VETFSSGSPNVGEPGTSGLGAVQSAALEDSNVEITQELVDLIVAQRNFQANAQVIQAEDA 420

Query: 412 FMDILISLK 420
               +I+L+
Sbjct: 421 ITQTVINLR 429


>gi|209773380|gb|ACI85002.1| flagellar hook protein FlgE [Escherichia coli]
          Length = 401

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           + P        +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPAGTAEPA-------M 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|297517866|ref|ZP_06936252.1| flagellar hook protein FlgE [Escherichia coli OP50]
          Length = 401

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++   TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMATKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|237817502|ref|ZP_04596493.1| flagellar hook protein FlgE [Brucella abortus str. 2308 A]
 gi|237787337|gb|EEP61554.1| flagellar hook protein FlgE [Brucella abortus str. 2308 A]
          Length = 456

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 61  MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 120

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 121 LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 180

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 181 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 236

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 237 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 278

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 279 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 335

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 336 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 395

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 396 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 455

Query: 421 R 421
           R
Sbjct: 456 R 456


>gi|332298237|ref|YP_004440159.1| flagellar hook-basal body protein [Treponema brennaborense DSM
           12168]
 gi|332181340|gb|AEE17028.1| flagellar hook-basal body protein [Treponema brennaborense DSM
           12168]
          Length = 463

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 106/467 (22%), Positives = 201/467 (43%), Gaps = 52/467 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + +SGM     R+  + +N+ANV+T G+KR  + F  ++    S +        
Sbjct: 1   MMRSLYSGVSGMQNHQTRLDVIGNNVANVNTTGFKRGRVNFQDMISQQLSGAAKPTTEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D +  QG+L  T   TD+AIQG GFF++K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGVMVASIDTVFTQGNLQSTGVATDVAIQGNGFFVLKNGE-ETFYTRAGAFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           ++++G L N   G  + G+  + A+  +I+N+    E + +       A  T     + N
Sbjct: 120 LDSDGTLVNPANGLRVQGWMAQEANGEMILNTAGSPEDLIIPVGSKDPAKATQNVNFACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSV--VYDVYYTKTGDKKWEVSIF 225
           L+KN   I    +        + T  +    YD+ G+                +W+ ++ 
Sbjct: 180 LNKNTPEILEGASE---SDIMKGTWSTEQKVYDSFGNEHMLSVAFARVPGNPNQWQATVL 236

Query: 226 RQDQSTNNSFP----YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
               + + +           +    +     TG L + +  A +  + T  I  Q +  +
Sbjct: 237 IDPDNADVTQTRVGLGTTDGVANTFLVNFDNTGSLQSVTDSAGNVTNPTGQIVLQTSFTV 296

Query: 282 SKT---------------------------TQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
           + +                           TQ A     +    +G+  G   +F +   
Sbjct: 297 TDSNPDADGNPYRQTMNINLGTIGSQQHTITQSASQSSTKAYYQDGYTMGYLDNFKIDSS 356

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +  +Y +GT   + ++A+AT  ++  L+    NTY+ + +SG  +IG  G    G + 
Sbjct: 357 GIITGVYSNGTNRVLGQIALATFSNQGGLEKAGDNTYVQSNNSGLANIGTSGIAGKGSML 416

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +G+LE +NVD+  + T++I  QR +  +SK  QT    +D +++LKR
Sbjct: 417 AGSLEMSNVDLTEQFTDMIVTQRGFQASSKTIQTADTLLDTVMNLKR 463


>gi|188997539|ref|YP_001931790.1| protein of unknown function DUF1078 domain protein
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932606|gb|ACD67236.1| protein of unknown function DUF1078 domain protein
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 413

 Score =  248 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 119/427 (27%), Positives = 183/427 (42%), Gaps = 22/427 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--------PSTSNS 54
           +L S  TA++G++     ++ +SDNIANV+T+G+K   + F  LV          +  N+
Sbjct: 1   MLQSFYTAITGLNGNQQWLNVISDNIANVNTIGFKSERVTFEDLVAHSLTTFANNTPKNT 60

Query: 55  YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEG 114
            + GG  ++       QGS M+T S TDLA+ G+GFF+VK        TRAG F ++  G
Sbjct: 61  EIGGGSFVALTTKDFSQGSFMNTNSPTDLALDGEGFFMVKDNQGTVYYTRAGQFRLDANG 120

Query: 115 FLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATI 174
            L NV G  L G+ L N            +                      NLD  + +
Sbjct: 121 DLVNVDGMKLQGWTLDNNGNIAGALDKINVPYAINPTITT----KINLVEPTNLDSRSNV 176

Query: 175 ITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNS 234
                          + + +S   YD+LG+      Y+ K      E S     +     
Sbjct: 177 ---ISATFDPTNSTTFNYVNSMTIYDSLGNPHTLSFYFQK----TNESSTGSTWKVYAYK 229

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
                  + +  ++FD      + S         N +   Q I++D+SK  Q+A  FI  
Sbjct: 230 DNDLTTQVGSSTLNFDTNGNLTSGSPFTLSLTLSNGATSPQVISVDVSKIKQVASDFIFY 289

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G A G     +V++DG V  +Y +G    I RLA+AT   ++ L     N YLP 
Sbjct: 290 A-NQDGFAKGDLLGVAVTEDGIVKGMYSNGNVKNIARLAVATFKDKEMLVRKGNNLYLPN 348

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             +    I  PG     ++ SG LE +NVDI+ E   LI AQR Y  N++V  T    + 
Sbjct: 349 TQTFTPII-TPG-GILSKVRSGFLELSNVDISREFINLITAQRAYQANARVITTDDQILQ 406

Query: 415 ILISLKR 421
             +++KR
Sbjct: 407 EAMNIKR 413


>gi|283833630|ref|ZP_06353371.1| flagellar hook protein FlgE [Citrobacter youngae ATCC 29220]
 gi|291071313|gb|EFE09422.1| flagellar hook protein FlgE [Citrobacter youngae ATCC 29220]
          Length = 411

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 96/418 (22%), Positives = 178/418 (42%), Gaps = 11/418 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K  A +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGAASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    + N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRMVDSNGSVFYSRNGQFKLDENRNIVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 118 GYPA--TGTPPTVQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDKV--PAKTPFDPS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   +D+ G++   +++Y K           +   + + +        N  
Sbjct: 174 DADTYNKKGTVTVFDSQGNAHDMNIFYVKNAQSNTWEVHTQDASTGDPAQSAGFMRFNEN 233

Query: 246 EVSFD---PVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
            V        TG  A +  +  +   N +         ++   Q  G      +  NG+ 
Sbjct: 234 GVFLGISATATGAPAGTDIQITTGQINGADAADFSLSFLNSMQQNTGANNIVATNQNGYK 293

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
           PG    + ++ DG V   Y +  +  + ++ +A   + + L     N +  T+ SG   +
Sbjct: 294 PGDLVSYQINNDGTVVGNYSNEQKQVLGQIVLANFANNEGLASQGDNVWAATQSSGVALL 353

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G  G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 354 GTAGEGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 411


>gi|146307869|ref|YP_001188334.1| flagellar hook protein FlgE [Pseudomonas mendocina ymp]
 gi|145576070|gb|ABP85602.1| flagellar basal body FlaE domain protein [Pseudomonas mendocina
           ymp]
          Length = 438

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 101/444 (22%), Positives = 181/444 (40%), Gaps = 36/444 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A +  ++   +NIAN  T G+K++   F+ +   S   T ++    G+ +
Sbjct: 2   SFNIGLSGLRAATKDLNVTGNNIANAGTAGFKQSRAEFADVYAASVLGTGSNPQGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
                +  QG++ +T +  DLAI G GFF+    +     TRAG F  + EGF+ N  G 
Sbjct: 62  GDISQLFNQGNINYTQNALDLAINGNGFFVT-SNNGEISYTRAGYFGTDREGFMVNNFGY 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY +                    +    +  P  T  ++   + N+  + P   P 
Sbjct: 121 RLQGYTVDANGNLQNGVVSDL------RIQTANQEPRATANLAQTFNLNSNNVVPTTVPF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN--------- 233
                  Y   +S   YDT G+S V+  Y+ KTG   W +++    ++ ++         
Sbjct: 175 DPTDPTSYNSSTSTNIYDTQGNSHVFTQYFVKTGPNTWTMNVLIDGRNPDDPTLTTPSSV 234

Query: 234 -----------------SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ 276
                            S P          +S         ++S   +   +  +     
Sbjct: 235 DLQFTTAGQLDIPALVGSTPTGFTVAADGTISLSTWVPAAPDNSVPPVWSPNGAAANAAG 294

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           ITID+ ++TQ A  F   +   +G+  G+     +   G +   Y +G      ++ +A 
Sbjct: 295 ITIDVRQSTQFASSFAVNRVSQDGYTTGQLAGLEIDDTGVIFARYTNGQSKVQGQVVLAN 354

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
             +   L       ++ +  SG+  +G P     G + +GALE +NV+++ +L  LI AQ
Sbjct: 355 FANVQGLTPVGKTAWVQSFQSGEPVVGTPRAGTLGALQAGALEDSNVELSDQLVNLIVAQ 414

Query: 397 RNYAVNSKVFQTGSDFMDILISLK 420
           RNY  N+K  +T S     +I+L+
Sbjct: 415 RNYQANAKTIETESAITQTIINLR 438


>gi|261821153|ref|YP_003259259.1| flagellar hook protein FlgE [Pectobacterium wasabiae WPP163]
 gi|261605166|gb|ACX87652.1| fagellar hook-basal body protein [Pectobacterium wasabiae WPP163]
          Length = 405

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 186/415 (44%), Gaps = 11/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A SN +  + +NIAN  TVG+K  A+ F+ +       S V  G+++++ 
Sbjct: 2   GFSQAVSGLNAASNNLDVIGNNIANSATVGFKSGAVTFADMFA----GSKVGMGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L 
Sbjct: 58  LQDFGNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNG-RNIVNAQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+     P +V +      + V   ++ +  TT   +  NL  +  + T        G
Sbjct: 117 GYPV--TGTPPVVQTGADPVPLTVPDGDMLSRATTAATLKANLKSSDAVPTGSWA-TTPG 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y  K++   YD+ G+   + +Y+ KT +  W+        +               
Sbjct: 174 AEGTYNSKTNLTTYDSQGNKHDFTLYFVKTANNTWQTYARDGSITPAVYQSAGTLNFEA- 232

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             +    +      +   I+        +   TID++ + Q    +  +    NG+APG 
Sbjct: 233 --NGALSSTGATAHTPFTINLTGTNGAANGTFTIDLTGSVQQNTEYSYKSPIQNGYAPGA 290

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              F+++ DG ++  Y +G + P+ ++ +A+  + + L     N +  T  SG   +G  
Sbjct: 291 LTGFAINDDGTIEGNYSNGQKQPLGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLA 350

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 351 GTGSLGKLIGKSTESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 405


>gi|227112521|ref|ZP_03826177.1| flagellar hook protein FlgE [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 400

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 99/415 (23%), Positives = 186/415 (44%), Gaps = 16/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A SN +  + +NIAN  TVG+K   + F+ +       S V  G+++++ 
Sbjct: 2   GFSQAVSGLNAASNNLDVIGNNIANSATVGFKSGTVTFADMFA----GSKVGMGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L 
Sbjct: 58  LQDFGNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNG-RNIVNAQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P +V +      + V   ++ A  TTT  I  NL  +  +        + G
Sbjct: 117 GYPV--AGTPPVVQTGADPVPLTVPDGDMLASQTTTASIVANLKSSDAVPATAWA-TNPG 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y  K++   YD+ G+   + +Y+ KT +  W+        S               
Sbjct: 174 AEGTYNSKTALTTYDSQGNVHNFTLYFVKTANNTWQTYAKDDSVSPATYQNAGTLN---- 229

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
                   G L   +   I+        +   T++++ + Q    +  +    NG APG 
Sbjct: 230 ----FAANGALTGHTPFNINLTGTNGAANGVFTLNLTGSVQQNTEYSYKSPTQNGFAPGS 285

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              F+++ DG ++  Y +G + P+ ++ +A+  + + L     N +  T  SG   +G  
Sbjct: 286 LTGFAINDDGTIEGSYSNGQKQPLGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLA 345

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 346 GTGSLGKLIGKSTESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 400


>gi|209547946|ref|YP_002279863.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533702|gb|ACI53637.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 433

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 183/434 (42%), Positives = 238/434 (54%), Gaps = 14/434 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QSSVRQAVSDQGDISYTTSGTDLAISGDGFFIVQGADGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I     T
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVSQDGLTAIASTSGVFKGNLDSNAKIPVAPAT 180

Query: 181 PKHN--GRDAEYTHKSSFAAYDTLGSSVVYDVYYTK-----------TGDKKWEVSIFRQ 227
                 G     T K S  AYD LG+ V+YD Y+TK                       +
Sbjct: 181 APSANLGTTTTDTKKVSMVAYDRLGNKVMYDFYFTKASVAAAPPPAPPATAATWEVAMFR 240

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
           + +       +        V    +T         + + N       Q I +D S  TQL
Sbjct: 241 NANAAVGGTTSFPYTAGGAVGNGTLTFDSNGKMTSSGAVNITDGVTGQTIAMDFSGLTQL 300

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F       NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D L L  
Sbjct: 301 GADFSGTG-TPNGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLMS 359

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  NSKVFQ
Sbjct: 360 GNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTANSKVFQ 419

Query: 408 TGSDFMDILISLKR 421
           TGSD MD+L++LKR
Sbjct: 420 TGSDIMDVLVNLKR 433


>gi|193069470|ref|ZP_03050424.1| flagellar hook protein FlgE [Escherichia coli E110019]
 gi|192957218|gb|EDV87667.1| flagellar hook protein FlgE [Escherichia coli E110019]
 gi|323174795|gb|EFZ60410.1| flagellar hook protein flgE [Escherichia coli LT-68]
          Length = 401

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 99/415 (23%), Positives = 179/415 (43%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKTGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|119477953|ref|ZP_01618053.1| flagellar hook protein [marine gamma proteobacterium HTCC2143]
 gi|119448866|gb|EAW30108.1| flagellar hook protein [marine gamma proteobacterium HTCC2143]
          Length = 429

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 109/434 (25%), Positives = 189/434 (43%), Gaps = 25/434 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS--TSNSYVSGGLEIS 63
           S  TA+SG+ A +  +    +NIAN  T+G+KR+   F  +   S  + ++    G+ ++
Sbjct: 2   SFNTALSGLRAANTDLEVSGNNIANASTIGFKRSRAEFGDVYANSLVSGSNTTGSGVLVN 61

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
           +     +QG++  T ++ DLAI G GFF+V         TRAG F I++EG++ N +G  
Sbjct: 62  SISQQFDQGNISFTDNSLDLAINGTGFFVVAESSGATAYTRAGYFGIDDEGYITNNSGST 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L G+                   + V+  +L+   T+   +  NLD       P  +P +
Sbjct: 122 LQGFL----PTGTGSGVGGTPADLRVQSGDLAPSATSAVDLLFNLDARGDA--PSISPFN 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTN-----NSFPY 237
                 +   +S   +D+ G + V+  +Y KT  +  W +  +  D + N     +    
Sbjct: 176 PNDADTFNSSTSLTIFDSRGQAQVFSTFYEKTAVENVWNMHAYISDDAGNLQNVISPAGG 235

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQ-----------ITIDISKTTQ 286
                   +++F         +       N N  G +Q             TI+I  +TQ
Sbjct: 236 AGGANPFFQLTFGTDGLLTGTNPTGLTIDNWNPQGSNQSSTNGSTAIASDFTINIGPSTQ 295

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
               F     + NG A GK     ++  G V   Y +G  + + ++A+A   +E  L   
Sbjct: 296 FGSDFSVAAVDQNGFATGKLTGLEINTTGEVFARYTNGEALILGQVAMALFSNEQGLNPL 355

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
               +  + +SG+  +G P     G I SGALE +NVD++ EL  LI AQRN+  N+K  
Sbjct: 356 GETGWAQSFESGEPVVGAPLTGNLGGIQSGALEESNVDLSEELVRLIIAQRNFQANAKTI 415

Query: 407 QTGSDFMDILISLK 420
           +T       +I+++
Sbjct: 416 ETADTVTQAIINIR 429


>gi|281178185|dbj|BAI54515.1| flagellar hook protein FlgE [Escherichia coli SE15]
          Length = 401

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWDVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|2494530|sp|Q56326|FLGE_TREPH RecName: Full=Flagellar hook protein flgE
 gi|439981|gb|AAA73467.1| flagellar hook polypeptide [Treponema phagedenis]
          Length = 463

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 103/466 (22%), Positives = 193/466 (41%), Gaps = 50/466 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY------- 55
           ++ S+ + +SGM     R+  + +N+ANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGASRPNEEVG 60

Query: 56  ------VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D +  QG+L  T  NTD+AIQG GFFI+K  +     T AG F 
Sbjct: 61  GVNPKEVGLGVMVASIDTVHTQGALQTTGINTDIAIQGNGFFILKDGEKS-FYTTAGAFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           ++ +G L N   G  + G+  ++     I+N+    E + +   +      TT       
Sbjct: 120 VDRDGTLVNPANGMRVQGWMAEDIEGQQIINTSDQTEDLIIPIGQKIDAKATTDVAYACN 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
                   P+    +       T  + F  YDT G      + +++      +       
Sbjct: 180 LDKRLPELPEGA--NQADILRSTWATDFNVYDTFGEQHKLQMVFSRVPGTNNQWLATVNV 237

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLAN------------------------SSHKAI 264
              N +       + T + + +       N                        +S+  +
Sbjct: 238 DPENQAGTETRVGIGTTDGTENTFIVSFDNYGHLASVTDTAGNVTAPAGQVLVQASYNVV 297

Query: 265 SFNDNTSGIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDG 315
             N +  G   + T +I+           TQ A     +  + +G+A G  ++F + + G
Sbjct: 298 GANPDEGGAPTRHTFNINLGEIGTSRNTITQFAERSTTKAYQQDGYAMGYLENFKIDQSG 357

Query: 316 YVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFS 375
            +  +Y +G    I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++ +
Sbjct: 358 IITGVYSNGASREIGQLALAGFANQGGLEKAGENTYIQSNNSGIANITVSGVMGKGKLIA 417

Query: 376 GALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           G LE +NVD+  + T++I  QR +   +K  QT    ++ +++LKR
Sbjct: 418 GTLEMSNVDLTDQFTDMIITQRGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|227876747|ref|ZP_03994856.1| flagellar hook protein [Mobiluncus mulieris ATCC 35243]
 gi|306817694|ref|ZP_07451436.1| flagellar hook protein FlgE [Mobiluncus mulieris ATCC 35239]
 gi|227842644|gb|EEJ52844.1| flagellar hook protein [Mobiluncus mulieris ATCC 35243]
 gi|304649508|gb|EFM46791.1| flagellar hook protein FlgE [Mobiluncus mulieris ATCC 35239]
          Length = 466

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 91/469 (19%), Positives = 171/469 (36%), Gaps = 53/469 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ T +SG+      +   S+NIANV+T G+K  +  F                   
Sbjct: 1   MLRSLFTGISGLSVHQTMLDVTSNNIANVNTTGFKSASTRFEDTFSQLVRSGAAPRLNER 60

Query: 50  -STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
              + + V  G+++ +       G+  +T  N D  I G GFF++K  +     TR G F
Sbjct: 61  GGMNPAQVGLGVKLQSITNNFTGGAAQNTGRNLDTMINGDGFFVLKKTNGTQVYTRNGSF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            ++ +G +    G  + G+                +     +  + +    TT  I    
Sbjct: 121 GLDAQGQVVAADGSFVQGWKADTKGIVNASGQPGNITLPLTQSMKANP---TTQVIFGGN 177

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD----------- 217
                +         N              +D  G+     + +T+T             
Sbjct: 178 MPADQLYNDPSMQNPNTAGNAKQFAQVLVVHDDKGNPHEILMKFTRTNIPAPAGGKPGLG 237

Query: 218 ----KKWEVSIFRQDQSTNNSFPY------NVAPLNTVEVSFDPVTGYLANSSHKAISFN 267
                 W+V  +                   +   ++VE+SFD              +  
Sbjct: 238 GAPGSTWKVQFYDSKSYEQLKDANKEKALIQINKKDSVELSFDSQGQLSDADKEALKALP 297

Query: 268 D---------------NTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVS 312
                            T   + +  +++S  T  AG       +++G+  G    F V 
Sbjct: 298 FEINEYKVNDDKTDVTKTKVANDEAKLNLSNLTGYAGLKNFAVDQVDGNPAGTLTGFGVE 357

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
            DG +   + +G+   + ++A A+  +   L+    + ++ + +SG   IG PG    G 
Sbjct: 358 ADGTIRGTFSNGSSRALAKIATASFSNPLGLEKAGASYFVESGNSGQPQIGEPGSGTRGA 417

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +  GA+E +NVD+A+E T LI +QR +  N++V  T  + +  L+S+KR
Sbjct: 418 MTGGAIEMSNVDLAAEFTNLILSQRGFQANTRVITTSDEILQELVSMKR 466


>gi|301023263|ref|ZP_07187060.1| flagellar hook protein FlgE [Escherichia coli MS 69-1]
 gi|300397108|gb|EFJ80646.1| flagellar hook protein FlgE [Escherichia coli MS 69-1]
          Length = 401

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  + +       N 
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPSVKAFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S        + +
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTADHAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSNPTENITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|325982371|ref|YP_004294773.1| fagellar hook-basal body protein [Nitrosomonas sp. AL212]
 gi|325531890|gb|ADZ26611.1| fagellar hook-basal body protein [Nitrosomonas sp. AL212]
          Length = 423

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 102/429 (23%), Positives = 182/429 (42%), Gaps = 22/429 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-----SYVSGGL 60
             +  +SG+ A S  +  V +NIANV+TVGYK++   F+ +   S        + V  G 
Sbjct: 2   GFQQGLSGLSAASTNLDVVGNNIANVNTVGYKQSQAQFTDIFANSLDGAGSSRTQVGIGA 61

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            ++T   +  QG +  T +  D+AI G+GFF +   + V   +R G F ++  GFL + +
Sbjct: 62  RVATVAQLFNQGDIAPTNNPLDIAINGQGFFRMSD-NGVISYSRNGQFRLDGNGFLTDAS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY                   + +   ++S   T+T  +  NL  NA    P  T
Sbjct: 121 GINLTGYAPDANGNINT----GQATNLKLNTTDISPRVTSTFNLGFNLPSNADA--PAVT 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD--KKWEVSIFRQDQSTNNSFPYN 238
                    +  K S   +D+LG+   +  Y+ K+G     W++             P  
Sbjct: 175 TFDANNTQSFNEKKSGVFFDSLGNDHAFTYYFQKSGTLANTWDMYASVDGAIDPTGVPMG 234

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDN--------TSGIDQQITIDISKTTQLAGG 290
           V       V+       +  +     + + +         +G      +D++  TQ    
Sbjct: 235 VTLDGAASVTLTFDDNGILTAPTAPFNVSVDLATINPTLGAGSPLVFALDLTTATQFGSQ 294

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F    ++ +G+A G+   F+ S +G +   Y +G    + ++ +A+  +   L       
Sbjct: 295 FGINLAQSDGYASGRLAGFTTSPEGIIQGNYSNGQNKTLGQVVLASFVNPQGLNPIGDGR 354

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           ++ T  SG   +G P     G + + A+E+ANVD+ SEL ++I AQR Y  N+K  +T  
Sbjct: 355 WIETPSSGQPLVGEPNSGTLGVLQASAVESANVDLTSELVKMITAQRMYQANAKTIETQD 414

Query: 411 DFMDILISL 419
             +  L++L
Sbjct: 415 AILQTLVNL 423


>gi|42528268|ref|NP_973366.1| flagellar hook protein FlgE [Treponema denticola ATCC 35405]
 gi|4426943|gb|AAD20617.1| flagellar hook protein FlgE [Treponema denticola]
 gi|41819538|gb|AAS13285.1| flagellar hook protein FlgE [Treponema denticola ATCC 35405]
          Length = 463

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 110/467 (23%), Positives = 199/467 (42%), Gaps = 52/467 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + ++GM     R+  + +N+ANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVTGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGAARPTEELG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+L  T  NTDLAIQG GFFI+K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGMMVASIDTIFTQGALQTTGVNTDLAIQGNGFFILKDGE-KTFYTRAGAFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           I+ EG L N   G  + G+  + A    I+N+    E +N+   + L A  TT+   + N
Sbjct: 120 IDKEGTLVNPANGMRVQGWMAEEAEGFRIINTSGQTEDLNIPIGQKLDAKATTSVNYACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY--TKTGDKKWEVSIF 225
           LDK    +          +  E T  + F  YD+ G +    + +         W  ++ 
Sbjct: 180 LDKRLPELPEGANR---AQILESTWSTEFKVYDSFGEAHELQIDFARVPGEVNAWRATVN 236

Query: 226 RQDQSTNNSFP----YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS---------- 271
               + + +           +    +      G+LA+ +  A +                
Sbjct: 237 VDPTNADATATRVGIGTTDGVQNSFIVRFDNNGHLASVTDTAGNVTSPAGQVLVQISYNV 296

Query: 272 --------GIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
                   G   + T D++           TQ +     +  E +G+  G  ++F + + 
Sbjct: 297 VGANPDEAGAPTRHTFDVNLGEIGTSKNTITQFSDKSTTKAYEQDGYTLGYLENFRIDQS 356

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +  +Y +G R  I ++A+A   ++  L+    NTY+ + +SG  ++   G    G   
Sbjct: 357 GIITGVYSNGVRQEIGQIAMAGFANQGGLEKAGQNTYVQSNNSGIANVSTSGTVGKGYFI 416

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            G LE +NVD+  +  ++I  Q+ +   +K  QT    ++ +++LKR
Sbjct: 417 GGTLEMSNVDLTDQFVDMIVTQKGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|149927798|ref|ZP_01916049.1| flagellar hook protein E [Limnobacter sp. MED105]
 gi|149823420|gb|EDM82651.1| flagellar hook protein E [Limnobacter sp. MED105]
          Length = 437

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 108/436 (24%), Positives = 178/436 (40%), Gaps = 25/436 (5%)

Query: 5   GSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY----VSGGL 60
           GS +  +SG++A    +  +++N++N   VG+K +   FS +   + + +     +  G 
Sbjct: 7   GSFQQGLSGLNAAQRGLEVIANNVSNASVVGFKGSEAEFSDVFARAFNGARSTNGIGLGT 66

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            ++      +QG++  T +  DLAI G GFF V+  +  N  TR G F +NNEG + N  
Sbjct: 67  SLAAVTQNFKQGNINVTGNPLDLAISGTGFFKVQAGNGDNIYTRNGQFTLNNEGVIVNSR 126

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L G+P+  A+      +   L         +    T +  +  NLD  AT I P   
Sbjct: 127 GDKLQGFPVDAATGRPSDVAQDILVPR----GSIPPAATRSANLELNLDARATAIDPALA 182

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP---- 236
                    + + +S   YD LG + +  +Y  K     W V         +        
Sbjct: 183 F-DPANLNTFNNSTSMTVYDELGGAHIMAIYMRKEASNDWSVFATVDGTQVDVGTAPVAV 241

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDN------------TSGIDQQITIDISKT 284
                 +T       V G L   +   ++ + +            T     Q T D+S T
Sbjct: 242 TTAPAQSTSANLQYGVDGLLTTPNSGNLTVDMSRFVTASGVPFSSTGTAPNQFTFDMSNT 301

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           TQ    F+ Q    +G        F V  DG + I Y +G  V   ++ +   P+ + L+
Sbjct: 302 TQYGSSFVVQNLGQDGFESSPFAGFDVGADGMLTISYANGQLVNHAQIGLYRFPNPEGLQ 361

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
               N +L T  SG   +        G I SGALE +N+D+ +EL  +I AQR Y  NS+
Sbjct: 362 PVGSNGWLATNSSGPELVSLSEDTAFGIIQSGALEESNIDLTAELVAMISAQRVYQANSQ 421

Query: 405 VFQTGSDFMDILISLK 420
             +T       + +L+
Sbjct: 422 TIKTQDSIFQTITNLR 437


>gi|324113871|gb|EGC07845.1| fagellar hook-basal body protein [Escherichia fergusonii B253]
 gi|325497616|gb|EGC95475.1| flagellar hook protein FlgE [Escherichia fergusonii ECD227]
          Length = 401

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 174/415 (41%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDIAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A  P  +        I++ +  ++A  TTT  +  NL+ +  + T       N 
Sbjct: 118 GYPA--AGTPPTIQQGANPTNISIPNTLMAAKTTTTAAMQINLNSSDPLPTVKAFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KT D  W+V                       
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTKDNTWQVYTQDS-------SDAASKATAAT 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+     +   +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLEFNANGMLVKGETANITTGAINGAVPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQASGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|331682578|ref|ZP_08383197.1| flagellar hook protein FlgE [Escherichia coli H299]
 gi|331080209|gb|EGI51388.1| flagellar hook protein FlgE [Escherichia coli H299]
          Length = 401

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSDPTANISTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|300918678|ref|ZP_07135259.1| flagellar hook protein FlgE [Escherichia coli MS 115-1]
 gi|300414172|gb|EFJ97482.1| flagellar hook protein FlgE [Escherichia coli MS 115-1]
          Length = 401

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   + + G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFVSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|311280017|ref|YP_003942248.1| fagellar hook-basal body protein [Enterobacter cloacae SCF1]
 gi|308749212|gb|ADO48964.1| fagellar hook-basal body protein [Enterobacter cloacae SCF1]
          Length = 402

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 102/415 (24%), Positives = 183/415 (44%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRALDVAISQNGFFRLVDSNGSVYYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        +NV +  ++A  TTT  +  NL  N+T  TP  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPVALNVPNTLMAAKTTTTAAMQINL--NSTDKTPTVTPFDAT 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y  K S   YD+ G++   +VY+ K+ D  W         + ++S         + 
Sbjct: 174 KADSYNKKGSVTVYDSQGNAHDMNVYFVKSADNTW------DVYTQDSSTNAVSPTTPST 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            ++FD     L+  +    +   N +          +   Q  G      +  NG+ PG 
Sbjct: 228 TLTFDTNGNLLSGGTVNITTGTVNGATPATFALSFANSMQQNTGSNNIVATNQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L+    N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQVLGQIVLANFANNEGLQSEGDNVWSATKSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|218674739|ref|ZP_03524408.1| flagellar hook protein FlgE [Rhizobium etli GR56]
          Length = 433

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 179/434 (41%), Positives = 236/434 (54%), Gaps = 14/434 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTSGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSTTDLAISGDGFFIVQGADGTPVLTRAGDFQKDDEGNLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + S  ++VN F GL  +NV    L+A+ +T+G    NLD NA I     T
Sbjct: 121 GFQLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGVFKGNLDSNAKIPVAPAT 180

Query: 181 PKHNGRDAEYTHKSSFA--AYDTLGSSVVYDVYYTKT-----------GDKKWEVSIFRQ 227
                     T     +  AYD LG+ V+YD Y+TK                       +
Sbjct: 181 LPSANAATTTTDTKKVSMVAYDRLGNKVMYDFYFTKQSVAAAPPPAPPATAATWEVAMFR 240

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
           + +       +        V    +T         + + N       Q I ++ S  TQL
Sbjct: 241 NANAAVGGTTSFPYSVGGAVGTGTLTFDSNGKMTSSGAVNITDGVTGQTIAMNFSGLTQL 300

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F       NG A    KD ++  DG V   Y+DG+  P+YR+ +A V S D L L  
Sbjct: 301 GADFSGTG-TPNGQAATPVKDVTIDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLMS 359

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN Y     SG    GFP  N  G I SGALE +NVD+A ELTE+IE+QR+Y  NSKVFQ
Sbjct: 360 GNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGELTEMIESQRSYTANSKVFQ 419

Query: 408 TGSDFMDILISLKR 421
           TGSD MD+L++LKR
Sbjct: 420 TGSDIMDVLVNLKR 433


>gi|167630298|ref|YP_001680797.1| flagellar hook protein [Heliobacterium modesticaldum Ice1]
 gi|167593038|gb|ABZ84786.1| flagellar hook protein [Heliobacterium modesticaldum Ice1]
          Length = 442

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 90/443 (20%), Positives = 172/443 (38%), Gaps = 25/443 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           ++ S+ + ++ +     R+  + +NIANV+T+G+K++ + F+  +  +            
Sbjct: 1   MMRSLFSGVTALRNHQTRMDTIGNNIANVNTIGFKKSRVTFADALNQTIRGASSPQGGRG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+   V  G+ I+T + +    S+  T  N+DLAI+G GFF++         TRAG+F 
Sbjct: 61  GTNPMQVGLGMNIATMETVFTPASVQGTGKNSDLAIEGDGFFLL-DDGGARYYTRAGNFD 119

Query: 110 INNE-GFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
           ++ E  F+    G  ++GY                +   +      SA        +   
Sbjct: 120 LDTEYNFIRTDNGMKVMGYIADATGEIDANGDPVPINIKDKLQMTASATNRVEFNKNLYS 179

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
            + +          ++ R  ++    +F       +   + V    T +      I   +
Sbjct: 180 LQASAKPIQKSIEIYDSRGGKHNLVLTFKNVSNATTPNTWQVSARITTEDPQSKKITTAN 239

Query: 229 QSTNNSFPYNVAPLNTVEVSFDP----------VTGYLANSSHKAISFNDNTSGIDQQIT 278
                +  ++   L       D                  +      F       D ++ 
Sbjct: 240 GYIIGTMLFSTNGLFKSFQVSDSVDFKFPGLGVDDIGAMPNGTYTAKFEIPDVKKDTKLY 299

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
           +D+   TQ        K   NG+A G  K +++   G +   Y +G    + ++A+ T  
Sbjct: 300 LDLHAITQFNSETTIDKLSQNGYADGDLKSYAIDAAGVLTGTYSNGQNRKMAQVAVTTFS 359

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           +   L     N Y  T +SG+   G P     G I  GALE +NVD++ E T++I  QR 
Sbjct: 360 NPAGLFKAGSNLYTRTNNSGEPKTGQPAVGGRGAITPGALEMSNVDLSQEFTDMITTQRG 419

Query: 399 YAVNSKVFQTGSDFMDILISLKR 421
           +  NS++       ++ L++LKR
Sbjct: 420 FQANSRIISVSDSMLEELVNLKR 442


>gi|331657138|ref|ZP_08358100.1| flagellar hook protein FlgE [Escherichia coli TA206]
 gi|331055386|gb|EGI27395.1| flagellar hook protein FlgE [Escherichia coli TA206]
          Length = 401

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNHWDVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|253688972|ref|YP_003018162.1| hypothetical protein PC1_2595 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755550|gb|ACT13626.1| protein of unknown function DUF1078 domain protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 405

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 94/415 (22%), Positives = 179/415 (43%), Gaps = 11/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A SN +  + +NIAN  TVG+K   + F+ +       S V  G+++++ 
Sbjct: 2   GFSQAVSGLNAASNNLDVIGNNIANSATVGFKSGTVTFADMFA----GSKVGMGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L 
Sbjct: 58  LQDFGNGTVTSSSRDLDIAISGGGFYRLQDTNGSVYYSRNGQFMLNG-RNIVNAQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P +V +      + +   ++ A  TTT  I  NL  + ++          G
Sbjct: 117 GYPV--AGTPPVVQTGADPVPLTIPDGDMLANRTTTASIKANLKSSDSVPANSWA-TTPG 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y  K++   YD  G+   Y +Y+ KT +  W+        +               
Sbjct: 174 GEGTYNSKTALTTYDGQGNVHNYTLYFVKTANNTWQTYAKDDAVTPATYQNAGTLNFEA- 232

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             +    +      +   I+            T+D++ + Q    +  +    NG  PG 
Sbjct: 233 --NGALSSTGATAHTPFTINMTGTNGAAGGTFTLDLTGSVQQNTEYSYKSPTQNGFGPGS 290

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              ++++ DG +   Y +G +  + ++ +A   + + L     N +  T  SG   +G  
Sbjct: 291 LTGYAINDDGTIVGSYSNGQKQALGQILLAGFANPEGLSPEGDNAWSETASSGQAVVGLA 350

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   + E +NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 351 GSGNLGKLVGKSTEMSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 405


>gi|227328338|ref|ZP_03832362.1| flagellar hook protein FlgE [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 400

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 182/415 (43%), Gaps = 16/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A SN +  + +NIAN  TVG+K   + F+ +       S V  G+++++ 
Sbjct: 2   GFSQAVSGLNAASNNLDVIGNNIANSATVGFKSGTVTFADMFA----GSKVGMGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L 
Sbjct: 58  LQDFGNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNG-RNIVNAQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P  V +      + V   ++ A  TT   I  NL  +  + T        G
Sbjct: 117 GYPV--AGTPPTVQTGADPVPLTVPDGDMLASATTIASIKANLKSSDAVPTNAWA-TTPG 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y  K++   YD+ G+   + +Y+ KT +  W+                  A     
Sbjct: 174 AEGTYNSKTALTTYDSQGNVHNFTLYFVKTANNTWQTYAKDD--------SITPAVYQNA 225

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
                   G L   +   I+            T++++ + Q    +  +    NG APG 
Sbjct: 226 GALNFASNGALTGHTPFNINLVGTNGAATGTFTLNLTGSVQQNTEYSYKSPTQNGFAPGS 285

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              F+++ DG ++  Y +G +  + ++ +A+  + + L     N +  T  SG   +G  
Sbjct: 286 LTGFAINDDGTIEGNYSNGQKQALGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLA 345

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 346 GTGSLGKLIGKSTESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 400


>gi|328948413|ref|YP_004365750.1| flagellar hook-basal body protein [Treponema succinifaciens DSM
           2489]
 gi|328448737|gb|AEB14453.1| flagellar hook-basal body protein [Treponema succinifaciens DSM
           2489]
          Length = 463

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 106/467 (22%), Positives = 193/467 (41%), Gaps = 52/467 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+   +SG+     R+  + +NI+NV+T G+K+    F  ++    + +        
Sbjct: 1   MMRSLYAGVSGLQNHQTRMDVIGNNISNVNTYGFKKGRATFQDMISQQINGAARPTEEVG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ ++T D I  QG+L  T + TDLAIQG GFF++K  D     +RAG F 
Sbjct: 61  GVNPKEVGLGMSVATIDTIFTQGNLQTTGNTTDLAIQGNGFFVLKNGD-ETFYSRAGVFG 119

Query: 110 INNEGFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
            ++ G L N A G+ +   +        ++  S    + +     +     T       N
Sbjct: 120 TDSNGTLVNPANGLRVQGWMAEDVNGRQVVRTSATPTDLVIPVGQKDPPKATENVRYFCN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           L+KN   I  + T     +  E T ++    YDT G++    + + K      + ++   
Sbjct: 180 LNKNTPEIPDNPT---ADQVIEGTWQTEIDIYDTYGNAHQVQMNFAKVPGNPNQWTVTVN 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------ 281
               N  F        T +   +  T    N+       +   +  + Q  I +      
Sbjct: 237 VDPDNADFTQTRIGFGTTDGVQNTYTLNFDNTGKLQSVVDSAGNQSNPQGEIVLQASYAV 296

Query: 282 ---------------------------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
                                      +  TQ A     + +  +G+  G   +F + + 
Sbjct: 297 ADSNADANGNPYRQTFNLNLGTIGSMENTITQAASKSTTKANYQDGYKLGYLDNFKIDQS 356

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +  +Y +G+   I ++A+A+  ++  L+    NTY  + +SG  +IG  G    G + 
Sbjct: 357 GIITGVYSNGSVRTIGQVAMASFTNQGGLEKKGDNTYAESINSGMANIGESGTQGKGSML 416

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           SG LE +NVD+  +LT++I  QR +  N+K  QTG   ++ ++ LKR
Sbjct: 417 SGTLEMSNVDLTEQLTDMIVTQRGFESNAKTIQTGDSMLETVLGLKR 463


>gi|254516989|ref|ZP_05129047.1| flagellar hook protein FlgE [gamma proteobacterium NOR5-3]
 gi|219674494|gb|EED30862.1| flagellar hook protein FlgE [gamma proteobacterium NOR5-3]
          Length = 429

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 182/429 (42%), Gaps = 15/429 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           +  TA+SG++A +  +  +S+NIAN  T G+K +   F+ +   S     ++ +  G+ +
Sbjct: 2   AFSTAISGINAATADLGVISNNIANSSTTGFKASRAEFADVYATSLLGAGSNAIGKGVSL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++  T ++ DLAI G GFF +   +     TRAG+F ++ EGFL +    
Sbjct: 62  AGVTQEFGQGNITFTNNSLDLAINGNGFFQL-SVEGAIEYTRAGNFQVDREGFLVSNQNS 120

Query: 123 VLLGYPLKN---------ASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT 173
            L G+ +                               + L +   + G          T
Sbjct: 121 RLQGFQVDAGGDVTGQLGDIQIDTSLIDPNATASVSLTSNLDSREVSPGTGFGGAAAPFT 180

Query: 174 IITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQDQSTN 232
                     +   A++   +S   YD+LG+  V  +YY KT    +W V       S N
Sbjct: 181 EYDAFAATPTSPSPADFNATTSTTIYDSLGNPHVLSLYYVKTANANEWNVFSLIDGVSQN 240

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG-IDQQITIDISKTTQLAGGF 291
              P  +   +  + +   +T           +   +T         +D+++TTQ    F
Sbjct: 241 AGAPVTLNFASNGQFTAASLTDIPIAGWDPLNTDGSSTGALSPASFNVDLAQTTQFGTAF 300

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G + G+ +   + + G     Y +G    + ++A+A+  +++ L+      +
Sbjct: 301 AVSSVVQDGFSAGQLRGLEIDESGVAFARYTNGESRALGQIALASFNNQNGLQPVGDTNW 360

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
           + T  SG  ++G PG +  G + S ALE +NV+I  EL +LI AQRN+  N++V Q    
Sbjct: 361 VETFSSGSPNVGEPGTSGLGVVQSAALEDSNVEITQELVDLIVAQRNFQANAQVIQAEDA 420

Query: 412 FMDILISLK 420
               +I+L+
Sbjct: 421 ITQTVINLR 429


>gi|157371207|ref|YP_001479196.1| flagellar hook protein FlgE [Serratia proteamaculans 568]
 gi|157322971|gb|ABV42068.1| flagellar basal body FlaE domain protein [Serratia proteamaculans
           568]
          Length = 407

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 101/416 (24%), Positives = 191/416 (45%), Gaps = 11/416 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K   ++F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATSGFKSGTVSFADMFA----GSQVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
               + G+   T+   D+AI G GFF ++ +D     +R G F ++    L N+ G  L 
Sbjct: 58  TQNFKGGTTTGTSRALDVAISGNGFFRMQDQDGGVFYSRNGQFKLDENRNLTNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A  P  +        +++    ++A  +T+G +  NL     +  PD       
Sbjct: 118 GYPA--AGTPPTIQQGANPVPLSIPEGMMNAKASTSGTMVANLKSTHKV--PDNKTFDPA 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y + ++  AYD+LG++   + Y+ KT + KW+  ++ QD S        +    + 
Sbjct: 174 KQDSYNYVNTITAYDSLGNAHNINAYFVKTDENKWQ--VYTQDGSAAPVDAGTMTFDTSG 231

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF-IPQKSEINGHAPG 304
            ++        A      +  +       Q +++  +K+ Q +       K   +G+  G
Sbjct: 232 NLTGTTSKQGTAAEFSMLVPMSAKDGAPAQNLSLSFAKSMQQSVSADSVSKVSQDGYGAG 291

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +  +F ++ DG V  IY +     + ++ +A   + + L     N +  T  SG   +G 
Sbjct: 292 EYTNFQINNDGTVVGIYSNQQTQVLGQIVMANFSNPEGLSSQGDNVWQETGASGQPRVGI 351

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G    G++ SGALE +NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 352 AGGGGFGKLTSGALEASNVDLSQELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 407


>gi|74317652|ref|YP_315392.1| flagellar hook protein FlgE [Thiobacillus denitrificans ATCC 25259]
 gi|74057147|gb|AAZ97587.1| flagellar hook protein FlgE [Thiobacillus denitrificans ATCC 25259]
          Length = 405

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 88/418 (21%), Positives = 162/418 (38%), Gaps = 17/418 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGG---LEI 62
           S +  +SG++A +  +  + +N++N  TVG+K++   F+ +   S + +  S     +++
Sbjct: 2   SFQQGLSGLNAAAKNLDVIGNNVSNASTVGFKQSQAQFADVYANSLTGAGGSSIGIGVKV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG++  T +  D+AI G GFF            R G F ++  G++ N  GG
Sbjct: 62  AQVAQQFTQGNITSTNNPLDMAINGGGFFR-MDNGGEIAYQRNGQFQLDKNGYIVNPTGG 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY                     +        P  T  ++  L+ ++T         
Sbjct: 121 KLTGYTAN------ASGVLSTGAPAPLAINTADLTPQATSEVNAVLNLDSTGTALPAASF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                  Y   ++ + YD+LG+      YY KT    W V           +        
Sbjct: 175 DMNDPTTYHSSTAASVYDSLGNQHTLQTYYVKTAAGTWNVYAASDGTPIPAAGTPVSTLT 234

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
                      G L       ++    T         D + TTQ    F       +G+ 
Sbjct: 235 FNGS-------GALTGGGQFTVTAPVTTGANPITAAFDFTGTTQFGSAFSVNTLNQDGYT 287

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   F++  DG +   Y +G    + ++ +A   + + L+    N +  T  SG   +
Sbjct: 288 SGRLAGFNIGADGTILGRYTNGQSAVLGQVVLANFANPNGLQQMGNNLWTETATSGTPLV 347

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G P     G + S A+E +NVD+ +EL  +I AQR Y  N++  ++    +  L++L+
Sbjct: 348 GTPDSGGLGVLQSSAVEDSNVDLTAELVNMITAQRVYQANAQTIKSQDAVLQTLVNLR 405


>gi|116250500|ref|YP_766338.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255148|emb|CAK06222.1| flagellar hook protein (agr_c_1012p) [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 433

 Score =  246 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 183/434 (42%), Positives = 245/434 (56%), Gaps = 14/434 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR+S V+DNIANV+T GYK  + +FSSLV PS+  +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSSLVLPSSGGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  +S+QG + +T S+TDLAI G GFFIV+G D    LTRAGDF  ++EG L N A
Sbjct: 61  QTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGADGTPVLTRAGDFTKDDEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY     S  ++VN F GL  +NV    L+A+ +T+G    NLD  A +++    
Sbjct: 121 GFQLMGYSYDAGSPAVVVNGFDGLVPVNVNQEGLTAIASTSGVFKGNLDSGANVVSTAAD 180

Query: 181 PKHNGRDAE--YTHKSSFAAYDTLGSSVVYDVYYTK-----------TGDKKWEVSIFRQ 227
                       T K S  AYD+LG+ V+YD Y+TK                WEV+IFR 
Sbjct: 181 RPSANSATTTADTKKFSMVAYDSLGNKVMYDFYFTKTSVTTPPPATPATASTWEVAIFRN 240

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
             +              +  +          ++       D+T+   Q I +D++  TQL
Sbjct: 241 ADAATGGTTSFPYSTAAIGTTTLDFDATGKITNSTGAVTIDDTARTGQMIDMDLTGFTQL 300

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
              F       NG A    KD +V  DG V   Y+DG+  P+YR+ +A V S D L L  
Sbjct: 301 GADFAGTG-TPNGQAASPVKDVTVDGDGIVYAKYEDGSTKPLYRIPLANVASPDKLTLMS 359

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
           GN Y     SG    GFP  N  G I +GALE +NVD+A ELTE+IE+QR+Y  NSKVFQ
Sbjct: 360 GNVYSANGQSGVTVTGFPQTNGLGTIKAGALEGSNVDLAGELTEMIESQRSYTANSKVFQ 419

Query: 408 TGSDFMDILISLKR 421
           TGSD MD+L++LKR
Sbjct: 420 TGSDIMDVLVNLKR 433


>gi|194432446|ref|ZP_03064733.1| flagellar hook protein FlgE [Shigella dysenteriae 1012]
 gi|194419333|gb|EDX35415.1| flagellar hook protein FlgE [Shigella dysenteriae 1012]
 gi|332092817|gb|EGI97885.1| flagellar hook protein flgE [Shigella dysenteriae 155-74]
          Length = 401

 Score =  246 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  WEV           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWEVYTQD-------SSDPTDTADRAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSNPTENITTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASKGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|117928057|ref|YP_872608.1| hypothetical protein Acel_0849 [Acidothermus cellulolyticus 11B]
 gi|117648520|gb|ABK52622.1| protein of unknown function DUF1078 domain protein [Acidothermus
           cellulolyticus 11B]
          Length = 398

 Score =  246 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 103/431 (23%), Positives = 177/431 (41%), Gaps = 47/431 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ + +SG+ A    +  V +NIANV+TVG+K + + F   +               
Sbjct: 1   MLRSLFSGVSGLRAHQTMLDVVGNNIANVNTVGFKASQVEFEDTLSQMLRAAGAPQGVQG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+ + V  G++I+       QG    T  +TDL IQG GFF++         TR G F 
Sbjct: 61  GTNPAQVGLGVQIAAISTTFTQGPAETTGVDTDLMIQGDGFFVL-DDGGQRVYTRNGAFS 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +  G L +  G ++ G+                          +    TTT  ++ NL 
Sbjct: 120 FDANGNLVSANGALVQGWLASGGVVNTTGPVTAIKLP---LGTSMPPSATTTATLAGNLP 176

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            + +    D                    YD  G +  Y + Y+              + 
Sbjct: 177 ADGSGSPIDNN---------------LTVYDAKGQATQYTLEYS---------YDTTSNS 212

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
              +  P        V +SFD  TG    ++ + ++         Q I++D+S  T   G
Sbjct: 213 WKLDILPPGGGSPTNVPLSFDSTTGQYNGTNPQTVTL------GGQNISLDLSGLTAYGG 266

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
           G   +    +G A G    +++S DG +  ++ +G + P+ ++A+AT  +   L     +
Sbjct: 267 GNTVEVVSSDGSAMGSLASYTISPDGTIQGVFTNGMKQPLAKIALATFNNPGGLTKVGTS 326

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            Y  + +SG   IG  G    G++ +G LE +NVD++ E T LI A+R +  N+KV  T 
Sbjct: 327 EYAESVNSGAAQIGASGTGSRGQLAAGELEGSNVDLSQEFTNLIIAERGFQANAKVITTS 386

Query: 410 SDFMDILISLK 420
              +  L++LK
Sbjct: 387 DQVLQDLVNLK 397


>gi|315127353|ref|YP_004069356.1| flagellar hook protein E [Pseudoalteromonas sp. SM9913]
 gi|315015867|gb|ADT69205.1| flagellar hook protein E [Pseudoalteromonas sp. SM9913]
          Length = 440

 Score =  246 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 98/442 (22%), Positives = 168/442 (38%), Gaps = 30/442 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A++G+ A    +   ++NIANV+T G+K +   F+ +   S      +    G++ 
Sbjct: 2   SFNIALTGLAAAQKDLDVTANNIANVNTTGFKESRAEFADVYASSVFSAGKTKNGDGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           +       QGSL  T ++ DLAI G+G+F             TRAG F +N + F+ +  
Sbjct: 62  TMVAQQFHQGSLQFTNNSLDLAITGEGYFATSQDLGAQDFTYTRAGAFKLNKDNFVVDAK 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+   S      S      + +  +  S   T+  + S N+D    +      
Sbjct: 122 GNFLQSFPVDEVSGDTTSVSLSTSSALQIPDSSGSPRSTSNVYTSFNVDSREDV---IAV 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P        Y   +S   YD+LG   V   ++ KT   +W+V         + +      
Sbjct: 179 PFDATDSTTYNSSTSTTMYDSLGEPHVLQFFFVKTAPNEWQVHGTLDKTPFDATGAATAT 238

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI------------------- 281
           P       FD        +    +        +       I                   
Sbjct: 239 PSPLSTFGFDASGLPATTNGAPNVGPTFTDVNLTGTNLSGILSNGAQFDDIAINWRDEAG 298

Query: 282 ---SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
                 TQ A  F  +  E +G   G+     +  DG V   Y +G    + ++A+    
Sbjct: 299 TANRTPTQYASRFEVKALEQDGATVGRLAGIDIGTDGKVVASYSNGDSTYLGQVAMVRFS 358

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           +   L+     ++  +  SG+   G PG    G I S ALE +NV++ +EL +LI AQRN
Sbjct: 359 NSQGLQQVGDTSWKKSLTSGEPIAGEPGSGTLGNINSSALEQSNVNLTNELVDLISAQRN 418

Query: 399 YAVNSKVFQTGSDFMDILISLK 420
           +  NS+  +  S     ++ ++
Sbjct: 419 FQANSRALEVNSTIQQNILQIR 440


>gi|295096225|emb|CBK85315.1| fagellar hook-basal body proteins [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 402

 Score =  246 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 175/415 (42%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K  + +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGSASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRMVDANGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P  V +    + I++    ++A  TTT     NL+   T  T         
Sbjct: 118 GYPV--AGTPPTVQTGANPQAISIPTTLMAAKSTTTASQQINLNSTDTAPTVA---FDPS 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   +D+ G++   +++Y K         ++ QD S         A     
Sbjct: 173 NPDSYNKKGTVTVFDSQGNAHNMNLFYVKNETPANSWKVYSQDGSV-----AGDAAKLAT 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            ++F+           K  +     +          +   Q  G      +  NG+ PG 
Sbjct: 228 TLTFNESGVLTGGDDIKITTGTVPGATPATFDMSFANSMQQNTGANNIVATSQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + LK    N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQVLGQIVLANFANNEGLKSEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GSGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|218704484|ref|YP_002412003.1| flagellar hook protein FlgE [Escherichia coli UMN026]
 gi|293404360|ref|ZP_06648354.1| flgE [Escherichia coli FVEC1412]
 gi|298380140|ref|ZP_06989745.1| flagellar hook protein FlgE [Escherichia coli FVEC1302]
 gi|300899595|ref|ZP_07117834.1| flagellar hook protein FlgE [Escherichia coli MS 198-1]
 gi|218431581|emb|CAR12460.1| flagellar hook protein [Escherichia coli UMN026]
 gi|291428946|gb|EFF01971.1| flgE [Escherichia coli FVEC1412]
 gi|298279838|gb|EFI21346.1| flagellar hook protein FlgE [Escherichia coli FVEC1302]
 gi|300356866|gb|EFJ72736.1| flagellar hook protein FlgE [Escherichia coli MS 198-1]
          Length = 401

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S        + +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTADHAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSNPTANITTGAINGADPATFSLSFLNSMQQNTGANNIVVTTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|325474542|gb|EGC77728.1| flagellar hook protein FlgE [Treponema denticola F0402]
          Length = 463

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 110/467 (23%), Positives = 200/467 (42%), Gaps = 52/467 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ S+ + ++GM     R+  + +N+ANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVTGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGAARPTEELG 60

Query: 55  -----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D I  QG+L  T  NTDLAIQG GFFI+K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGMMVASIDTIFTQGALQTTGVNTDLAIQGNGFFILKDGE-KTFYTRAGAFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           I+ EG L N   G  + G+  + A    I+N+    E +N+   + L A  TT+   + N
Sbjct: 120 IDKEGTLVNPANGMRVQGWMAEEADGFRIINTSGQTEDLNIPIGQKLDAKATTSVNYACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY--TKTGDKKWEVSIF 225
           LDK    +          +  E T  + F  YD+ G +    + +         W+ ++ 
Sbjct: 180 LDKRLPELPEGANR---AQILESTWSTEFKVYDSFGEAHELQIDFARVPGEVNAWQATVN 236

Query: 226 RQDQSTNNSFP----YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS---------- 271
               + + +           +    +      G+LA+ +  A +                
Sbjct: 237 VDPTNADATATRVGIGTTDGVQNSFIVRFDNNGHLASVTDTAGNVTSPAGQVLVQISYNV 296

Query: 272 --------GIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
                   G   + T D++           TQ +     +  E +G+  G  ++F + + 
Sbjct: 297 VGANPDEAGAPTRHTFDVNLGEIGTSKNTITQFSDKSTTKAYEQDGYTLGYLENFRIDQS 356

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +  +Y +G R  I ++A+A   ++  L+    NTY+ + +SG  ++   G    G   
Sbjct: 357 GIITGVYSNGVRQEIGQIAMAGFANQGGLEKAGQNTYVQSNNSGIANVSTSGTVGKGYFI 416

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            G LE +NVD+  +  ++I  Q+ +   +K  QT    ++ +++LKR
Sbjct: 417 GGTLEMSNVDLTDQFVDMIVTQKGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|119469950|ref|ZP_01612755.1| flagellar hook protein E [Alteromonadales bacterium TW-7]
 gi|119446660|gb|EAW27933.1| flagellar hook protein E [Alteromonadales bacterium TW-7]
          Length = 454

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 108/456 (23%), Positives = 184/456 (40%), Gaps = 44/456 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A++G+ A    +   ++NIANV+T G+K +   F+ +   S   +  +    G++ 
Sbjct: 2   SFNIALTGIAAAQKDLDVTANNIANVNTTGFKESRAEFADVYASSVFSSGRTKNGDGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           +       QGSL  T ++ DLAI G+G+F +           TRAG F ++ + F+ +  
Sbjct: 62  TMVAQQFHQGSLQFTNNSLDLAITGEGYFAMSQDLGAQDFTYTRAGAFKLDKDNFVVDAK 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L G+P+  A+      S      + +  +  S   TT  + S NLD  A   +    
Sbjct: 122 GNYLQGFPVDEATGDTTSVSLSTSSALQIPDSSGSPRATTNVYSSFNLDSRADAPSIA-- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT------GDKKWEVSIFRQDQSTNNS 234
                  A Y   +S   YD+LG   V   ++ KT       D +WE       +S + +
Sbjct: 180 -FDPETSASYNSSTSTTVYDSLGEPHVLQFFFVKTDSAVTGNDNEWETYATLDGKSFSPA 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDN--------------------TSGID 274
                A   T   +F   +  L +S+    +                        T+G  
Sbjct: 239 GLEETAAPFTPLSTFQFDSSGLPSSTDGVANTGTTFNPLTVPGGAGAAAGLSDVLTNGAS 298

Query: 275 QQITIDISK----------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG 324
               IDI+            TQ A  F  +  + +G   G+     +  DG V   Y +G
Sbjct: 299 FPDDIDINWRDEAGTTNKVPTQYASRFEVKALDQDGATVGRLAGIDIGTDGKVVASYSNG 358

Query: 325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVD 384
               + ++A+    +   L+      +  +  SG+   G PG    G I S ALE +NV+
Sbjct: 359 DSTFLGQVAMVRFSNSQGLQQVGDTAWKKSLTSGEPIAGEPGSGTLGSINSSALEQSNVN 418

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + +EL +LI AQRN+  NS+  +  S     ++ ++
Sbjct: 419 LTNELVDLISAQRNFQANSRALEVNSTLQQAILQIR 454


>gi|315654586|ref|ZP_07907492.1| flagellar hook protein FlgE [Mobiluncus curtisii ATCC 51333]
 gi|315491050|gb|EFU80669.1| flagellar hook protein FlgE [Mobiluncus curtisii ATCC 51333]
          Length = 487

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 90/487 (18%), Positives = 170/487 (34%), Gaps = 68/487 (13%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ T +SG+      +   S+NIANV+T G+K  +  F                   
Sbjct: 1   MLRSLFTGISGLSVHQTMLDVTSNNIANVNTTGFKSASTRFEDTFSQLVRSGAAPRLNER 60

Query: 50  -STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
              + + V  G+++ +       G+   T  N D  I G GF++++  +  +  TR G F
Sbjct: 61  GGMNPAQVGLGVKLQSITQNFTGGAAQMTGRNLDTMINGDGFYVLRKTNGTSVYTRNGSF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERI-----------------NVKH 151
            ++ +G L    G  + G+            +   +                    N+  
Sbjct: 121 GVDAQGQLVAADGSFVQGWMGNEDGTINASGTPGHITLPLTKTVEGKPTKNVIYGGNIPA 180

Query: 152 AELSAMPTTTGFISNNLDKNATIITPDKTPKHNGR------------------------- 186
            ++   PT +    +N  + + I+       +                            
Sbjct: 181 DQIYMDPTKSKTSPSNAFQRSQIVHAYDDKGNPHDVLLTFARADFAKPGSQPVWELRAYD 240

Query: 187 ---DAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLN 243
                E             G+ +   V   KT                          L+
Sbjct: 241 AKAYKELNETQREELTSKNGARIELKVKQGKTVKLGNSTVAPVAKGGVLTFQFGTNGKLD 300

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSG---------IDQQITIDISKTTQLAGGFIPQ 294
           T          +  +  +   +                  + IT+D+S  T   G     
Sbjct: 301 TESEQLLKTVNFTLDQLNVVPATKPGEIAKTEVVTPNVTKEPITLDLSAMTGFGGVNNFG 360

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
           + +++G+  G    +SV  DG +   + +G    + R+A+A+  +   L+    + ++ T
Sbjct: 361 QKQVDGNMAGYMTGYSVEADGTIRGTFSNGDNRALARIAVASFANPLGLEKAGSSYFVET 420

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SG   IG  G  Q G +  GA+E +NVD+A+E T LI +QR +  NS+V  T  + + 
Sbjct: 421 GNSGQPQIGEAGTGQRGAMTGGAIEMSNVDLAAEFTNLILSQRGFQANSRVITTSDEILQ 480

Query: 415 ILISLKR 421
            L+++KR
Sbjct: 481 ELVNMKR 487


>gi|307546968|ref|YP_003899447.1| flagellar hook protein FlgE [Halomonas elongata DSM 2581]
 gi|307218992|emb|CBV44262.1| flagellar hook protein FlgE [Halomonas elongata DSM 2581]
          Length = 422

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 104/426 (24%), Positives = 182/426 (42%), Gaps = 16/426 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NIAN  TVG+K +   F+ +      NS V  G ++S  
Sbjct: 2   GFSQALSGLNAASSSLDVLGNNIANSQTVGFKGSDTLFADVYA----NSKVGLGTKVSRV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                +G+L  T  N DL I G+GF   + ++     +R G   +  +G+LEN  G  L+
Sbjct: 58  LQDFGEGNLESTGRNLDLGISGEGFLRFQ-QNGEVVYSRNGQLSMTADGYLENAQGARLM 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTG------FISNNLDKNATIITPDK 179
           G+ + +A           L+    + A  +     T                  + T   
Sbjct: 117 GFGVNDAGQVQTGGQPSVLQVSAEEMAASATTDVATTLNLDSREAVGEQLDQVDVTTDMS 176

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
            P +N +  +Y + ++F AYD+LG+     VYY KTG   W   +        ++     
Sbjct: 177 DPANNQQTLDYHYANNFTAYDSLGNPRNATVYYQKTGANSWTGRVTMDGHYDASNDFTLT 236

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSG-----IDQQITIDISKTTQLAGGFIPQ 294
              +    + +        +       +DNT+       +   T+DI+ +TQ        
Sbjct: 237 FNNSGQLATINGNDAGDPANMPTVSVASDNTTPLGGEPAELSFTLDIAGSTQFGNTSRAS 296

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G+  G     S+  DG +   Y +    P  ++++A+  + + L     N +  T
Sbjct: 297 DLIQDGYTSGSLVGISIEDDGTIVRNYTNEQSRPAGQVSLASFRNPEGLDPVGDNAWAAT 356

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG   +G PG  Q G I SG +E++NVD+A EL ++I  QR Y  NS+  +T  + + 
Sbjct: 357 AASGQELVGAPGTGQLGGIQSGVVESSNVDMAQELVDMIVTQRAYQANSQTIKTQDEVLQ 416

Query: 415 ILISLK 420
             I+L+
Sbjct: 417 TAINLR 422


>gi|331646334|ref|ZP_08347437.1| flagellar hook protein FlgE [Escherichia coli M605]
 gi|330910890|gb|EGH39400.1| flagellar hook protein FlgE [Escherichia coli AA86]
 gi|331045086|gb|EGI17213.1| flagellar hook protein FlgE [Escherichia coli M605]
          Length = 401

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQLNLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|123442784|ref|YP_001006761.1| flagellar hook protein FlgE [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161322|ref|YP_004297899.1| flagellar hook protein FlgE [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122089745|emb|CAL12598.1| flagellar hook protein FlgE [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605242|emb|CBY26740.1| flagellar hook protein FlgE [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665552|gb|ADZ42196.1| flagellar hook protein FlgE [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860606|emb|CBX70903.1| flagellar hook protein flgE [Yersinia enterocolitica W22703]
          Length = 419

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 93/425 (21%), Positives = 171/425 (40%), Gaps = 17/425 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NIAN  T G+K  +++F+ +       S    G++++  
Sbjct: 2   GFSQAVSGLNAASSNLDVIGNNIANSATSGFKAGSVSFADMFA----GSQTGMGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T    DLAI   GFF ++         R G F ++    + N+ G  L 
Sbjct: 58  TQDFNDGTTTTTNRRLDLAISQSGFFRMQDSSGGVLYARNGQFKLDENRNIVNMQGLSLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        ++V    + A  TT+G +  NL     +I P  T     
Sbjct: 118 GYPA--TGTPPTVQQGANPVALSVPQNMIPAKATTSGTMVANLTSTHDVI-PVATTFDPT 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y+  ++   +D+LG+    +V+Y K  +     + +      +++ P   A     
Sbjct: 175 KPDTYSFVNNMTTFDSLGNRHEINVFYVKRSESTTAGNTWDVYTLDSSAKPAETADKRGS 234

Query: 246 E----------VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
                      V+        ++ +        N +              Q  G      
Sbjct: 235 MTFDTNGALQSVTNGTNPASTSDFTLTIPMGVVNGAPAQTFTLSVAGSKQQNTGTDSIVT 294

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
               G+A G+   F ++ DG +   Y +     + ++ +    + + L     N +  T 
Sbjct: 295 QNQTGYAAGEFTGFQINNDGSIVGTYSNSQTQLLGQIVMVNFANPEGLSSEGDNVWKETL 354

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
            SG+  +G  G    G + SGALE++NVD++ EL  +I AQRNY  N++  +T    +  
Sbjct: 355 SSGNPILGTAGSGGFGTLTSGALESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILQT 414

Query: 416 LISLK 420
           L++L+
Sbjct: 415 LVNLR 419


>gi|77165838|ref|YP_344363.1| hypothetical protein Noc_2375 [Nitrosococcus oceani ATCC 19707]
 gi|254433154|ref|ZP_05046662.1| conserved domain protein [Nitrosococcus oceani AFC27]
 gi|76884152|gb|ABA58833.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gi|207089487|gb|EDZ66758.1| conserved domain protein [Nitrosococcus oceani AFC27]
          Length = 425

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 106/427 (24%), Positives = 188/427 (44%), Gaps = 15/427 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG++A S+ +   ++NIAN  T G+KR+   F+ +   S+     + V  G+ +
Sbjct: 2   AFNTSLSGLNAASSDLDITANNIANASTTGFKRSRGEFADIFAVSSFGRSQTAVGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--RDNVNCLTRAGDFHINNEGFLENVA 120
           +      EQG+L  T ++ DLAI G+G F +      +    +RAG F ++ EG++ N +
Sbjct: 62  NKTAQQFEQGNLDFTQNSLDLAISGRGLFALSPSLNSDDLVYSRAGAFSVDKEGYVVNSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P   A+      S      + +  +  +   T+   I  NL  +A  + P   
Sbjct: 122 GQYLRTFPTN-ANGTATAASLSNSHPLRLPTSAGTPQATSQVSIGANLPSDAAALDPAS- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS-----TNNSF 235
                  + YT  +S   YD+LG+S +  +Y+ K  +   + +++             + 
Sbjct: 180 -LDLLDASTYTASTSETVYDSLGNSHISTLYFLKDTNGINQWAVYHSLDGTLANINGGTA 238

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI--SKTTQLAGGFIP 293
                   T+      +                N    D  + +D   + TTQ+A  F  
Sbjct: 239 GAGGIQYGTLNFDATGILTGSVPDPLITDPLALNNGANDIAMRLDFAANNTTQVASPFNV 298

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                +G   G+     +S  G +   Y +G    + ++A+A  P+E  L+    N +  
Sbjct: 299 AVLNQDGFTSGRLTGLDISNTGIIQANYSNGQNSTLGKIALAQFPNEQGLRQLGNNAWAE 358

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T  SG    G  G    G I +GALE++NVD+ +EL  LI AQRN+  N+K  +T S   
Sbjct: 359 TVSSGTALAGEAGVGSFGLIQTGALESSNVDLTAELVHLITAQRNFQANAKAIETASTVT 418

Query: 414 DILISLK 420
           D +I+++
Sbjct: 419 DTIINIR 425


>gi|24051371|gb|AAN42702.1| flagellar hook protein FlgE [Shigella flexneri 2a str. 301]
          Length = 642

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 172/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 242 AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 297

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N  G  L 
Sbjct: 298 TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLLNTQGLQLT 357

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+     P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 358 GYPV--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 413

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 414 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 473

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 474 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 527

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V     +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 528 LVSYQINDDGTVVGNNSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 587

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++  ++L+
Sbjct: 588 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYKSNAQTIKTQDQILNTRVNLR 642


>gi|331672596|ref|ZP_08373385.1| flagellar hook protein FlgE [Escherichia coli TA280]
 gi|331070239|gb|EGI41605.1| flagellar hook protein FlgE [Escherichia coli TA280]
          Length = 401

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|56460252|ref|YP_155533.1| flagellar hook protein FlgE [Idiomarina loihiensis L2TR]
 gi|56179262|gb|AAV81984.1| Flagellar hook protein FlgE [Idiomarina loihiensis L2TR]
          Length = 449

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 102/448 (22%), Positives = 181/448 (40%), Gaps = 33/448 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S K A+SG++A    +   ++NI+NV T G+K++   F+ +   S     N+ V  G+  
Sbjct: 2   SFKIALSGINASQKDLDVTANNISNVKTSGFKQSRAEFADVYATSIFNAGNTKVGDGVLT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           S+      QG+L  T ++ D+AI G GFF             TR+G F +N++ F+ +  
Sbjct: 62  SSVAQQFSQGTLEFTENSLDMAISGNGFFATTDGLGSRDMTYTRSGAFKLNDDKFIVDNQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +   S      +    + I +     +   T   F + N+D   + I     
Sbjct: 122 GNYLQGYQVDRNSGTNSSVALATTQPIRIPDVAGAPQSTDNVFTAFNVDARRSPIDGAAN 181

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P      + Y   +S   YD+LG S     YY K  + +W+V         + +      
Sbjct: 182 PFDPETPSTYQSSTSATVYDSLGESHTLSTYYVKRDNNQWDVYATFDGDEIDMTPTGTAT 241

Query: 241 PLN-----------------------TVEVSFDPVTGYLANSSHKAISFNDNTSGI---- 273
                                       + +FDP +  L+ ++     + +N +      
Sbjct: 242 ASPDASVNGYAGLRVEFLGSGDPDVAAGQNTFDPGSIDLSGNNVDGDPYLNNGADAQTIQ 301

Query: 274 -DQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRL 332
            + Q     +  TQ A  F     + +G   G+  +  + K G +   Y +G    + ++
Sbjct: 302 FNFQDLTGTTTPTQFASDFEVTALDQDGSTVGRLTNVDIDKSGLIAATYSNGDVQYLGQV 361

Query: 333 AIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTEL 392
           AI    +E  L    G  +  + DSG+   G       G I + ALE +NV++  EL +L
Sbjct: 362 AIVRFANEQGLTQIGGTKWRESIDSGEPLSGEANTGTFGGIEASALENSNVNLTKELVDL 421

Query: 393 IEAQRNYAVNSKVFQTGSDFMDILISLK 420
           I AQRN+  NS+  +  +     ++ ++
Sbjct: 422 ITAQRNFQANSRSLEVNNTINQTILQIR 449


>gi|329901230|ref|ZP_08272755.1| Flagellar hook protein flgE [Oxalobacteraceae bacterium IMCC9480]
 gi|327549162|gb|EGF33754.1| Flagellar hook protein flgE [Oxalobacteraceae bacterium IMCC9480]
          Length = 407

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 91/419 (21%), Positives = 165/419 (39%), Gaps = 17/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG++A S  +    +N+AN  TVG+K     F+ +   S +      V  G  +
Sbjct: 2   GFQQGLSGLNAASKSLEVTGNNVANSSTVGFKSAQAQFADVYASSLTGGGASQVGIGTSV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +T      QG++  + +  DLAI G GFF +         +R G F ++  G + N  G 
Sbjct: 62  ATVAQQFTQGNVTASNNPLDLAINGGGFFRL-STGGAITYSRNGQFQLDKNGGIVNSNGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L                       N+        P TT  +   ++ ++   TP  T  
Sbjct: 121 HL------TGFGVSATGVLATGTPSNLVINTADLAPKTTSEVKLLVNLDSRETTPKTTTF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                  Y   +S + +D+LG+S V   Y+ +T        ++        +   ++ P 
Sbjct: 175 SATDPTSYNRSTSVSVFDSLGNSHVLQSYFVRTSPTASTWDVY------GTADGASLTPA 228

Query: 243 NTVEVSFDPVTGYLANSS-HKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
               +SF+   G          +            +  D++ TTQ    F       +G+
Sbjct: 229 LIGSLSFNTDGGLTTAQPFSATLPTTVTPGASALTLKFDLTGTTQFGSTFGLNTQSQDGY 288

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             GK   F+   DG +   Y +G    + ++ ++   + + L+    N +  T  SG   
Sbjct: 289 TSGKLSGFATGADGVITGRYTNGKSATLGQVVLSNFTNPNGLQNLGNNVWSETAASGGPL 348

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G P     G + S A+E +NVD+ +EL  +I AQR Y  N++  +T    +  L++L+
Sbjct: 349 VGTPNSGNLGVLQSSAVEDSNVDLTAELVNMITAQRFYQANAQTIKTQDQVLQTLVNLR 407


>gi|168764488|ref|ZP_02789495.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4501]
 gi|189365520|gb|EDU83936.1| flagellar hook protein FlgE [Escherichia coli O157:H7 str. EC4501]
          Length = 401

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++      N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNQVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQD-------SSDPTGTAEPAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           ++ F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 KLVFNANGVLTSNPTENITTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|218549196|ref|YP_002382987.1| flagellar hook protein FlgE [Escherichia fergusonii ATCC 35469]
 gi|218356737|emb|CAQ89365.1| flagellar hook protein [Escherichia fergusonii ATCC 35469]
          Length = 401

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDIAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A  P  +        I++ +  ++A  TTT  +  NL+ +  + T       N 
Sbjct: 118 GYPA--AGTPPTIQQGANPTNISIPNTLMAAKTTTTAAMQINLNSSDPLPTVKAFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KT D  W+V       + + +           
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTKDNTWQVYTQDSSDAASQATQATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+     +   +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LEFNANGMLVKGETANITTGAINGAVPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQASGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|218689029|ref|YP_002397241.1| flagellar hook protein FlgE [Escherichia coli ED1a]
 gi|218426593|emb|CAR07421.1| flagellar hook protein [Escherichia coli ED1a]
          Length = 401

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 178/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|222032829|emb|CAP75568.1| flagellar hook protein flgE [Escherichia coli LF82]
 gi|312945638|gb|ADR26465.1| flagellar hook protein FlgE [Escherichia coli O83:H1 str. NRG 857C]
          Length = 401

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|285018209|ref|YP_003375920.1| flagellar hook protein flge [Xanthomonas albilineans GPE PC73]
 gi|283473427|emb|CBA15932.1| probable flagellar hook protein flge [Xanthomonas albilineans]
          Length = 407

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 101/418 (24%), Positives = 180/418 (43%), Gaps = 15/418 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
              T++SG+ A +  ++  ++NIANV+T G+K +   F+     S      + V  G+ +
Sbjct: 2   GFNTSLSGIKAANTDLNVTANNIANVNTTGFKSSRAEFADQFTVSGYGLARNAVGSGVRV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T  N DLAI G GFF +   +     +RAG+F  +  G++ N  G 
Sbjct: 62  SNVAQQFSQGNIDPTGRNLDLAISGSGFFTL-SNNGARVYSRAGNFQTDANGYVVNPQGA 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L  +P    +A     +   L  + ++  +    PT+T  +   L  NA   T      
Sbjct: 121 RLQVFP---PTANGNGFAVGTLSDLQLQTTDSPPNPTSTVNLMFTLPGNAQPPTVTTFDP 177

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
           +N      +       YD+LG S +   Y+ KT           Q Q  N          
Sbjct: 178 NNANSYN-SSTGGTTVYDSLGVSHIQTSYFVKTATPN-------QWQVYNYIDGVAAGGA 229

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +T++ S   +    A+      SF  +T      +T++++ +TQ    F  + +  +G+A
Sbjct: 230 STLQFSGSGMLTSPADGKITLGSFTPSTGAGPLNLTLNVTGSTQYGETFALRGASQDGYA 289

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            GK    S+   G +   Y +     + ++A++   +   L     N +  +  SG    
Sbjct: 290 SGKLNSISIDSSGVIFARYSNNADKALGQVAMSNFVNPQGLTSLGDNAWAESSGSGAPRT 349

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G  G +  G + SGALE++ VD+  +L  +I AQRN+  NS++  T       +I+++
Sbjct: 350 GVAGSSDFGSVQSGALESSTVDLTEQLVNMIVAQRNFQANSQMISTQDQVTQTVINIR 407


>gi|293409442|ref|ZP_06653018.1| flgE [Escherichia coli B354]
 gi|291469910|gb|EFF12394.1| flgE [Escherichia coli B354]
          Length = 401

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRMVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|315296707|gb|EFU56002.1| flagellar hook protein FlgE [Escherichia coli MS 16-3]
 gi|320196442|gb|EFW71065.1| Flagellar hook protein FlgE [Escherichia coli WV_060327]
          Length = 401

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNTFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|332088750|gb|EGI93862.1| flagellar hook protein flgE [Shigella boydii 5216-82]
          Length = 401

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLYVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  WEV           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWEVYTQD-------SSDPTDTADRAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSNPTENITTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|304310787|ref|YP_003810385.1| Flagellar basal body FlaE [gamma proteobacterium HdN1]
 gi|301796520|emb|CBL44728.1| Flagellar basal body FlaE [gamma proteobacterium HdN1]
          Length = 447

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 101/449 (22%), Positives = 171/449 (38%), Gaps = 37/449 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY---VSGGLEI 62
           S   A+SG+ A  + +   S+NIANV T G+K++   F  +       S    +  G+ +
Sbjct: 2   SFNIAISGLKAAQSDLEVTSNNIANVATTGFKKSRAEFGDIYATGAFGSTKTAIGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN--VNCLTRAGDFHINNEGFLENVA 120
                   QG++  T +  D  + G+GFF++           TRAG F +N +G + N +
Sbjct: 62  QAVSQQFNQGNMNFTQNTLDFGVSGEGFFVMSPNIGSSERIYTRAGAFGVNADGNVVNSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
             +L  +P+              +     K  + +  P  T  ++  ++  A     D  
Sbjct: 122 DQLLQVFPVNEDGTVTSTALSSTIPL---KLPDAAGTPKATELVTMGVNLPADAAALDPA 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG----DKKWEVSIFRQDQSTNNSFP 236
                    YT  +S   YD+LG + V  +YY +         W++      +       
Sbjct: 179 LFDPRDAKTYTASTSVNVYDSLGKAHVAALYYVRDSTSVVPNTWQMFTMIDGERVALDDG 238

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID---------------- 280
              A             G L   S    +F     G+D                      
Sbjct: 239 GTPAAPLNSARFSFGNDGTLNIGSMVPATFQTLGLGVDAGGNAAVPPAPGPLTGWLNGPD 298

Query: 281 ---------ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYR 331
                     + T Q A  F       +G + G+     V   G V   Y +G  V + +
Sbjct: 299 PLQVIEFDITAGTKQFASPFTLNTLTQDGFSIGRLTGIEVDDSGLVRAAYSNGQTVSVGK 358

Query: 332 LAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTE 391
           +A+A  P+   L      ++  T  SG+   G  G + +G I +GALE +NVD+ +EL  
Sbjct: 359 VALARFPNPQGLSQIGNTSWKETSASGEALAGEAGTSSYGLIRAGALEVSNVDLTTELVG 418

Query: 392 LIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           LI AQRN+  N+K  +T +   + +I+L+
Sbjct: 419 LITAQRNFQANAKSIETTNTVTNAIINLR 447


>gi|82544458|ref|YP_408405.1| flagellar hook protein FlgE [Shigella boydii Sb227]
 gi|81245869|gb|ABB66577.1| hook protein [Shigella boydii Sb227]
 gi|320186977|gb|EFW61690.1| Flagellar hook protein FlgE [Shigella flexneri CDC 796-83]
 gi|332094030|gb|EGI99082.1| flagellar hook protein flgE [Shigella boydii 3594-74]
          Length = 402

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 174/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATPQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|325274800|ref|ZP_08140828.1| flagellar hook protein FlgE [Pseudomonas sp. TJI-51]
 gi|324100068|gb|EGB97886.1| flagellar hook protein FlgE [Pseudomonas sp. TJI-51]
          Length = 440

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 102/445 (22%), Positives = 168/445 (37%), Gaps = 38/445 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY-----VSGGL 60
           S    +SG+ A +  ++   +NIANV T G+K +   F+     S   +      +  G+
Sbjct: 2   SFNIGLSGLYAANKALNVTGNNIANVATTGFKSSRAEFADQYSNSIRGTSAGKSVIGTGV 61

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + +    +   G++  T    D+AI G GFF +   +     TRAG F+ + EG++ N  
Sbjct: 62  KTAAVSQLFTPGNINATGQALDMAIDGNGFFALND-NGSKIYTRAGAFYSDKEGYVVNAG 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +      +       L  + +  + L+  PT+      NL+  AT   P  T
Sbjct: 121 GANLQGYAVGEDGKIIQ----GVLTDLQIDTSNLTPKPTSLITEKINLNSGATA--PSVT 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQDQSTNNSFPYNV 239
           P      + Y    +   YD+ G+    + Y+ K      W +      ++  N      
Sbjct: 175 PFDPTNASSYNFTFNTPVYDSQGNEHQMNQYFIKDDVTNTWSMHTTIDGRNPANPASTTP 234

Query: 240 APLNTVEVS-------------------------FDPVTGYLANSSHKAISFNDNTSGID 274
                   S                         F       A  +       +      
Sbjct: 235 LVNAVPFKSDGTLDKDAMAAGDVVGGLSIGEDKIFQLNDWIPAQKNAAGEWSANGAVANA 294

Query: 275 QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
             + +D+   TQ            +G A G+    S+ ++GY+   + +G    I ++AI
Sbjct: 295 DGVKLDMLGATQYNASSAEIAKTQDGFATGELSGLSIDQNGYLFASFTNGKDKVIGQVAI 354

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A   +   L    G  +  +  SG   IG P     G+I  GALE +NVD+  EL  LI+
Sbjct: 355 ANFANLQGLTPIGGTNWKESYASGVPVIGAPDTGTLGQITGGALEDSNVDLTGELVNLIK 414

Query: 395 AQRNYAVNSKVFQTGSDFMDILISL 419
           AQ NY  N+K   T S  M  +I +
Sbjct: 415 AQSNYQANAKTISTESTIMQTIIQM 439


>gi|300114799|ref|YP_003761374.1| fagellar hook-basal body protein [Nitrosococcus watsonii C-113]
 gi|299540736|gb|ADJ29053.1| fagellar hook-basal body protein [Nitrosococcus watsonii C-113]
          Length = 425

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 108/427 (25%), Positives = 187/427 (43%), Gaps = 15/427 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN---SYVSGGLEI 62
           +  T++SG++A S+ +   + NIAN  T G+KR+   F+ +   S+     + V  G+ +
Sbjct: 2   AFNTSLSGLNAASSDLDVTAHNIANASTTGFKRSRSEFADIFAVSSFGRSQTAVGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--RDNVNCLTRAGDFHINNEGFLENVA 120
           +      EQG+L  T ++ DLAI G+G F +     D     +RAG F ++ EG++ N +
Sbjct: 62  NKTAQQFEQGNLDFTQNSLDLAISGQGLFALSPSLNDKDLVYSRAGAFSVDKEGYVVNSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P           S    + + +  +  +   T+   I  NL  +   + P   
Sbjct: 122 GQYLRTFPTNEN-GTATAASLNNSQPLRLPTSAGTPQATSRISIGANLPSDTAALDPVN- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS-----TNNSF 235
                  + YT  +S   YD+LG+S +  +Y+ K  +   + +++             + 
Sbjct: 180 -LDLLDTSTYTASTSETVYDSLGNSHISTLYFLKDTNGTNQWAVYHSLDGTLANINGGTA 238

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI--SKTTQLAGGFIP 293
                   T+                   S   N    D  +T+D   + TTQ+A  F  
Sbjct: 239 GAGGVQYGTLNFDATGALTGSTPDPLATDSIALNNGANDIALTLDFAANNTTQVASPFNV 298

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                +G   G+     +SK G +   Y +G    + ++A+A  P+E  L+    N +  
Sbjct: 299 AALNQDGFTSGRLTGLDISKTGVIQANYSNGQNSTLGKVALAQFPNEQGLRQLGNNAWGE 358

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T  SG    G  G    G I +GALE++NVD+ +EL  LI AQRN+  N+K  +T S   
Sbjct: 359 TVSSGSALAGEAGVGSFGTIQTGALESSNVDLTAELVHLITAQRNFQANAKAIETASTIT 418

Query: 414 DILISLK 420
           D +I+++
Sbjct: 419 DTIINIR 425


>gi|315657509|ref|ZP_07910391.1| flagellar hook protein FlgE [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|315491981|gb|EFU81590.1| flagellar hook protein FlgE [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 484

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 92/486 (18%), Positives = 174/486 (35%), Gaps = 69/486 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ T +SG+      +   S+NIANV+T G+K  +  F                   
Sbjct: 1   MLRSLFTGISGLSVHQTMLDVTSNNIANVNTTGFKSASTRFEDTFSQLVRSGAAPRLNER 60

Query: 50  -STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
              + + V  G+++ +       G+   T  N D  I G GF++++  +  +  TR G F
Sbjct: 61  GGMNPAQVGLGVKLQSITQNFTGGAAQMTGRNLDTMINGDGFYVLRKTNGSSVYTRNGSF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            ++ +G +    G  + G+            +   +         +   PTT      N+
Sbjct: 121 GLDAQGQVVAADGSFVQGWMGDKDGTINASGTPGNITLP--LTKTVEGRPTTKVIYGGNI 178

Query: 169 DKNATIITPDK----------------TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY 212
             +   + P                       G   +     +   +   GS  ++++  
Sbjct: 179 PADQIYMDPTGSKTSPDNAFQRSQIVHAYDDKGNPHDVLLTFARNDFANPGSEPMWELRA 238

Query: 213 TKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG 272
                 K      R+  +T+      +   +   VS        A+              
Sbjct: 239 YDANVFKELDETQREKLTTDGGARIALEVEDGGSVSIGGSKVKPADGDGVLNFKFKTDGT 298

Query: 273 ID-------------------------------------QQITIDISKTTQLAGGFIPQK 295
           +D                                     Q I +D+S  T   G     +
Sbjct: 299 LDEDSLKAMKTVKFKLDQVNVKETAVPKVSEILQPNVTKQPINLDLSALTGFGGVNNFGQ 358

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
            +++G+  G    +SV  DG +   + +G    + R+A+A+  +   L+    + ++ T 
Sbjct: 359 KQVDGNMAGYMTGYSVEADGTIRGTFSNGDNRALARIAVASFANPLGLEKAGSSYFVETG 418

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           +SG   IG  G  Q G +  GA+E +NVD+A+E T LI +QR +  NS+V  T  + +  
Sbjct: 419 NSGQPQIGEAGTGQRGAMTGGAIEMSNVDLAAEFTNLILSQRGFQANSRVITTSDEILQE 478

Query: 416 LISLKR 421
           L+++KR
Sbjct: 479 LVNMKR 484


>gi|148554189|ref|YP_001261771.1| flagellar basal body FlaE domain-containing protein [Sphingomonas
           wittichii RW1]
 gi|148499379|gb|ABQ67633.1| flagellar basal body FlaE domain protein [Sphingomonas wittichii
           RW1]
          Length = 435

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 102/434 (23%), Positives = 171/434 (39%), Gaps = 20/434 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS--TSNSYVSGGLEIS 63
           S  TA+SG+ A    ++ +S+NIANV T G+KR+   F  LV  S   S+     G  + 
Sbjct: 2   SFYTALSGLKASQTDLAVISNNIANVGTTGFKRSGTEFGDLVSSSPMQSSGIAGQGTRLR 61

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVK--GRDNVNCLTRAGDFHINNEGFLENVAG 121
                  QG L  +  + DLAI G+GFF+ +    +     TR G F ++   FL + +G
Sbjct: 62  GIAQQFTQGGLESSERSLDLAISGQGFFVTRASNSNGQVSYTRNGAFSVDANRFLVDSSG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII------ 175
             L   P       +          I +     ++  T T  +S        +       
Sbjct: 122 AYLQALPTD-TKGNVTATGLSSARSIQLPLTSGTSKATQTIDLSVTFPSAGDVPSTRAIY 180

Query: 176 -TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-------DKKWEVSIFRQ 227
            T +           Y   ++   YD  G++     YY +         D  W    F  
Sbjct: 181 STTNPYKFDRTDPNSYNQSTTTTVYDAAGNAFPMTTYYIRENLPGGSVTDTNWTAHTFIG 240

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT-Q 286
           D   +        P                + +          +    + T++ S +T  
Sbjct: 241 DTEISYDSSAATQPAPLTLTFDSTGAKTAPSGAINLGPLTPAGASAPLEFTLNYSGSTKM 300

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
            A  F     + +G+A G+  + SV  DG +   + +G    + ++ +A   + + L+  
Sbjct: 301 SASPFTLTSFDQDGYAAGQLDNVSVGADGLIVATFSNGDSQALGKIILANFSNPEGLRQL 360

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
             + +  T  SG+  IG    N  G+I SGALE ANVDI  EL  LI+AQRN++ N+K  
Sbjct: 361 GDSKWGATGLSGEPIIGEASSNGTGQIQSGALEQANVDITEELVALIQAQRNFSANAKTI 420

Query: 407 QTGSDFMDILISLK 420
           +  +     +++L+
Sbjct: 421 EAANTMTQTIVNLR 434


>gi|331662482|ref|ZP_08363405.1| flagellar hook protein FlgE [Escherichia coli TA143]
 gi|284920899|emb|CBG33962.1| flagellar hook protein FlgE [Escherichia coli 042]
 gi|331060904|gb|EGI32868.1| flagellar hook protein FlgE [Escherichia coli TA143]
          Length = 402

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 174/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKATTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|242238969|ref|YP_002987150.1| flagellar hook protein FlgE [Dickeya dadantii Ech703]
 gi|242131026|gb|ACS85328.1| flagellar basal body FlaE domain protein [Dickeya dadantii Ech703]
          Length = 399

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 107/415 (25%), Positives = 185/415 (44%), Gaps = 17/415 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NIAN +T G+K  +++F+ +   S     V  G+++++ 
Sbjct: 2   GFSQAVSGLNAASSNLDVIGNNIANSETTGFKSASVSFADIYADSA----VGLGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G++  T   TD+AI   GFF V         TR G+F ++++  L    G  + 
Sbjct: 58  TQNFTDGTVESTDVGTDVAISKTGFFRVTDDSGSVYYTRNGEFTLDSDRNLVTKTGYYVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY       P  + S      +N+  + ++A  T+T   S NLD     IT   T     
Sbjct: 118 GYAA--TGTPPSIASGSQPTVLNISSSGMAASATSTASFSANLDSGEDAIT---TTFDAT 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
             + Y    S   YD+LG+    ++Y+TKT D  WEV       S+  +        +T 
Sbjct: 173 DSSTYNWTQSLTTYDSLGNVHTVNLYFTKTADNTWEVHALDSSDSSATAQDLGAISFSTS 232

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
                   G +  ++   IS N          +ID + TTQ            +G+  G 
Sbjct: 233 --------GQITGTTSFNISTNSLNGSAANTFSIDFTGTTQQNSDSSVNTKSQDGYTAGS 284

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              ++++ DG +   Y +     + ++ +A+  +   L     N +  T  SG   +G  
Sbjct: 285 LTSYTINDDGTITGTYSNSQTQLLGQIVLASFSNPQGLSSQGDNVWSETSASGQALLGTA 344

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + SGALE++NVDI+ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 345 GTGVFGTLTSGALESSNVDISQELVNMIVAQRNYQSNAQTIKTQDAILNTLVNLR 399


>gi|238751762|ref|ZP_04613250.1| Flagellar hook protein FlgE [Yersinia rohdei ATCC 43380]
 gi|238710033|gb|EEQ02263.1| Flagellar hook protein FlgE [Yersinia rohdei ATCC 43380]
          Length = 430

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 93/436 (21%), Positives = 173/436 (39%), Gaps = 28/436 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NIAN  T G+K ++++F+ +       S    G++++  
Sbjct: 2   GFSQAVSGLNAASSNLDVIGNNIANSATSGFKSSSVSFADMFA----GSQAGMGVQVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T    D+AI   GFF ++         R G F ++    + N+ G  L 
Sbjct: 58  TQDFNDGTATTTNRRLDIAISQSGFFRMQDSTGGIYYARNGQFKLDENRNIINMQGLSLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        +++    +SA  T +G +  NL     +I P        
Sbjct: 118 GYPA--TGTPPTVKQGANPIALSIPQDIISAKATDSGKMVVNLTSTHKVI-PATPAFDPE 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y+  ++   YD+LG+S V +V+Y KT +     + ++     +++   +       
Sbjct: 175 KPDTYSFVNNLTTYDSLGNSHVINVFYVKTAEDAVNGNSWQVYTKDSSATLADKTKPFDP 234

Query: 246 E---------------------VSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKT 284
                                 V+         + +        N S             
Sbjct: 235 TDPAAASLRGTMVFDTNGALKSVANGTNPASTTDLTMAIPMGVVNGSPAQSFKLDVTGSK 294

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
            Q  G          G+A G+   F +  DG +   Y +     + ++ +    + + L 
Sbjct: 295 QQNTGTDSVVAQSQTGYAAGEFTGFQIGTDGALVGTYSNQQTQLLGQIVMVNFANPEGLS 354

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
               N +  T+ SG   +G  G    G + SGALE++NVD+++EL  +I AQRNY  N++
Sbjct: 355 SAGDNVWKETQTSGSPILGIAGSGGFGTLTSGALESSNVDLSAELVNMIVAQRNYQSNAQ 414

Query: 405 VFQTGSDFMDILISLK 420
             +T    +  L++L+
Sbjct: 415 TIKTQDQILQTLVNLR 430


>gi|218700421|ref|YP_002408050.1| flagellar hook protein FlgE [Escherichia coli IAI39]
 gi|218370407|emb|CAR18214.1| flagellar hook protein [Escherichia coli IAI39]
          Length = 400

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 177/415 (42%), Gaps = 16/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  + +       N 
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPSVKAFDASNA 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V        T  + P         
Sbjct: 176 D--SYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWDVYTLDSSDPTGTANPATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      ++ +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSDPTKDITTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     +  + +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLG-IVLANFANNEGLASEGDNVWSATQSSGVALLGTA 345

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 346 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 400


>gi|150395503|ref|YP_001325970.1| flagellar hook protein FlgE [Sinorhizobium medicae WSM419]
 gi|150027018|gb|ABR59135.1| flagellar basal body FlaE domain protein [Sinorhizobium medicae
           WSM419]
          Length = 402

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 166/422 (39%), Positives = 233/422 (55%), Gaps = 21/422 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + +Y SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGAYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +   +  IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N A
Sbjct: 61  QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P +V +   GL R+N+    L A  +TTG +  NL   A +     
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASKGLIAAGSTTGSMGANLPSGAAVGDIST 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T                  YD+ G++ + D  Y KT    W V +         +    +
Sbjct: 181 TS--------------LVVYDSQGNTRILDFNYEKTAANAWSVEVVD------RTSSTVL 220

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
                   +   +T   A  +  A++    T      +TID++KTTQL   F      I+
Sbjct: 221 GTQTLNFNADGSLTATPATLTTSAMASLPGTGANLSALTIDLTKTTQLGYAFNADGGSID 280

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP K   + +  DG V + Y++G   P YR+A+A V S D LK   GN Y    DSG 
Sbjct: 281 GNAPSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLKPESGNVYSQGVDSGV 340

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L++L
Sbjct: 341 IITGFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVLVNL 400

Query: 420 KR 421
           KR
Sbjct: 401 KR 402


>gi|146311246|ref|YP_001176320.1| flagellar hook protein FlgE [Enterobacter sp. 638]
 gi|145318122|gb|ABP60269.1| flagellar basal body FlaE domain protein [Enterobacter sp. 638]
          Length = 404

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 87/415 (20%), Positives = 169/415 (40%), Gaps = 12/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S +  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKIGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    + N+ G  L 
Sbjct: 58  TQDFNDGTTTNTGRGLDVAISQNGFFRMVDANGSVFYSRNGQFKLDENRNIVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P  + +    + I + +  ++A  TTT     NL+      +         
Sbjct: 118 GYPV--AGTPPTIQTGANPQAITIPNTLMAAKSTTTASQQINLNSTDAAPSKAFNVADTS 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +++Y K           +      ++           
Sbjct: 176 DPDSYNKKGTVTVYDSQGNAHNMNLFYVKDTAANSWKVYSQDASVPGSAATLATT----- 230

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            ++F       A       +     +          +   Q  G      +  NG+ PG 
Sbjct: 231 -LTFSASGVLTAGGQVNVTTGTIPGATPATFALSFANSMQQNTGANNIVATNQNGYKPGD 289

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ +G V   Y +     + ++ +A   + + LK    N +  T+ SG   +G  
Sbjct: 290 LVSYQINDNGTVVGNYSNEQNQVLGQIVLANFANNEGLKSEGDNVWTATQSSGVALLGTA 349

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 350 GTGNFGSLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 404


>gi|91210228|ref|YP_540214.1| flagellar hook protein FlgE [Escherichia coli UTI89]
 gi|117623262|ref|YP_852175.1| flagellar hook protein FlgE [Escherichia coli APEC O1]
 gi|215486285|ref|YP_002328716.1| flagellar hook protein FlgE [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218557958|ref|YP_002390871.1| flagellar hook protein FlgE [Escherichia coli S88]
 gi|237706938|ref|ZP_04537419.1| flagellar hook protein FlgE [Escherichia sp. 3_2_53FAA]
 gi|312968850|ref|ZP_07783057.1| flagellar hook protein flgE [Escherichia coli 2362-75]
 gi|91071802|gb|ABE06683.1| flagellar biosynthesis, hook protein [Escherichia coli UTI89]
 gi|115512386|gb|ABJ00461.1| flagellar biosynthesis, hook protein FlgE [Escherichia coli APEC
           O1]
 gi|215264357|emb|CAS08714.1| flagellar hook protein [Escherichia coli O127:H6 str. E2348/69]
 gi|218364727|emb|CAR02417.1| flagellar hook protein [Escherichia coli S88]
 gi|226898148|gb|EEH84407.1| flagellar hook protein FlgE [Escherichia sp. 3_2_53FAA]
 gi|294491293|gb|ADE90049.1| flagellar hook protein FlgE [Escherichia coli IHE3034]
 gi|307627454|gb|ADN71758.1| flagellar hook protein FlgE [Escherichia coli UM146]
 gi|312286252|gb|EFR14165.1| flagellar hook protein flgE [Escherichia coli 2362-75]
 gi|315287369|gb|EFU46780.1| flagellar hook protein FlgE [Escherichia coli MS 110-3]
 gi|323953238|gb|EGB49104.1| fagellar hook-basal body protein [Escherichia coli H252]
 gi|323957900|gb|EGB53612.1| fagellar hook-basal body protein [Escherichia coli H263]
          Length = 401

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 177/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|325289233|ref|YP_004265414.1| fagellar hook-basal body protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964634|gb|ADY55413.1| fagellar hook-basal body protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 447

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 101/451 (22%), Positives = 190/451 (42%), Gaps = 36/451 (7%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ ++ +A+SG+ A   ++  + +NIANV+TV YK + + FS ++  + S++        
Sbjct: 1   MMRALFSAVSGLQAHQKKMDVIGNNIANVNTVAYKASRVTFSDILSQTLSSATGADSTSG 60

Query: 55  -------YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAG 106
                   +  G+ I + D +   GS   T ++TDL+I G GFFIVK         TRAG
Sbjct: 61  RGGSNAKQIGLGVGIGSIDTLMTAGSTESTGNSTDLSIDGDGFFIVKNGSTGTYMFTRAG 120

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLER---------INVKHAELSAM 157
           +F I++ G L    G  + G+     +           E           N     L A 
Sbjct: 121 NFSIDDSGNLVTSDGLNVYGWLNYTVNTDGTYTFDTDSEVEAINLYSDEDNGNKQILKAQ 180

Query: 158 PTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--- 214
            T    +S NLD   + +    +   +       + ++   YD+LG+     V +TK   
Sbjct: 181 ATANVSLSGNLDAGESAVGSGLSDIGSSDPEA-QYTTTMTVYDSLGNEHELTVSFTKCYV 239

Query: 215 ----TGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT 270
               T            D         +                  + ++   ++ +  +
Sbjct: 240 DASGTDPVTTWYYSVAADSGDAALTDASGYLQFDSNGKLVTDDSSYSPTATMTVTPSSAS 299

Query: 271 SGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIY 330
              + +I +D S  +  A     +   ++G+  G  +D S+  +G +  +Y +G   P+ 
Sbjct: 300 GAGEYEIELDFSNLSTSADDGSVETKGVDGYPSGTLEDISIDSNGIILGVYSNGIEQPLG 359

Query: 331 RLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELT 390
            +A+A   +   L     N Y+ T +SG+ + G      +G + SG LE +NVD+++E +
Sbjct: 360 MIALARFANPSGLLKTGSNYYVATANSGEFTNGV---MANGALSSGTLEMSNVDLSTEFS 416

Query: 391 ELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           ++I  QR Y  NS++  T  + ++ +I +KR
Sbjct: 417 QMITTQRGYQANSRMITTADEMLETIIEMKR 447


>gi|82777309|ref|YP_403658.1| flagellar hook protein FlgE [Shigella dysenteriae Sd197]
 gi|309788143|ref|ZP_07682749.1| flagellar hook protein flgE [Shigella dysenteriae 1617]
 gi|81241457|gb|ABB62167.1| hook protein [Shigella dysenteriae Sd197]
 gi|308923995|gb|EFP69496.1| flagellar hook protein flgE [Shigella dysenteriae 1617]
          Length = 402

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 173/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKAATTLKFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +          +   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFPNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|16129039|ref|NP_415594.1| flagellar hook protein [Escherichia coli str. K-12 substr. MG1655]
 gi|89107922|ref|AP_001702.1| flagellar hook protein [Escherichia coli str. K-12 substr. W3110]
 gi|170080727|ref|YP_001730047.1| flagellar hook protein [Escherichia coli str. K-12 substr. DH10B]
 gi|188492271|ref|ZP_02999541.1| flagellar hook protein FlgE [Escherichia coli 53638]
 gi|238900330|ref|YP_002926126.1| flagellar hook protein [Escherichia coli BW2952]
 gi|256023226|ref|ZP_05437091.1| flagellar hook protein FlgE [Escherichia sp. 4_1_40B]
 gi|300950171|ref|ZP_07164116.1| flagellar hook protein FlgE [Escherichia coli MS 116-1]
 gi|300954384|ref|ZP_07166838.1| flagellar hook protein FlgE [Escherichia coli MS 175-1]
 gi|301029709|ref|ZP_07192763.1| flagellar hook protein FlgE [Escherichia coli MS 196-1]
 gi|301644988|ref|ZP_07244954.1| flagellar hook protein FlgE [Escherichia coli MS 146-1]
 gi|307137711|ref|ZP_07497067.1| flagellar hook protein FlgE [Escherichia coli H736]
 gi|331641620|ref|ZP_08342755.1| flagellar hook protein FlgE [Escherichia coli H736]
 gi|2494529|sp|P75937|FLGE_ECOLI RecName: Full=Flagellar hook protein flgE
 gi|1787316|gb|AAC74160.1| flagellar hook protein [Escherichia coli str. K-12 substr. MG1655]
 gi|85674830|dbj|BAA35885.2| flagellar hook protein [Escherichia coli str. K12 substr. W3110]
 gi|169888562|gb|ACB02269.1| flagellar hook protein [Escherichia coli str. K-12 substr. DH10B]
 gi|188487470|gb|EDU62573.1| flagellar hook protein FlgE [Escherichia coli 53638]
 gi|238861108|gb|ACR63106.1| flagellar hook protein [Escherichia coli BW2952]
 gi|260449784|gb|ACX40206.1| flagellar basal body FlaE domain protein [Escherichia coli DH1]
 gi|299877397|gb|EFI85608.1| flagellar hook protein FlgE [Escherichia coli MS 196-1]
 gi|300318620|gb|EFJ68404.1| flagellar hook protein FlgE [Escherichia coli MS 175-1]
 gi|300450518|gb|EFK14138.1| flagellar hook protein FlgE [Escherichia coli MS 116-1]
 gi|301076717|gb|EFK91523.1| flagellar hook protein FlgE [Escherichia coli MS 146-1]
 gi|309701348|emb|CBJ00649.1| flagellar hook protein FlgE [Escherichia coli ETEC H10407]
 gi|315135708|dbj|BAJ42867.1| flagellar hook protein FlgE [Escherichia coli DH1]
 gi|315618246|gb|EFU98836.1| flagellar hook protein flgE [Escherichia coli 3431]
 gi|323937816|gb|EGB34080.1| fagellar hook-basal body protein [Escherichia coli E1520]
 gi|323942545|gb|EGB38712.1| fagellar hook-basal body protein [Escherichia coli E482]
 gi|331038418|gb|EGI10638.1| flagellar hook protein FlgE [Escherichia coli H736]
 gi|332342622|gb|AEE55956.1| flagellar hook protein FlgE [Escherichia coli UMNK88]
          Length = 402

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 174/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|306814075|ref|ZP_07448248.1| flagellar hook protein FlgE [Escherichia coli NC101]
 gi|305852712|gb|EFM53160.1| flagellar hook protein FlgE [Escherichia coli NC101]
          Length = 401

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 175/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++  +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNVAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNTFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|293395583|ref|ZP_06639866.1| flagellar hook protein FlgE [Serratia odorifera DSM 4582]
 gi|291421902|gb|EFE95148.1| flagellar hook protein FlgE [Serratia odorifera DSM 4582]
          Length = 411

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 100/418 (23%), Positives = 181/418 (43%), Gaps = 11/418 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K  +++F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATAGFKSGSVSFADMFA----GSQVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T    D+AI   GFF ++  D     +R G F ++    L N+ G  L 
Sbjct: 58  TQNFNGGTTTSTNRALDVAITENGFFRMQDSDGGIFYSRNGQFKLDENRNLVNMQGLNLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   A  P  +        +++    ++A  TT+G +  NL    ++  P        
Sbjct: 118 GYPA--AGTPPTIQQGADPVPLSIPEGMMNAKSTTSGSMVANLKSTHSV--PANGTFDPN 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y + ++   YD+LG++   + Y+ KT D KW+V       +   +        N  
Sbjct: 174 KSDSYNYVNTITTYDSLGNAHNVNAYFVKTADNKWDVYTQDGSVTGAPAAKAGSLNFNAS 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS---KTTQLAGGFIPQKSEINGHA 302
               + +      ++   ++   +           +S      Q  G     K   NG+ 
Sbjct: 234 GALTETLDASGVATADFNLTIPMSAKDGAPAQNFTLSFAGSMQQNVGSDSVSKVAQNGYT 293

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+  +F + KDG V  IY +  +  + ++ +A   + + L     N +  T  SG   +
Sbjct: 294 AGEYNNFQIEKDGTVVGIYSNQQKQVLGQIVLANFSNPEGLASKGDNVWQETGASGQPRV 353

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G  G    G + SGALE +NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 354 GTAGGGGFGNLTSGALEASNVDLSQELVNMIVAQRNYQSNAQTIKTQDSILQTLVSLR 411


>gi|254473478|ref|ZP_05086875.1| flagellar hook protein FlgE [Pseudovibrio sp. JE062]
 gi|211957594|gb|EEA92797.1| flagellar hook protein FlgE [Pseudovibrio sp. JE062]
          Length = 397

 Score =  243 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 132/420 (31%), Positives = 205/420 (48%), Gaps = 23/420 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G M T++SGM+AQSN++S V+DNI+N +TVGYKR   AFSSLV    ++ + SG +
Sbjct: 1   MGLYGIMNTSVSGMNAQSNKLSTVADNISNANTVGYKRYKTAFSSLVGSGGTSGHESGIV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
             +    + +QG+   T+  TDLAI GKGFF V+        TRAGDF ++  G + N  
Sbjct: 61  NTTVVQTVRQQGAFNFTSRGTDLAINGKGFFQVQDSQGSTYYTRAGDFVLDKNGQMVNSG 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL                 G   + V         ++ G +  NL  +  + T   +
Sbjct: 121 GYKLL---------------SAGGAPVTVDLNTPVWQASSEGELGVNLASSTPVRTGAPS 165

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
              N     + +K+S +AYD  G+ V  D+ Y+K G      ++                
Sbjct: 166 YPGN-----FDYKTSVSAYDQNGNVVKIDLVYSKIGQNMTGSTVDDSTWKVQAYNQDTPP 220

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
                        G L   S   ++F        + +T+D+SKT      F   K +++G
Sbjct: 221 VELANVDLVFDGDGTLQTGSPDELAFTVPNG---ETLTLDLSKTVTAGDKFSVNKVDVDG 277

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           + P   K   +  DG V  +Y+      + ++ I    + D L+   GN Y  T  SGD 
Sbjct: 278 YGPSTIKTIRIEADGRVFGVYEGSAEKLLDQIQIVNFSNPDGLQAKSGNVYAATDASGDP 337

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ++GFPG N  G ++SGA+E +NVD+A+ELTE+++AQR Y+ N+KVF   S+ +  L +L+
Sbjct: 338 AVGFPGDNGFGSLYSGAVEGSNVDLAAELTEMVQAQRTYSANTKVFNASSELLQELNNLR 397


>gi|307310146|ref|ZP_07589796.1| fagellar hook-basal body protein [Escherichia coli W]
 gi|306909864|gb|EFN40358.1| fagellar hook-basal body protein [Escherichia coli W]
 gi|315060354|gb|ADT74681.1| flagellar hook protein [Escherichia coli W]
 gi|320200972|gb|EFW75556.1| Flagellar hook protein FlgE [Escherichia coli EC4100B]
 gi|323379085|gb|ADX51353.1| fagellar hook-basal body protein [Escherichia coli KO11]
          Length = 402

 Score =  243 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 174/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|307318929|ref|ZP_07598360.1| fagellar hook-basal body protein [Sinorhizobium meliloti AK83]
 gi|306895343|gb|EFN26098.1| fagellar hook-basal body protein [Sinorhizobium meliloti AK83]
          Length = 402

 Score =  243 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 166/422 (39%), Positives = 233/422 (55%), Gaps = 21/422 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + SY SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +   +  IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N A
Sbjct: 61  QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P +V +   GL R+N+    L A  +T G +  NL   A +     
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASDGLIATGSTKGSMGANLPSGAAVGDVST 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T                  YD+ G++ + D  Y KTG   W V +         +    +
Sbjct: 181 TS--------------LVVYDSQGNTRILDFNYEKTGANAWSVEVVD------RTSSTVL 220

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
                   +   +T   A  +  A++    T      +TID++KTTQL   F      I+
Sbjct: 221 GTQTLNFNADGSLTATPATLTTSAMTALPGTGANLSALTIDLTKTTQLGYAFNADGGNID 280

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP K   + +  DG V + Y++G   P YR+A+A V S D L+   GN Y    DSG 
Sbjct: 281 GNAPSKVAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLRPESGNVYSQGVDSGV 340

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L++L
Sbjct: 341 IITGFAGSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVLVNL 400

Query: 420 KR 421
           KR
Sbjct: 401 KR 402


>gi|22126390|ref|NP_669813.1| flagellar hook protein FlgE [Yersinia pestis KIM 10]
 gi|45441409|ref|NP_992948.1| flagellar hook protein FlgE [Yersinia pestis biovar Microtus str.
           91001]
 gi|51596011|ref|YP_070202.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis IP 32953]
 gi|108807173|ref|YP_651089.1| flagellar hook protein FlgE [Yersinia pestis Antiqua]
 gi|108812483|ref|YP_648250.1| flagellar hook protein FlgE [Yersinia pestis Nepal516]
 gi|145598610|ref|YP_001162686.1| flagellar hook protein FlgE [Yersinia pestis Pestoides F]
 gi|149366251|ref|ZP_01888286.1| flagellar hook protein FlgE [Yersinia pestis CA88-4125]
 gi|153950658|ref|YP_001401290.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis IP 31758]
 gi|162421636|ref|YP_001606473.1| flagellar hook protein FlgE [Yersinia pestis Angola]
 gi|165925992|ref|ZP_02221824.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938693|ref|ZP_02227248.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010935|ref|ZP_02231833.1| flagellar hook protein FlgE [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210871|ref|ZP_02236906.1| flagellar hook protein FlgE [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401045|ref|ZP_02306548.1| flagellar hook protein FlgE [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420383|ref|ZP_02312136.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425748|ref|ZP_02317501.1| flagellar hook protein FlgE [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|170024647|ref|YP_001721152.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis YPIII]
 gi|186895114|ref|YP_001872226.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis PB1/+]
 gi|218928922|ref|YP_002346797.1| flagellar hook protein FlgE [Yersinia pestis CO92]
 gi|229896242|ref|ZP_04511412.1| flagellar hook protein FlgE [Yersinia pestis Pestoides A]
 gi|229897177|ref|ZP_04512333.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229897903|ref|ZP_04513054.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229902865|ref|ZP_04517982.1| flagellar hook protein FlgE [Yersinia pestis Nepal516]
 gi|270486645|ref|ZP_06203719.1| flagellar hook protein FlgE [Yersinia pestis KIM D27]
 gi|294504030|ref|YP_003568092.1| flagellar hook protein [Yersinia pestis Z176003]
 gi|21959376|gb|AAM86064.1|AE013853_12 hook protein [Yersinia pestis KIM 10]
 gi|45436269|gb|AAS61825.1| flagellar hook protein FlgE [Yersinia pestis biovar Microtus str.
           91001]
 gi|51589293|emb|CAH20914.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis IP 32953]
 gi|108776131|gb|ABG18650.1| flagellar hook protein FlgE [Yersinia pestis Nepal516]
 gi|108779086|gb|ABG13144.1| flagellar hook protein FlgE [Yersinia pestis Antiqua]
 gi|115347533|emb|CAL20442.1| flagellar hook protein FlgE [Yersinia pestis CO92]
 gi|145210306|gb|ABP39713.1| flagellar hook protein FlgE [Yersinia pestis Pestoides F]
 gi|149292664|gb|EDM42738.1| flagellar hook protein FlgE [Yersinia pestis CA88-4125]
 gi|152962153|gb|ABS49614.1| flagellar hook protein FlgE [Yersinia pseudotuberculosis IP 31758]
 gi|162354451|gb|ABX88399.1| flagellar hook protein FlgE [Yersinia pestis Angola]
 gi|165913307|gb|EDR31929.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922196|gb|EDR39373.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990279|gb|EDR42580.1| flagellar hook protein FlgE [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166208051|gb|EDR52531.1| flagellar hook protein FlgE [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962078|gb|EDR58099.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049434|gb|EDR60842.1| flagellar hook protein FlgE [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055147|gb|EDR64944.1| flagellar hook protein FlgE [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751181|gb|ACA68699.1| flagellar basal body FlaE domain protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186698140|gb|ACC88769.1| flagellar basal body FlaE domain protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|229680312|gb|EEO76411.1| flagellar hook protein FlgE [Yersinia pestis Nepal516]
 gi|229688944|gb|EEO81009.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229693514|gb|EEO83563.1| flagellar hook protein FlgE [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229701165|gb|EEO89194.1| flagellar hook protein FlgE [Yersinia pestis Pestoides A]
 gi|262361784|gb|ACY58505.1| flagellar hook protein [Yersinia pestis D106004]
 gi|262366080|gb|ACY62637.1| flagellar hook protein [Yersinia pestis D182038]
 gi|270335149|gb|EFA45926.1| flagellar hook protein FlgE [Yersinia pestis KIM D27]
 gi|294354489|gb|ADE64830.1| flagellar hook protein [Yersinia pestis Z176003]
 gi|320015467|gb|ADV99038.1| flagellar hook protein FlgE [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 428

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 94/433 (21%), Positives = 173/433 (39%), Gaps = 24/433 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SGM+A S+ +  + +NIAN  T G+K  +++F+ +       S    G++++  
Sbjct: 2   GFSQAVSGMNAASSNLDVIGNNIANSATSGFKAGSVSFADMFA----GSQTGMGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T    DLAI   GFF ++         R G F ++    + N+ G  L 
Sbjct: 58  TQDFNDGTATTTNRRLDLAISQNGFFRMQDSSGGIYYARNGQFKLDENRNIVNMQGLNLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        +++    +SA  TT+G +  NL     +I    +P    
Sbjct: 118 GYPA--TGTPPTVQQGANPVPLSIPQDMISAKATTSGNMVANLTSTHDVIAEATSPFDPD 175

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y+  ++   +D+LG+    +V+Y K  +   + + +      +++   + A     
Sbjct: 176 NPDTYSFVNNMTTFDSLGNRHEINVFYVKRAEDATDGNTWDVYTRDSSAKVTDPADPTDP 235

Query: 246 ------------------EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
                              V+         + +        N +              Q 
Sbjct: 236 AAAAKRGSMVFDSNGALKNVTNGTNATSTTDFTFTIPMGVVNGAPAQSFALNVAGSKQQN 295

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
            G          G+A G+   F ++ DG V   Y +     + ++ +    + + L    
Sbjct: 296 TGADSIVAQNQTGYAAGEFTGFQINSDGSVVGTYSNQQTQLLGQIVMVNFSNPEGLSSEG 355

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
            N +  T+ SG+ ++G  G    G + SGALE++NVD++ EL  +I AQRNY  N++  +
Sbjct: 356 DNVWKETQSSGNPTLGTAGSGGFGTLTSGALESSNVDLSKELVNMIVAQRNYQSNAQTIK 415

Query: 408 TGSDFMDILISLK 420
           T    +  L+SL+
Sbjct: 416 TQDQILQTLVSLR 428


>gi|157160603|ref|YP_001457921.1| flagellar hook protein FlgE [Escherichia coli HS]
 gi|170020528|ref|YP_001725482.1| flagellar hook protein FlgE [Escherichia coli ATCC 8739]
 gi|312971213|ref|ZP_07785391.1| flagellar hook protein flgE [Escherichia coli 1827-70]
 gi|157066283|gb|ABV05538.1| flagellar hook protein FlgE [Escherichia coli HS]
 gi|169755456|gb|ACA78155.1| flagellar basal body FlaE domain protein [Escherichia coli ATCC
           8739]
 gi|310336415|gb|EFQ01601.1| flagellar hook protein flgE [Escherichia coli 1827-70]
          Length = 402

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 172/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLKFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|258625234|ref|ZP_05720146.1| Flagellar hook protein flgE [Vibrio mimicus VM603]
 gi|258582481|gb|EEW07318.1| Flagellar hook protein flgE [Vibrio mimicus VM603]
          Length = 398

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 106/414 (25%), Positives = 168/414 (40%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S+NIAN  T G+K +   F+++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNKELNTISNNIANASTFGFKGSRTEFAAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    D+AI G GFF+ K        TR+G F+ +   F+    G  L
Sbjct: 57  SQNFDKNGSITGTGRAMDMAINGSGFFVTKDSMGQLLYTRSGVFNTDKNNFITGNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +      L       +  I V  + L A  T       N D +A ++   + P   
Sbjct: 117 QGYSVDTNGELL----SGSVGDIKVSTSSLEAKATNKIDFVANFDASAKVVDQTQYPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG++     Y+TKT D  W+VS+                   +
Sbjct: 173 NNSNSFNSSYTTKVYDSLGNAHNVTQYFTKTADNTWKVSVQVD----------GSKKPVS 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L +                  I I +  +TQ    F    +  NG+  G
Sbjct: 223 TVPVKFKSDGTLESPKGSYKVSFPAAGAEPLNIDISLKGSTQFGAAFGVSTNNANGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   YD+G      ++ +A       L   +   +  +  SG   +G 
Sbjct: 283 ELTGVRVEDNGMVYATYDNGESQRQGQVVLANFADPQGLSKVNDTAWTQSFSSGAPIMGI 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    GE+  G+LE +NVD+ SEL  L+ AQRNY  N+K   TG      L +
Sbjct: 343 PGTGSLGELAPGSLEGSNVDLTSELVSLMTAQRNYQANAKTISTGDKLTQALFN 396


>gi|110641252|ref|YP_668982.1| flagellar hook protein FlgE [Escherichia coli 536]
 gi|191172366|ref|ZP_03033907.1| flagellar hook protein FlgE [Escherichia coli F11]
 gi|300982621|ref|ZP_07176205.1| flagellar hook protein FlgE [Escherichia coli MS 200-1]
 gi|110342844|gb|ABG69081.1| flagellar hook protein FlgE [Escherichia coli 536]
 gi|190907250|gb|EDV66848.1| flagellar hook protein FlgE [Escherichia coli F11]
 gi|300307086|gb|EFJ61606.1| flagellar hook protein FlgE [Escherichia coli MS 200-1]
 gi|324013350|gb|EGB82569.1| flagellar hook protein FlgE [Escherichia coli MS 60-1]
          Length = 401

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 176/415 (42%), Gaps = 15/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++  +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNVAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ + ++  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDSL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATT------ 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 -LVFNANGVLTSNPTANISTGAINGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 401


>gi|296102908|ref|YP_003613054.1| flagellar hook protein FlgE [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057367|gb|ADF62105.1| flagellar hook protein FlgE [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 402

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 176/415 (42%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K  + +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGSASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRMVDANGSVFYSRNGQFKLDENRNLVNMQGMQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P  V +    + IN+    ++A  TTT     NL+   T  T   T     
Sbjct: 118 GYPV--AGTPSTVQTGANPQPINIPTTLMAAKATTTASQQINLNSTDTAPT---TAFDPA 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   +D+ G++   +++Y K         ++ QD S   S           
Sbjct: 173 NPDTYNKKGTVTVFDSQGNAHNMNLFYVKDATPANSWKVYAQDGSVAGSTAS-----LAT 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            ++F+     +   +    +     +          +   Q  G      +  NG  PG 
Sbjct: 228 TLTFNNNGTLIGGGNINLTTATIPGATPATFAMSFANSMQQNTGANNIVGTSQNGFKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + LK    N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQVLGQIVLANFANNEGLKSEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GSGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|88811801|ref|ZP_01127055.1| flagellar hook protein [Nitrococcus mobilis Nb-231]
 gi|88791192|gb|EAR22305.1| flagellar hook protein [Nitrococcus mobilis Nb-231]
          Length = 400

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 94/418 (22%), Positives = 169/418 (40%), Gaps = 22/418 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           S +TA++G++A S  +    +N+AN  T G+K +   F+ +   S   +    +  G+ +
Sbjct: 2   SFETALTGLNAASADLDVTGNNVANSATTGFKSSRAEFADIYALSNVGTAQTSIGQGVRL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG    T +  DLA+ G GFF +   +     +R G F ++ +GF+ +  G 
Sbjct: 62  AAVTQQFTQGQFDFTGNTLDLAVNGTGFFAL-NANGTTAYSRNGAFQLDRDGFIVDADGH 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY   +  A         L  + V    ++   T    +S NLD  A       T  
Sbjct: 121 RLNGYQAGSNGAI-----SGALGDLQVNIGNVAPQATANIGLSANLDARAAT---IPTAF 172

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                A Y   +S   YD  G      +Y+ K  D  W++     D +            
Sbjct: 173 DAADPATYNFSTSTTVYDAQGKDHFATLYFQKQSDNVWDIYADGDDGTGAKDPATVT--- 229

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
                      G   +++       +        I++D S  TQ    F  ++   +G +
Sbjct: 230 -------FDSRGEFVSATGATTYSFNYAGAGTSNISVDYSSLTQYGSVFDVKELSQDGFS 282

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+  +  V  DG +   + +G    + ++A++  PS  +L+      +  T  SG    
Sbjct: 283 TGQFTNLGVEDDGRLLARFTNGQSQTLGQIALSRFPSPQSLQQIGDTHWAETFASGAPVT 342

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             PG +  G I  GALE +NV++  +L  +I AQRN+  NS++  T       +++++
Sbjct: 343 AAPGSSGVGTIQGGALEKSNVNLTEQLVHMITAQRNFQANSQMISTQDQITQSILNIR 400


>gi|331652129|ref|ZP_08353148.1| flagellar hook protein FlgE [Escherichia coli M718]
 gi|331050407|gb|EGI22465.1| flagellar hook protein FlgE [Escherichia coli M718]
          Length = 402

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 172/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKIATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGADPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|261339376|ref|ZP_05967234.1| flagellar hook protein FlgE [Enterobacter cancerogenus ATCC 35316]
 gi|288318177|gb|EFC57115.1| flagellar hook protein FlgE [Enterobacter cancerogenus ATCC 35316]
          Length = 402

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 174/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K  + +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGSASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRMVDANGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P  V +    + I++    ++A  TTT     NL+   T  T         
Sbjct: 118 GYPV--AGTPPTVQTGANPQAISIPTTLMAAKSTTTASQQINLNSTDTAPTKA---FDAT 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   +D+ G++   ++YY K         ++ QD S               
Sbjct: 173 NPDTYNKKGTVTVFDSQGNAHNMNLYYVKDATPANSWKVYAQDGSV-----AGSPVSLAT 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            ++F+         +    +     +          +   Q  G      +  NG+ PG 
Sbjct: 228 TLTFNASGVLTGGDNVNITTATVPGATPATFAMSFANSMQQNTGANNIVATNQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + LK    N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGSVVGNYSNEQTQVLGQIVLANFANNEGLKSEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GSGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|300312833|ref|YP_003776925.1| flagellar hook protein [Herbaspirillum seropedicae SmR1]
 gi|300075618|gb|ADJ65017.1| flagellar hook protein [Herbaspirillum seropedicae SmR1]
          Length = 420

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 94/427 (22%), Positives = 167/427 (39%), Gaps = 20/427 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S +  +SG+   S  +  + +N+AN  TVG+K+  + F+     S   + NS V  G+ +
Sbjct: 2   SFQQGLSGLHGASKHLDVIGNNVANASTVGFKQGQVQFADAYANSMNRSGNSPVGIGVTV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           +       QG++  T +  D+AI G GFF +     D      R G F +N +G+L N  
Sbjct: 62  ANVSQAFTQGNIATTNNALDVAINGDGFFRMAASLTDQSPRYGRNGQFQLNKDGYLINP- 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
                   +  A          G + + +K    +   T T  +S  ++ ++    P  +
Sbjct: 121 -------SMNGAYLTGYPAGTNGGDPVPLKIDTATLPATATTRVSTKVNLDSRKSVPTVS 173

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK------TGDKKWEVSIFRQDQSTNNS 234
           P        Y++ +    YD+LG+      +Y K           W V      ++  N+
Sbjct: 174 PFDPANPNSYSNSTGATVYDSLGNPYSLQTFYVKGAATGTPPSTTWSVYATLDGKTIINA 233

Query: 235 FPYNVAPL-NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
            P     L  T+              S    +     +     I +  + +TQ    F  
Sbjct: 234 PPATGPQLLGTLRFDATGALTASTGMSLNLSTLAKGGATFPGPIALGYAGSTQTGSAFAN 293

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
                +G  PG    FS+ KDG +   Y +     + ++ +    +   L+    N Y  
Sbjct: 294 LAQSQDGMPPGTLSSFSIGKDGSIIGAYSNQQTRVMGQIVLVNFANPHGLQPIGNNLYQA 353

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           +  +G   +G P     G +   A+E +NVD+ +EL  +I AQR Y  NS+  +     +
Sbjct: 354 SEAAGSALVGTPTTGAFGALQGRAVEQSNVDLTAELVNMIVAQRVYQANSQTIKVQDTVL 413

Query: 414 DILISLK 420
             L+SL+
Sbjct: 414 QTLVSLR 420


>gi|229592130|ref|YP_002874249.1| flagellar hook protein FlgE [Pseudomonas fluorescens SBW25]
 gi|229363996|emb|CAY51545.1| putative flagellar hook protein [Pseudomonas fluorescens SBW25]
          Length = 434

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 95/435 (21%), Positives = 176/435 (40%), Gaps = 24/435 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A + ++    +NIANV T G+K +   FS +   S   T  + +  G+ +
Sbjct: 2   SFNIGLSGLYAANKQLDVTGNNIANVATTGFKSSRAEFSDIYAASKLGTGQNSIGNGVNL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG + ++    D+AIQG GFF+ KG D     TR+G F  + +G++ N  G 
Sbjct: 62  AAVSQQFTQGDVNNSGGVLDMAIQGGGFFVQKGSDGSLEYTRSGAFRADKDGYITNNTGT 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
             L     +A   ++     GL  + +  + L    +T    ++NL+ ++ +I       
Sbjct: 122 SRLQGYAADADGNIV---KGGLTDLQLNLSYLPPKASTKVDSTSNLNSSSPVIDQATKLF 178

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                + +T ++S   YD  G+S     Y  K+   +W+       ++ + + P      
Sbjct: 179 DPTDTSTFTTQNSTTLYDAQGNSHEMVQYMVKSNPNEWKAYTLIDGRNLDGTKPTTTGAT 238

Query: 243 NTVEVSFDPV------------------TGYLANSSHKAISFNDNTSGIDQQITIDISKT 284
             V  ++                     T                 +     I +++   
Sbjct: 239 APVPATYTFDGAGKLLGVTGTGVVGTTLTLTGWVPGTVTNGNWAPNNATAPNIAVNLGNV 298

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
           TQ            +G+A G+     +   G +   + +     I ++++A+  +E  L+
Sbjct: 299 TQYNSASYRNPPTTDGYATGQITGLKIDGSGVLFATFSNQQSKAIGQISLASFNNEQGLQ 358

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
              G T+  T  SG      P     G I + +LE +NV++ +EL +LI+AQ NY  N+K
Sbjct: 359 PSGGTTWRETFASGQPGYDTPQAGTLGSIVANSLENSNVNLTNELVDLIKAQSNYQANAK 418

Query: 405 VFQTGSDFMDILISL 419
              T S  M  +I +
Sbjct: 419 TISTQSTIMQTIIQM 433


>gi|258622488|ref|ZP_05717510.1| Flagellar hook protein flgE [Vibrio mimicus VM573]
 gi|262173354|ref|ZP_06041031.1| flagellar hook protein FlgE [Vibrio mimicus MB-451]
 gi|258585188|gb|EEW09915.1| Flagellar hook protein flgE [Vibrio mimicus VM573]
 gi|261890712|gb|EEY36699.1| flagellar hook protein FlgE [Vibrio mimicus MB-451]
          Length = 398

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 106/414 (25%), Positives = 168/414 (40%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S+NIAN  T G+K +   F+++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNKELNTISNNIANASTFGFKGSRTEFAAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    D+AI G GFF+ K        TR+G F+ +   F+    G  L
Sbjct: 57  SQNFDKNGSITGTGRAMDMAINGSGFFVTKDSMGQLLYTRSGVFNTDKNNFITGNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +      L       +  I V  + L A  T       N D +A ++   + P   
Sbjct: 117 QGYSVDTNGELL----SGSVGDIKVSTSSLEAKATNKIDFVANFDASAKVVDQTQYPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG++     Y+TKT D  W+VS+                   +
Sbjct: 173 NNSNSFNSSYTTKVYDSLGNAHNVTQYFTKTADNTWKVSVQVD----------GSKKPVS 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L +                  I I +  +TQ    F    +  NG+  G
Sbjct: 223 TVPVKFKTDGTLESPKGSYKVSFPAAGAEPLNIDISLKGSTQFGAAFGVSTNNANGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   YD+G      ++ +A       L   +   +  +  SG   +G 
Sbjct: 283 ELTGVRVEDNGMVYATYDNGESQRQGQVVLANFADPQGLSKVNDTAWTQSFSSGAPIMGI 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    GE+  G+LE +NVD+ SEL  L+ AQRNY  N+K   TG      L +
Sbjct: 343 PGTGSLGELAPGSLEGSNVDLTSELVSLMTAQRNYQANAKTISTGDKLTQALFN 396


>gi|219670134|ref|YP_002460569.1| hypothetical protein Dhaf_4124 [Desulfitobacterium hafniense DCB-2]
 gi|219540394|gb|ACL22133.1| protein of unknown function DUF1078 domain protein
           [Desulfitobacterium hafniense DCB-2]
          Length = 426

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 99/436 (22%), Positives = 163/436 (37%), Gaps = 28/436 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS------------ 50
           +L S+ +A+SG+     ++  V +NIANV+T G+KR+ + FS+++  +            
Sbjct: 1   MLRSLYSAISGLKNHQIKMDVVGNNIANVNTTGFKRSRVTFSTMLSQTMKGAGSPSANQG 60

Query: 51  -TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+ + V  G  +S+ D I   GS  +T  +TD  I G+GFF+ +         RAG F 
Sbjct: 61  GTNPAQVGLGSMVSSIDQIMTTGSSQNTGKSTDAMINGRGFFVFRN-AGQIVYGRAGAFS 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            +  G+L +   G  +LG         ++      L  +          P     I  NL
Sbjct: 120 QDQNGYLTDPGTGAFVLGQMWGANDREILEWGSAPLTPLRFNIGSYPPEPEGGI-IKINL 178

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
                  +  +        A  T         T G          +       + I   D
Sbjct: 179 GDFVQNGSNYEYVNPALIGASATVPDGGTLDSTTGKITFTKDPADEASGDPPAIEITDID 238

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLA 288
                    +     +V V  +P             SF+  T  I               
Sbjct: 239 YDKLTIPAGDFVQKGSVYVYENPDLVGADLEDITDGSFDPKTGTITLNAAP--------- 289

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT---RVPIYRLAIATVPSEDNLKL 345
                +   ++G    K  + ++  +G +  IY +G       I +LAIA   ++  L+ 
Sbjct: 290 PSAGVEIEGVDGRLRAKLDEVTIDGNGIISGIYSNGKGSASRRIGQLAIANFANDAGLQN 349

Query: 346 FDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKV 405
              N Y  T +SG   IG  G    G I   ++E +NVD++ E T++I  QR +  NS+V
Sbjct: 350 VGNNFYAATNNSGIADIGAAGTAGRGNIIPNSVEMSNVDLSQEFTDMIVTQRGFQANSRV 409

Query: 406 FQTGSDFMDILISLKR 421
                  +  LI LKR
Sbjct: 410 ITVSDSLLQELIDLKR 425


>gi|307131609|ref|YP_003883625.1| flagellar hook protein flgE [Dickeya dadantii 3937]
 gi|306529138|gb|ADM99068.1| Flagellar hook protein flgE [Dickeya dadantii 3937]
          Length = 399

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 101/415 (24%), Positives = 183/415 (44%), Gaps = 17/415 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A SN +  + +NIAN  TVG+K + I+F+ +       S V  G  +++ 
Sbjct: 2   SFSQAVSGLNAASNNLDVIGNNIANSATVGFKASNISFADMYA----GSNVGLGTRVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS+  T+ + D+AI G GF+ +   +     +R G F +++   + N  G  L 
Sbjct: 58  LQDFSNGSITSTSRSLDVAINGNGFYRLLNSNGSVVYSRNGQFTLDSSRNIVNAQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        +++    +SA  T+T  I  +L+ + +  T D T   N 
Sbjct: 118 GYPA--TGTPPAIQQGADPVGLSIPETTMSAKATSTASIIASLNSSDSTNTWDPTDPTN- 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
                 +K S   YD+LG++  + +Y+ K+    W+V           +           
Sbjct: 175 ---TSNYKGSITTYDSLGNAHNFALYFVKSASNSWDVYAQD-------TSITGAGFQGPT 224

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            +SF+        +         N S              Q +G    +    +G+ PG+
Sbjct: 225 TLSFNTSGALTTTTPATISMATLNGSAASTFNLSFTGTVQQNSGSNSTKTPTQDGYEPGE 284

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              +S+S+DG V   Y +     + ++A+A   + + L     N +  T +SG   +G  
Sbjct: 285 LTGYSISEDGSVVGSYSNNKTQLLGQIALANFANPEGLSPQGDNVWAATGNSGQAVVGSA 344

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   A E++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 345 GTGNLGKLVGKATESSNVDMSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 399


>gi|238764392|ref|ZP_04625342.1| Flagellar hook protein FlgE [Yersinia kristensenii ATCC 33638]
 gi|238697418|gb|EEP90185.1| Flagellar hook protein FlgE [Yersinia kristensenii ATCC 33638]
          Length = 437

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 94/442 (21%), Positives = 171/442 (38%), Gaps = 33/442 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NIAN  T G+K  +++F+ +       S    G++++  
Sbjct: 2   GFSQAVSGLNAASSNLDVIGNNIANSATSGFKAGSVSFADMFA----GSQTGMGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T    DLAI   GFF ++         R G F ++    + N+ G  L 
Sbjct: 58  TQDFNDGTTTTTNRRLDLAISQNGFFRMQDSTGGIFYARNGQFKLDENRNIVNMQGLNLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT----- 180
           GYP      P  V        +++    + A  TT+G +  NL     II  + T     
Sbjct: 118 GYPA--TGTPPTVQQGANPVPLSIPQGMIPAKATTSGNMVANLTSTHNIIPAETTSSAGV 175

Query: 181 ---PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPY 237
                   +   Y+  ++   +D+LG+    +V+Y K  +     + +      +++ P 
Sbjct: 176 TTPTFDPDKPDTYSFVNNITTFDSLGNRHEINVFYVKRSEDAVNGNSWDVYTRDSSAVPA 235

Query: 238 -------------------NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT 278
                                 P+ T   +    T      +        N +       
Sbjct: 236 QVAERRGSMRFDTNGALVETTNPVITPPATTPVETPTTVPFTLTIPMGIVNGAPAQDFAL 295

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
                  Q  G          G+A G+   F ++ DG V   Y +     + ++ +    
Sbjct: 296 NVAGSKQQNTGTDSIVTQNQTGYAAGEFTGFQINNDGSVVGTYSNQQTQLLGQIVMVNFA 355

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           + + L     N +  T  SG+  +G  G    G + SGALE++NVD++ EL  +I AQRN
Sbjct: 356 NPEGLSSEGNNVWKETLSSGNAILGTAGSGGFGTLTSGALESSNVDLSKELVNMIVAQRN 415

Query: 399 YAVNSKVFQTGSDFMDILISLK 420
           Y  N++  +T    +  L++L+
Sbjct: 416 YQSNAQTIKTQDQILQTLVNLR 437


>gi|50120639|ref|YP_049806.1| flagellar hook protein FlgE [Pectobacterium atrosepticum SCRI1043]
 gi|49611165|emb|CAG74611.1| flagellar hook protein [Pectobacterium atrosepticum SCRI1043]
          Length = 405

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 187/415 (45%), Gaps = 11/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A SN +  + +NIAN  TVG+K   + F+ +       S V  G+++++ 
Sbjct: 2   GFSQAVSGLNAASNNLDVIGNNIANSATVGFKSGNVTFADMFA----GSKVGMGVKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G++  ++ + D+AI G GF+ ++  +     +R G F +N    + N  G  L 
Sbjct: 58  LQDFGNGTVTSSSRDLDIAISGGGFYRLQDTNGSTYYSRNGQFMLNG-RNIVNAQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+  A  P  V +      + V   ++ A  T+   I  NL  + ++ T        G
Sbjct: 117 GYPV--AGTPPTVQTGADPVPLTVPDGDMLASQTSVASIKANLKSSDSVPTNAWA-TTPG 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            +  Y  K++   YD+ G+   + +Y+ KT +  W+           N   Y  A     
Sbjct: 174 AEGTYNSKTALTTYDSQGNVHNFTLYFVKTANNTWQTYAKDDSI---NPATYQNAGTLNF 230

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
           E +    +      +   ++        +   T++++ + Q    +  +    NG APG 
Sbjct: 231 EANGALSSTGATAHTPFTLNLTGTNGAANGTFTLNLTGSVQQNTEYSYKSPTQNGFAPGS 290

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              F+++ DG ++  Y +G +  + ++ +A+  + + L     N +  T  SG   +G  
Sbjct: 291 LTGFAINDDGTIEGSYSNGQKQALGQILLASFANPEGLSPEGDNAWSETASSGQAVVGLA 350

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   + E++NVD++ EL  +I AQRNY  N++  +T    +  L+SL+
Sbjct: 351 GTGSLGKLIGKSTESSNVDLSKELVSMIVAQRNYQSNAQTIKTQDSILQTLVSLR 405


>gi|127512279|ref|YP_001093476.1| flagellar hook protein FlgE [Shewanella loihica PV-4]
 gi|126637574|gb|ABO23217.1| flagellar basal body FlaE domain protein [Shewanella loihica PV-4]
          Length = 453

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/455 (22%), Positives = 183/455 (40%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+T G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNTTGFKESRAEFADVYASSIFANSKTTVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           +      +QGSL  T++  D+AI G GFF+            TRAG F ++ + +L N A
Sbjct: 62  AQVAQQFQQGSLQFTSNALDMAINGGGFFVTSSEVGSQDLSYTRAGAFKVDADSYLVNSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S   T    I  NL+     + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTTQPVKIPDTAGSPQKTDNIGIQMNLNAGEGTLDPAN- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS----------------- 223
             +      Y + +S   YD+LG   +   Y+ +  +  +  +                 
Sbjct: 180 -FNPNDPDTYNNSTSVTMYDSLGEPHILTTYFVRPPEAAYTGTSNWVAFYAVDGKQVDLA 238

Query: 224 ---------IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID 274
                          + +     N +      +SF+    Y  +      +      G +
Sbjct: 239 GAAGTYGRDTTGDGVADSTGTAVNASGWKGSVLSFNDTGAYTGSDPAVITTETLGVGGAN 298

Query: 275 ---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                    Q +T++ +  TQ A  F   +   +G   G+  +  V  DG ++  Y +G+
Sbjct: 299 VLGPGTDGSQTLTLNFNSPTQYASPFEVTELSQDGTTVGRLTNVEVGADGLINASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+A   +E  L      ++  + DSG    G       G I S ALE +NVD+
Sbjct: 359 TVPLARVALARFSNEQGLTQVGNTSWKESLDSGPALAGEANSGTFGSIRSSALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|330502734|ref|YP_004379603.1| flagellar hook protein FlgE [Pseudomonas mendocina NK-01]
 gi|328917020|gb|AEB57851.1| flagellar hook protein FlgE [Pseudomonas mendocina NK-01]
          Length = 456

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 93/457 (20%), Positives = 172/457 (37%), Gaps = 44/457 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A ++ ++   +NIAN  T G+K++   F+ L   S   T  +    G+ +
Sbjct: 2   SFNIGLSGLRAATSDLNVTGNNIANAGTAGFKQSRAEFADLYASSMLGTGKNPQGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +    +  QG++ +T +  D+AI G GFF+    +     TR+G F  + +G++ N  G 
Sbjct: 62  ADVAQLFNQGNINYTQNALDMAINGNGFFMT-SNNGEMSYTRSGYFGTDRDGYIVNNFGY 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY     S  ++            +  + +   T    +++N  + A   T      
Sbjct: 121 RLQGYAAD-DSGNILPVQSDLRVSAGQQEPKATTTVTQRINLNSNAVRPANAGTMAAPTF 179

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                  +   +S   YD+ G++ V   Y+ K         +        N    +    
Sbjct: 180 DPSDSKSFNWSTSTNIYDSQGNAHVMSQYFVKNEAPANNGWVMHVLIDGVNPRDPSSTQP 239

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDN--------------------------------- 269
            +  V++D        +     S   N                                 
Sbjct: 240 FSYAVNYDAAGQLADPALTPLASTPPNPALDAPAIPTGTPNGIFALAEADWVPAEKDPVN 299

Query: 270 ------TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDD 323
                      +  T D+  +TQ A  F       +G+  G+     V   G +   Y +
Sbjct: 300 PGTMVANGADSEAFTFDMRGSTQYAASFGVNAVSQDGYTTGQLAGIEVDDTGIIFARYTN 359

Query: 324 GTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANV 383
           G      ++ +A   +   L       ++ + +SG+  IG P  +  G + +GALE +NV
Sbjct: 360 GQSKVQGQVLLANFANVQGLSPVGKTAWVQSFESGEPVIGTPRSSTLGALQAGALEDSNV 419

Query: 384 DIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +++ +L  LI AQRNY  N+K  +T S     +I+L+
Sbjct: 420 ELSDQLVNLIVAQRNYQANAKTIETESAITQTIINLR 456


>gi|257457611|ref|ZP_05622778.1| flagellar hook protein FlgE [Treponema vincentii ATCC 35580]
 gi|257444997|gb|EEV20073.1| flagellar hook protein FlgE [Treponema vincentii ATCC 35580]
          Length = 463

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 106/467 (22%), Positives = 201/467 (43%), Gaps = 52/467 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY------- 55
           ++ S+ + +SGM     R+  + +NIANV+T G+KR  + F  L+    S +        
Sbjct: 1   MMRSLFSGVSGMQNHQTRMDVIGNNIANVNTTGFKRGRVNFQDLISQQLSGASRPTEEVG 60

Query: 56  ------VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
                 V  G+ +++ D +  QG+L  T  NTD+A+QG GFF++K  +  +  TRAG F 
Sbjct: 61  GVNPKEVGLGMMVASIDTVHTQGALQSTGINTDIAVQGNGFFVLKSGE-KSFYTRAGAFG 119

Query: 110 INNEGFLENV-AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAE-LSAMPTTTGFISNN 167
           ++ +G + N   G  + G+  +      ++N+    E + +   + + A  TT+   + N
Sbjct: 120 VDRDGTMVNPANGMRVQGWMAQEVDGTRLINTSAQTEDLIIPIGQKIDARATTSVNYACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ 227
           LDK    +  +       +  E T  + F  YDT G +   ++ +++    + +      
Sbjct: 180 LDKRLPELPENANR---AQVLESTWTTEFKVYDTFGETHELNLSFSRVPGTQNQWLATVN 236

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI-------- 279
               N         + T E + +  T    N  H A   +   +   +   +        
Sbjct: 237 VDPENAEATETRTGVGTTEGTGNTFTVTFDNYGHLASVTDTAGNASAEAGQVLVQVSYNV 296

Query: 280 -------------------------DISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
                                      +  TQ A     +  E +G+A G  ++F + + 
Sbjct: 297 PGATAGEDGAPVRHTFDINLGEIGTSRNTITQFAERSTTKAYEQDGYAMGYLENFKIDQS 356

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +  +Y +G    I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++ 
Sbjct: 357 GIITGVYSNGVSHEIGQLAMAGFANQGGLEKAGENTYVQSNNSGIANITTSGVMGKGKLI 416

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +G LE +NVD+  + T++I  QR +   +K  QT    ++ +++LKR
Sbjct: 417 AGTLEMSNVDLTDQFTDMIITQRGFQAGAKTIQTSDTMLETVLNLKR 463


>gi|320173529|gb|EFW48725.1| Flagellar hook protein FlgE [Shigella dysenteriae CDC 74-1112]
          Length = 402

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 173/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               +        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVNGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATPQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G      + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFATLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|251789168|ref|YP_003003889.1| flagellar hook protein FlgE [Dickeya zeae Ech1591]
 gi|247537789|gb|ACT06410.1| flagellar basal body FlaE domain protein [Dickeya zeae Ech1591]
          Length = 405

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 101/415 (24%), Positives = 179/415 (43%), Gaps = 11/415 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A SN +  + +NIAN  TVG+K + I+F+ +       S V  G  +++ 
Sbjct: 2   SFSQAVSGLNAASNNLDVIGNNIANSATVGFKASNISFADMYA----GSNVGLGTRVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS+  T+   D+AI G GF+ +   +     +R G F +++   + N  G  L 
Sbjct: 58  LQDFTNGSINSTSRALDVAINGSGFYRLLNGNGSVVYSRNGQFTLDSSRNIVNAQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           G+P      P  + S      +++    +SA  T    I  NL+ + +  T + T   N 
Sbjct: 118 GFPA--TGTPPAIQSGADPVGLSIPENTMSAKATNIASIIANLNSSDSTNTWNATDPTN- 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
                 +K S   YD+LG++  + +Y+ KT    W+V       +    F          
Sbjct: 175 ---TSNYKGSITTYDSLGNAHNFALYFVKTAANNWDVYAQDTSIT-GAGFQGPTRLTFDT 230

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             +  P     A +       + N S              Q +G    +    +G+ PG+
Sbjct: 231 SGALVPTPPATAVTPVTLSMASLNGSAASTFTLAFTGSVQQNSGSNSTKTPTQDGYEPGE 290

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              +S+S DG V   Y +     + ++ +A   + + L     N +  T +SG   +G  
Sbjct: 291 LTGYSISNDGSVIGSYSNKRTQLLGQIVLANFANPEGLSPQGDNVWAATNNSGQAVVGSA 350

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G +   A E++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 351 GTGNFGNLVGKATESSNVDMSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 405


>gi|117919772|ref|YP_868964.1| flagellar hook protein FlgE [Shewanella sp. ANA-3]
 gi|117612104|gb|ABK47558.1| GCN5-related N-acetyltransferase [Shewanella sp. ANA-3]
          Length = 453

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 98/455 (21%), Positives = 175/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ DLAI+G GFF+         +  TRAG F ++   ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDLAIKGGGFFVTASEIGTLDHQFTRAGAFKVDKNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NL+     + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTAKPVQIPDTAGSPVQTENVTLQMNLNAKEGSLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y   +S   YD+LG   +   Y+ K  +        W        +  + S
Sbjct: 180 -FDPLDSKTYNSVTSMTIYDSLGEPHIMTTYFVKPNNGSYNGENNWVAYYAIDGKQVDIS 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHK-----------------------------AIS 265
            P      +T        +G    +                                   
Sbjct: 239 GPAGTYQTDTNGDGTPDASGTAQTAGGWKGSVLKFNSVGVYTGSDPAVVATETLGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q + I  +  TQ +  F   +   +G   G+  +  + +DG +   Y +G+
Sbjct: 299 VLGPGADGTQAVIIKFNAPTQYSAPFAATELSQDGTTVGRLTNVEIGEDGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  +  SG    G P     G + S ALE +N+D+
Sbjct: 359 TVPLARVALVRFANEQGLTQVGNTSWKASLSSGPALAGEPNSGTFGSLSSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|114046838|ref|YP_737388.1| flagellar hook protein FlgE [Shewanella sp. MR-7]
 gi|113888280|gb|ABI42331.1| flagellar basal body FlaE domain protein [Shewanella sp. MR-7]
          Length = 453

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 102/455 (22%), Positives = 177/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ DLAI+G GFF+         +  TRAG F ++   ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDLAIKGGGFFVTASEIGTLDHQFTRAGAFKVDKNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NL+     + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTAKPVQIPDTAGSPVQTENVTLQMNLNAKEGSLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y   +S   YD+LG   +   Y+ K  +        W        +  + S
Sbjct: 180 -FDPLDSKTYNSVTSMTIYDSLGEPHIMTTYFVKPNNGSYNGENNWVAYYAIDGKQVDVS 238

Query: 235 FPYNVAPLNT-----------------------------VEVSFDPVTGYLANSSHKAIS 265
            P      +T                             V    DP              
Sbjct: 239 GPAGTYQTDTDGDGMADGTGTAQTTGGWKGSVLKFNSVGVYTGSDPAVVTTEALGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +TI  +  TQ +  F   +   +G   G+  +  + +DG +   Y +G+
Sbjct: 299 VLGPGADGTQDVTIKFNAPTQYSAPFAATELTQDGTTVGRLTNVEIGEDGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  + +SG    G P     G I S ALE +N+D+
Sbjct: 359 TVPLSRVALVRFANEQGLTQVGNTSWKASLESGPALAGEPNSGTFGSISSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|167623361|ref|YP_001673655.1| flagellar hook protein FlgE [Shewanella halifaxensis HAW-EB4]
 gi|167353383|gb|ABZ75996.1| flagellar basal body FlaE domain protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 453

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 103/455 (22%), Positives = 184/455 (40%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ +    ++  ++NIANV+T G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISSAQKDLNTTANNIANVNTTGFKESRAEFADVYASSIFANSKTTVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           S       QGS+  T ++ D+AI G GFF+            TRAG F  ++  ++ + A
Sbjct: 62  SQVAQQFHQGSMAFTNNSLDMAINGGGFFVTSSEVGSQDHSYTRAGAFKFDSNNYIVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T +  I  NL+   + + P   
Sbjct: 122 GNFLQTFPVDKD-GNSTSVSLTTTKPVQIPDTAGSPVKTDSVGIQMNLNAGESTLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD----------------------- 217
                    + + +S   YD+LG   +   Y+ +  +                       
Sbjct: 180 -FDPDDPDTFNNSTSVTIYDSLGEPHILTSYFVRPPNAAHTGESNWVAFYAVDGKPVDLD 238

Query: 218 ---KKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID 274
               ++ V           +   N A      VSF+    Y  ++     +      G +
Sbjct: 239 PAAGEYNVDTDGDGTVDGKANAENAAGWKGAAVSFNDTGAYTGSNPAVIKTEALGVGGAN 298

Query: 275 ---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                    Q +T+D +  TQ A  F   +   +G   G+  +  V  DG ++  Y +G+
Sbjct: 299 VLGPGADGTQTLTLDFNNPTQYASPFEVTELTQDGTTVGRLTNVEVGADGLINASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+ +  +E  L      ++  + DSG    G       G I S ALE +NVD+
Sbjct: 359 TVPLARVALVSFANEQGLSQAGNTSWKASLDSGPALAGEANSGTFGSIRSSALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 453


>gi|313497761|gb|ADR59127.1| FlgE [Pseudomonas putida BIRD-1]
          Length = 440

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 96/445 (21%), Positives = 167/445 (37%), Gaps = 38/445 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY-----VSGGL 60
           S    +SG+ A +  ++   +NIANV T G+K +   F+     S   +      +  G+
Sbjct: 2   SFNIGLSGLYAANKALNVTGNNIANVATTGFKSSRAEFADQYSNSIRGTSAGKTVIGTGV 61

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + +    +   G++  T    D+AI G GFF +   +     TRAG F+ +  G++ N +
Sbjct: 62  KTAAVSQLFTPGNINATGQALDMAIDGNGFFALND-NGSKIYTRAGAFYSDKAGYVVNAS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +      +           +++    +  P  T  I+  ++ N+   +P  T
Sbjct: 121 GANLQGYAVGEDGKIIQGI------LTDLQIDTSNLTPKPTSLITEKINLNSAATSPSVT 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQDQSTNNSFPYNV 239
           P      + Y    +   YD+ G+    + Y+ K      W +      ++  N      
Sbjct: 175 PFDPTNASSYNFTFNTPVYDSQGNEHQMNQYFIKDDATNTWSMHTTIDGRNPANPASTTP 234

Query: 240 APLNTVEVSFDPVTGYLANSSHKAI-------------------------SFNDNTSGID 274
                   S   +      +   A                             +      
Sbjct: 235 LVNAVPFKSDGTLDKDAMTAGDVAGGLSIGEDKIFQLNDWIPAQKNAAGEWSANGAIANA 294

Query: 275 QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
             + +D+   TQ            +G A G+    S+ ++GY+   + +G    I ++AI
Sbjct: 295 DGVKLDMLGATQYNASSAEIAKTQDGFATGELSGLSIDQNGYLFASFTNGKDKVIGQVAI 354

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A   +   L    G  +  +  SG   IG P     G+I  GALE +NVD+  EL  LI+
Sbjct: 355 ANFANLQGLTPIGGTNWKESYASGVPVIGAPDTGTLGQISGGALEDSNVDLTGELVNLIK 414

Query: 395 AQRNYAVNSKVFQTGSDFMDILISL 419
           AQ NY  N+K   T S  M  +I +
Sbjct: 415 AQSNYQANAKTISTESTIMQTIIQM 439


>gi|319898656|ref|YP_004158749.1| flagellar hook protein FlgE [Bartonella clarridgeiae 73]
 gi|319402620|emb|CBI76165.1| Flagellar hook protein FlgE [Bartonella clarridgeiae 73]
          Length = 402

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 137/421 (32%), Positives = 196/421 (46%), Gaps = 19/421 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M+T +SGM+AQ  R+S V+DN+AN  TVGYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MGIYGMMRTGVSGMNAQGTRLSGVADNVANAGTVGYKRTNVQFSNYVTPSGQYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T  + D  I G GFF V   +    LTRAG F  + +G+L N A
Sbjct: 61  KSHIGHDISISGPAHATGRSGDAMIHGNGFFRVADENGKEFLTRAGSFTRDKDGYLRNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL                + ++             TT      N + +A ++ P+  
Sbjct: 121 GYYLLN------------EDGERIQIKGGPTDLFGPEVTTKIDFKANFNPSAKVMEPEGG 168

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y  K S   YD+ G  V  D Y  KT + KW V  +        S  +N  
Sbjct: 169 QIDPKDPKSYNQKKSMTTYDSQGKKVQVDFYMRKTAENKWVVDAYSN-GEKVGSTDFNFD 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
               +          L +S  K    + N  G+        S  TQ    F  +  E +G
Sbjct: 228 KEGNLIEPTKEFKLTLPDSEGKTFEVDVNFGGVGAD-----SLVTQKGNLFAFEA-EADG 281

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G    F+  K+G ++++Y +     +  + I TV S ++L    G+ +     +G  
Sbjct: 282 MESGAFDGFTFGKNGEIEVMYSNQKTRIVGYVGITTVASPESLTFLGGSVFETNSQTGAQ 341

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +G PG    G + SG LE +NVD+  ELT++IEAQRNY  NSKVFQTGS+ MD++++LK
Sbjct: 342 MMGRPGDGVFGTLSSGYLEDSNVDMGDELTDMIEAQRNYTANSKVFQTGSELMDVIVNLK 401

Query: 421 R 421
           R
Sbjct: 402 R 402


>gi|157961171|ref|YP_001501205.1| flagellar hook protein FlgE [Shewanella pealeana ATCC 700345]
 gi|157846171|gb|ABV86670.1| flagellar basal body FlaE domain protein [Shewanella pealeana ATCC
           700345]
          Length = 453

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 104/455 (22%), Positives = 183/455 (40%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ +    ++  ++NIANV+T G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISSAQKDLNTTANNIANVNTTGFKESRAEFADVYASSIFANSKTTVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           S       QGS+  T ++ D+AI G GFF+            TRAG F  ++  ++ + A
Sbjct: 62  SQVAQQFHQGSMQFTNNSLDMAINGGGFFVTSSEVGSQDHSFTRAGAFKFDSNNYIVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    I  NL+   + + P   
Sbjct: 122 GNFLQTFPVDKD-GNSTSVSLTTTKPVQIPDTAGSPVKTDQVGIQMNLNAGESTLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTN-- 232
                    + + +S   YD+LG   +   Y+ +  +        W        +  +  
Sbjct: 180 -FDPDDPETFNNSTSVTIYDSLGEPHILTSYFVRPPNAAHIGESNWVAFYAVDGKPVDLD 238

Query: 233 ------------------NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID 274
                              +   N A      VSF+    Y  ++     +      G +
Sbjct: 239 PAAGEYDIDTDGDGAVDGQASAENAAGWKGAAVSFNDTGAYTGSNPAVITTEALGVGGAN 298

Query: 275 ---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                    Q +T+D +  TQ A  F   +   NG   G+  +  V  DG ++  Y +G+
Sbjct: 299 VLGPGADGSQTLTLDFNNPTQYASPFEVTELNQNGTTVGRLTNVEVGADGLINASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+ +  +E  L      ++  + DSG    G       G I S ALE +NVD+
Sbjct: 359 TVPLARVALVSFANEQGLSQAGNTSWKASLDSGPALAGEANSGTFGSIRSSALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|187734244|ref|YP_001880752.1| flagellar hook protein FlgE [Shigella boydii CDC 3083-94]
 gi|187431236|gb|ACD10510.1| flagellar hook protein FlgE [Shigella boydii CDC 3083-94]
          Length = 402

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 173/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NI N  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIVNSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGADPATFSLSFLNSMQQNTGANNIVATPQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|77359722|ref|YP_339297.1| flagellar hook protein FlgE [Pseudoalteromonas haloplanktis TAC125]
 gi|76874633|emb|CAI85854.1| flagellar biosynthesis; hook protein [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 454

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 104/456 (22%), Positives = 185/456 (40%), Gaps = 44/456 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+T G+K +   F+ +   S   +  +    G++ 
Sbjct: 2   SFNIALSGLAAAQKDLNVTANNIANVNTTGFKESRAEFADVYASSVFSSGKTKNGDGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           +       QGSL  T ++ DLAI G+G+F             TRAG F +N + F+ +  
Sbjct: 62  TMVAQQFHQGSLQFTNNSLDLAITGEGYFATSQDLGAQDFTYTRAGAFKLNKDNFVVDAN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L G+P+  ++      S      + +  +  S   T++ + S NLD  +   T    
Sbjct: 122 GSFLQGFPVDPSTGDTTSVSLSTSSALQIPDSSGSPRATSSVYSSFNLDSRSIAPTIA-- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
             +    A Y   +S   YD+LG   V  +++ K+         +W V      +S   +
Sbjct: 180 -FNPTESATYNSSTSTTVYDSLGEPHVLQLFFVKSDPAVPGNENQWSVHSTLDGKSFGAN 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDN--------------------TSGID 274
                    T   +F   +  L  S+    + ++                     T+G  
Sbjct: 239 GVEQTVAPYTPMTTFQFDSSGLPQSTDGTPNVSNTFNPLSIAAGGGGNAGLSDLLTNGAT 298

Query: 275 QQITIDISK----------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG 324
               ++I+            TQ A  F  +  E +G   G+     +  DG V   Y +G
Sbjct: 299 FPAPVEINWRDETGTANKIPTQYASRFEVKALEQDGATVGRLAGIDIGADGKVVASYSNG 358

Query: 325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVD 384
               + ++A+    +   L+      +  +  SG+   G PG    G I S ALE +NV+
Sbjct: 359 DSTFLGQVAMVRFSNSQGLQQVGSTGWKASIASGEPIAGEPGSGTLGNINSSALEQSNVN 418

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + +EL +LI AQRN+  NS+  +  S     ++ ++
Sbjct: 419 LTNELVDLISAQRNFQANSRALEVNSTIQQSILQIR 454


>gi|224825164|ref|ZP_03698270.1| flagellar basal body FlaE domain protein [Lutiella nitroferrum
           2002]
 gi|224602835|gb|EEG09012.1| flagellar basal body FlaE domain protein [Lutiella nitroferrum
           2002]
          Length = 419

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/423 (25%), Positives = 193/423 (45%), Gaps = 13/423 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
             +  +SG+ A S ++  V +N+AN  T G+KR+   F+ +   S    SN+    G+  
Sbjct: 2   GFQQGLSGLAAASKQLEVVGNNVANASTNGFKRSRSEFADMYGSSLYGVSNAQAGIGVRT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN---VNCLTRAGDFHINNEGFLENV 119
           +    + +QG++  T +N DLAI GKGFF++K        +  +R G F ++  G+L N 
Sbjct: 62  AEVSQLFDQGNINSTGNNLDLAISGKGFFVLKSPSAASSQDAYSRNGAFQVDANGYLVNG 121

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  L GY  +      ++        +  + + +S   T+   +  NL+ +A +I+P  
Sbjct: 122 DGYKLQGYAAQ----NGVIQYTATPVDLQFQTSLISPTATSNVDLGVNLNSSAMVISPTP 177

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T  +    + Y   +S   YD+LG++     Y+ K                   +     
Sbjct: 178 T-VNPTDTSTYNSATSVKVYDSLGNTHDLSFYFVKGTPTATGTDWTVNLYVDGTAVTSPA 236

Query: 240 APLN-TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
            P   + + +    +G + ++     +  + ++      T+D+SK+TQ    F       
Sbjct: 237 GPQTLSFDTNGVLTSGGVLSNIQYTATTPNGSTTPMTIATVDLSKSTQFNSSFGVNSLSA 296

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS- 357
           +G+APG     +++  G ++  Y +G  V I ++A+A   +   L+   GN +     S 
Sbjct: 297 DGNAPGTLTSTNINNQGIIEATYSNGKTVAIGQVALANFTNVQGLQSMGGNLWKDVASST 356

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G   +G P     GEI S ALE +NVD+ SEL ++I AQR Y  N++  +T    +  LI
Sbjct: 357 GGAKVGAPMSADLGEIQSQALEQSNVDLNSELVDMIVAQRFYQANAQSIKTEDTILQTLI 416

Query: 418 SLK 420
           +L+
Sbjct: 417 NLR 419


>gi|333004885|gb|EGK24405.1| flagellar hook protein flgE [Shigella flexneri VA-6]
          Length = 399

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 95/415 (22%), Positives = 175/415 (42%), Gaps = 17/415 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLLNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +           
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTAT------- 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             + +         ++   +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 --TLEFNANGTCAMANNIATGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 284

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 285 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 344

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++  ++L+
Sbjct: 345 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTRVNLR 399


>gi|304392493|ref|ZP_07374433.1| flagellar hook protein FlgE [Ahrensia sp. R2A130]
 gi|303295123|gb|EFL89483.1| flagellar hook protein FlgE [Ahrensia sp. R2A130]
          Length = 423

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 166/427 (38%), Positives = 242/427 (56%), Gaps = 10/427 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVS--- 57
           M + G M+T++SGM AQSNR+S V+DN+ANVDT GYK+ +  F+ LV P  S+   S   
Sbjct: 1   MSLYGMMRTSVSGMQAQSNRLSTVADNVANVDTTGYKKYSTEFAQLVRPGASSGVDSSLG 60

Query: 58  -GGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFL 116
            GG+    +  IS+QG++ +T S+TD+AI G GFF+V+     N LTRAG F  +  GFL
Sbjct: 61  SGGVLTDARQHISQQGNVSYTQSSTDIAINGNGFFVVEDSGGSNSLTRAGSFVADASGFL 120

Query: 117 ENVAGGVLLGYPLK-NASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATII 175
            N  G  L G       + P  + S   LE ++V    L+A+PT  G    NL  N+  +
Sbjct: 121 VNAGGQRLKGVAADDQGNFPASIGSISALEPVSVDKQALAAVPTQNGRFVPNLPANSVAV 180

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS-TNNS 234
           T D TP  N   + + HK+S  AYD LG + V D+Y T TG   WE++ F    +     
Sbjct: 181 TGD-TPVDNSAASTFAHKTSLTAYDNLGDAKVIDIYSTPTGPLTWEMTAFDASTASPTGG 239

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
           FPY  A L T  ++FDP  G LA  S   ++F        + + + ++ TTQLA  +   
Sbjct: 240 FPYASAALGTSTLTFDPANGQLAAGSPDTLTFTVPNG---RPVDLALAGTTQLAADYSIV 296

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
            ++++G  P   +   V  +G +   Y DG+   +YR+ +A V S D +    G  +L  
Sbjct: 297 TADLDGAPPASMEGIVVDGEGVLSARYSDGSLRDLYRIPLAAVVSPDRMDSDTGTVFLAN 356

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            +SGDI + F G   +G + SGALE +NV++A ELT++I AQR Y  NSKVFQTG+D MD
Sbjct: 357 TESGDIRVDFAGTGSNGVLISGALEQSNVELADELTDMIRAQRGYTANSKVFQTGADLMD 416

Query: 415 ILISLKR 421
           ++++L+R
Sbjct: 417 VIVNLRR 423


>gi|23092315|gb|AAN08640.1| FlgE [Aeromonas hydrophila]
          Length = 453

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/453 (23%), Positives = 182/453 (40%), Gaps = 39/453 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG++A    ++  ++NIANV+++G+K +   F+ +   S    + + V  G+  
Sbjct: 2   SFNNALSGVNAAQKDLNVTANNIANVNSIGFKESRAEFADVYANSIFVNAKTQVGNGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
                   QG+L  T ++ DLAIQG GFF+      +     TRAG F ++   ++ N  
Sbjct: 62  GAVAQQFHQGALQFTNNSLDLAIQGNGFFVTSDGLTNLDRTYTRAGAFKLDENSYMVNNQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +     P  V+     + I +         T+T   S N   +A  +    T
Sbjct: 122 GHYLQGYEVNVDGTPKAVSINAT-KPIQIPDKAGVPTKTSTIEASFNFPSDAKPLAAGNT 180

Query: 181 -----PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT----------GDKKWEVSIF 225
                      D  Y   +S   YD+LGS  V   Y+ K               W + ++
Sbjct: 181 ATDASIFDPTNDKSYYASTSVTIYDSLGSPHVITQYFVKEADPLNVTQPASPTAWRMYMY 240

Query: 226 RQDQSTNNSFPY--------NVAPLNTVEVSFDPVTGYLANSSHKAISFN---------- 267
              +  + S              P     V+FD     +  ++   I             
Sbjct: 241 EDKKPIDVSGGVPTTMAASVTTTPPLAARVTFDADGKMITPTTPATIKTIALGTPGAGII 300

Query: 268 DNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRV 327
            N +   QQ+ + ++  TQ +  F   K   +G   G+     ++ DG V   Y + T +
Sbjct: 301 TNGADGTQQVELKLTNVTQFSSPFEVNKLTQDGSTVGRLTKVEITADGIVSATYSNATTL 360

Query: 328 PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIAS 387
            +  +A+A   +   L      ++  +  SGD   G P     G I S +LE +NVD+ S
Sbjct: 361 KVAMVAMAKFANSQGLTQVGDTSWRQSLLSGDALPGTPNSGTFGSIKSSSLEQSNVDLTS 420

Query: 388 ELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +L  LI AQRN+  NS+  +  S     ++ ++
Sbjct: 421 QLVNLITAQRNFQANSRSLEVNSSLQQTILQIR 453


>gi|300716218|ref|YP_003741021.1| flagellar biosynthesis, hook protein [Erwinia billingiae Eb661]
 gi|299062054|emb|CAX59170.1| Flagellar biosynthesis, hook protein [Erwinia billingiae Eb661]
          Length = 414

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 99/419 (23%), Positives = 176/419 (42%), Gaps = 10/419 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A S+ +  + +NIAN  TVG+K   ++F+ +   S     V  G++++  
Sbjct: 2   AFSQAVSGLNAASSNLDVIGNNIANSATVGFKSATVSFADMFADS----KVGLGVKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T+   D+AI   GFF +         +R G F ++    + N  G  L 
Sbjct: 58  TQDFNDGTTTSTSRGLDVAISQSGFFRMTDTSGAVYYSRNGQFTLDANRNIVNADGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V +      +NV    +SA  T+   +  NL+   +  T D    +  
Sbjct: 118 GYPA--TGTPPTVQTGANPVALNVPTTAMSAKATSAAALVANLNSTDSTPTKDWATTNTD 175

Query: 186 ----RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   Y  K++   YD+LG+    ++YY KTGD  W++         + +       
Sbjct: 176 LSSIDVDTYNSKATMTTYDSLGNEHNINLYYVKTGDNSWKMYPVDGTTGQSAAGAGANTD 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            +               ++ +  +   N S              Q  G         +G+
Sbjct: 236 GSYNVTFNSSGQMTSPTATVQLATATLNGSAAGTFNLNLAGSQQQNTGTSTFGNPTQDGY 295

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
            PG    + ++ DG V   Y +     + ++A+A   + + LK    N +  T  SG   
Sbjct: 296 KPGDLTSYQINNDGTVVGTYSNEQTQTLGQIALANFANPEGLKSEGNNVWSATNSSGQAL 355

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G  G    G + +GALE++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 356 VGLAGTGNLGTLTAGALESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 414


>gi|113969606|ref|YP_733399.1| flagellar hook protein FlgE [Shewanella sp. MR-4]
 gi|113884290|gb|ABI38342.1| flagellar basal body FlaE domain protein [Shewanella sp. MR-4]
          Length = 453

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 102/455 (22%), Positives = 177/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ DLAI+G GFF+         +  TRAG F ++   ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDLAIKGGGFFVTASEIGTLDHQFTRAGAFKVDKNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NL+     + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTAKPVQIPDTAGSPVQTENVTLQMNLNAKEGSLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y   +S   YD+LG   +   Y+ K  +        W        +  + S
Sbjct: 180 -FDPLDSKTYNSVTSMTIYDSLGEPHIMTTYFVKPNNGSYNGENNWVAYYAIDGKQVDVS 238

Query: 235 FPYNVAPLNT-----------------------------VEVSFDPVTGYLANSSHKAIS 265
            P      +T                             V    DP              
Sbjct: 239 GPAGTYQTDTNGDGTADGTGTAQTTGGWKGSVLKFNSVGVYTGSDPAVVTTEALGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +TI  +  TQ +  F   +   +G   G+  +  + +DG +   Y +G+
Sbjct: 299 VLGPGADGTQDVTIKFNAPTQYSAPFAATELTQDGTTVGRLTNVEIGEDGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  + +SG    G P     G I S ALE +N+D+
Sbjct: 359 TVPLSRVALVRFANEQGLTQVGNTSWKASLESGPALAGEPNSGTFGSISSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|26991077|ref|NP_746502.1| flagellar hook protein FlgE [Pseudomonas putida KT2440]
 gi|24986112|gb|AAN69966.1|AE016635_2 flagellar hook protein FlgE [Pseudomonas putida KT2440]
          Length = 440

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 95/445 (21%), Positives = 167/445 (37%), Gaps = 38/445 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY-----VSGGL 60
           S    +SG+ A +  ++   +NIANV T G+K +   F+     S   +      +  G+
Sbjct: 2   SFNIGLSGLYAANKALNVTGNNIANVATTGFKSSRAEFADQYSNSIRGTSAGKTVIGTGV 61

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + +    +   G++  T    D+AI G GFF +   +     TRAG F+ +  G++ N +
Sbjct: 62  KTAAVSQLFTPGNINATGQALDMAIDGNGFFALND-NGSKIYTRAGAFYSDKAGYVVNAS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +      +           +++    +  P  T  I+  ++ N+   +P  T
Sbjct: 121 GANLQGYAVGEDGKIIQGI------LTDLQIDTSNLTPKPTSLITEKINLNSAATSPSVT 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQDQSTNNSFPYNV 239
           P      + Y    +   +D+ G+    + Y+ K      W +      ++  N      
Sbjct: 175 PFDPTNASSYNFTFNTPVFDSQGNEHQMNQYFIKDDATNTWSMHTTIDGRNPANPASTTP 234

Query: 240 APLNTVEVSFDPVTGYLANSSHKAI-------------------------SFNDNTSGID 274
                   S   +      +   A                             +      
Sbjct: 235 LVNAVPFKSDGTLDKDAMTAGDVAGGLSIGEDKIFQLNDWIPAQKNAAGEWSANGAIANA 294

Query: 275 QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
             + +D+   TQ            +G A G+    S+ ++GY+   + +G    I ++AI
Sbjct: 295 DGVKLDMLGATQYNASSAEIAKTQDGFATGELSGLSIDQNGYLFASFTNGKDKVIGQVAI 354

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A   +   L    G  +  +  SG   IG P     G+I  GALE +NVD+  EL  LI+
Sbjct: 355 ANFANLQGLTPIGGTNWKESYASGVPVIGAPDTGTLGQISGGALEDSNVDLTGELVNLIK 414

Query: 395 AQRNYAVNSKVFQTGSDFMDILISL 419
           AQ NY  N+K   T S  M  +I +
Sbjct: 415 AQSNYQANAKTISTESTIMQTIIQM 439


>gi|298345998|ref|YP_003718685.1| flagellar basal body and hook protein [Mobiluncus curtisii ATCC
           43063]
 gi|304390244|ref|ZP_07372198.1| flagellar hook protein FlgE [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|298236059|gb|ADI67191.1| flagellar basal body and hook protein [Mobiluncus curtisii ATCC
           43063]
 gi|304326726|gb|EFL93970.1| flagellar hook protein FlgE [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 484

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 91/488 (18%), Positives = 172/488 (35%), Gaps = 73/488 (14%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ T +SG+      +   S+NIANV+T G+K  +  F                   
Sbjct: 1   MLRSLFTGISGLSVHQTMLDVTSNNIANVNTTGFKSASTRFEDTFSQLVRSGAAPRLNER 60

Query: 50  -STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDF 108
              + + V  G+++ +       G+   T  N D  I G GF++++  +  +  TR G F
Sbjct: 61  GGMNPAQVGLGVKLQSITQNFTGGAAQMTGRNLDTMINGDGFYVLRKTNGSSVYTRNGSF 120

Query: 109 HINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERI-----------------NVKH 151
            ++ +G +    G  + G+            +   +                    N+  
Sbjct: 121 GLDAQGQVVAADGSFVQGWMGDKDGTINASGTPGNITLPLTKTVEGRPTTKVIYGGNIPA 180

Query: 152 AELSAMPTTTGFISNNLDKNATIITPDKTPKHNGR------------------------- 186
            ++   PT +    +N  + + I+       +                            
Sbjct: 181 DQIYMDPTGSKTSPDNAFQRSQIVHAYDDKGNPHDVLLTFARNDFANPGSEPMWELRAYD 240

Query: 187 -------------DAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN 233
                               +  A     G SV       K  D           +   +
Sbjct: 241 ANVFKELDETQREKLTNDGGARIALEVEDGGSVSIGGSKVKPADGDG----VLNFKFKTD 296

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIP 293
                 +      V F      +  ++    S     +   Q I +D+S  T   G    
Sbjct: 297 GTLDEDSLKAMKTVKFKLDQVNVNETTTPKSSSILQPNVTKQPINLDLSALTGFGGVNNF 356

Query: 294 QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLP 353
            + +++G+  G    +SV  DG +   + +G    + R+A+A+  +   L+    + ++ 
Sbjct: 357 GQKQVDGNMAGYMTGYSVEADGTIRGTFSNGDNRALARIAVASFANPLGLEKAGSSYFVE 416

Query: 354 TRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFM 413
           T +SG   IG  G  Q G +  GA+E +NVD+A+E T LI +QR +  NS+V  T  + +
Sbjct: 417 TGNSGQPQIGEAGTGQRGAMTGGAIEMSNVDLAAEFTNLILSQRGFQANSRVITTSDEIL 476

Query: 414 DILISLKR 421
             L+++KR
Sbjct: 477 QELVNMKR 484


>gi|126175146|ref|YP_001051295.1| flagellar hook protein FlgE [Shewanella baltica OS155]
 gi|125998351|gb|ABN62426.1| flagellar basal body FlaE domain protein [Shewanella baltica OS155]
          Length = 460

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 102/462 (22%), Positives = 183/462 (39%), Gaps = 50/462 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    + + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNAKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ D+AI+G GFF+         +  TRAG F +++  ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDMAIKGGGFFVTSSELGTLDHAFTRAGAFKVDSNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NLD  A  + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTAKPVQIPDTAGSPVKTENVTLQMNLDAKAAALDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + +S   YD+LG S +   Y+ K  D        W       ++  N +
Sbjct: 179 LFDPADPKTYNNVTSMTIYDSLGQSHIMTTYFVKPKDGAYNGENNWVAYYAVDNKPVNLN 238

Query: 235 FPY---------------------------NVAPLNTVEVSFDPVTGYLANSSHKAISFN 267
            P                                     + F+ V  Y+ ++     +  
Sbjct: 239 GPAGKYDVDTNGDGSPDVPTVAGGGGVSAQTAGGWTGSVLKFNSVGAYIDSNPAVIATQP 298

Query: 268 DNTSGID---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
              +G           Q +T+  +  TQ A  F   +   +G   G+  +  +  DG + 
Sbjct: 299 LGNTGAGVLGPGADGTQSVTVKFNAPTQYADPFAATELTQDGTTVGRLTNVEIGADGLIT 358

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
             Y +G+ V + R+A+    +E  L      ++  +  SG    G       G I S AL
Sbjct: 359 ASYSNGSTVALARVALVRFANEQGLTQVGNTSWKASLASGPALAGEANSGTFGSISSSAL 418

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           E +N+D+ +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 EQSNIDLTTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 460


>gi|146293690|ref|YP_001184114.1| flagellar hook protein FlgE [Shewanella putrefaciens CN-32]
 gi|145565380|gb|ABP76315.1| flagellar basal body FlaE domain protein [Shewanella putrefaciens
           CN-32]
 gi|319427089|gb|ADV55163.1| flagellar hook-basal body protein [Shewanella putrefaciens 200]
          Length = 453

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 96/455 (21%), Positives = 173/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ DLAI+G GFF+            TRAG F ++   ++ + +
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDLAIKGGGFFVTSSELGTLDFSYTRAGAFKVDASNYMVDSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T       NL+     + P   
Sbjct: 122 GNYLQTFPVDKE-GNSTSVSLTTAKPVQIPDTAGSPVKTENVSFQMNLNAKEGSLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    YT  +S   YD+LG   +   Y+ K  +        W        +  + +
Sbjct: 180 -FDPTDPKTYTSVTSMTIYDSLGEPHIMTTYFVKPTNGAHNGENNWVAYYAVDGKQVDVA 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHK-----------------------------AIS 265
                   +T        TG    +                                   
Sbjct: 239 GAAGTYQTDTDGDGVPDSTGTAETAGGWRGSVLKFNSVGVYTGSDPAIVTTETLGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +T+  +  TQ +  F   +   +G   G+  +  +  DG +   Y +G+
Sbjct: 299 VLGPGADGTQSLTVKFNAPTQYSAPFAATELTQDGTTVGRLTNVEIGADGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  + +SG    G       G + S ALE +N+D+
Sbjct: 359 TVPLARVALVRFANEQGLTQVGNTSWKASLNSGPALAGEANSGTFGSLSSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|312884834|ref|ZP_07744526.1| flagellar hook protein FlgE [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367486|gb|EFP95046.1| flagellar hook protein FlgE [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 398

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 111/414 (26%), Positives = 171/414 (41%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTDLNTISHNIANASTTGFKGARTEFSAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TRAG F+ + + FL +  G  L
Sbjct: 57  SQNFDKNGSISGTGRPMDLAINGTGFFVTKDSTGQTQYTRAGVFNRDKDNFLVSNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L          I +  + L+A  TT+     N D +A  +     P   
Sbjct: 117 QGYSVDGNNNLLT----GASGDIKLSTSSLAAKATTSMDFVANFDASAEQVDQTVNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    S   YD+LG+    + Y+TKTG   W+V++               A  + 
Sbjct: 173 NNTNSFNSSYSTKVYDSLGNEHNVNQYFTKTGPNTWQVNVQVD----------GAATPSA 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L   +                I +D+S +TQ    F    +  NG+  G
Sbjct: 223 TIAMNFNSDGSLQTPTAPYSVAFPAAGAQPMNIQVDLSGSTQFGAAFGVSTNSHNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V   G V   Y +G      ++ +A   +   L   +G  +  +  SG   +G 
Sbjct: 283 ELVGARVEDSGRVYATYTNGQSQLQGQVVLADFANPQGLVKVNGTAWTQSFSSGAPIVGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGTGTLGDLSPGALEGSNVDLTSELVNLMTAQRNYQANAKTISTNDKLTQALFN 396


>gi|256059804|ref|ZP_05449999.1| flagellar hook protein FlgE [Brucella neotomae 5K33]
 gi|261323784|ref|ZP_05962981.1| flagellar hook protein flgE [Brucella neotomae 5K33]
 gi|261299764|gb|EEY03261.1| flagellar hook protein flgE [Brucella neotomae 5K33]
          Length = 396

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 172/421 (40%), Positives = 241/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  LIV    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLIV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|120598232|ref|YP_962806.1| flagellar hook protein FlgE [Shewanella sp. W3-18-1]
 gi|120558325|gb|ABM24252.1| flagellar basal body FlaE domain protein [Shewanella sp. W3-18-1]
          Length = 453

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 100/455 (21%), Positives = 171/455 (37%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +TVG+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTVGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ DLAI+G GFF+            TRAG F ++   ++ + +
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDLAIKGGGFFVTSSELGTLDFSYTRAGAFKVDASNYMVDSS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T       NL+     + P   
Sbjct: 122 GNYLQTFPVDKE-GNSTSVSLTTAKPVQIPDTAGSPVKTENVSFQMNLNAKEGSLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    YT  +S   YD+LG   +   Y+ K  D        W        +  +  
Sbjct: 180 -FDPTDPKTYTSVTSMTIYDSLGEPHIMTSYFVKPTDGAYNGENNWVAYYAVDGKQVDVD 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHK-----------------------------AIS 265
                   +T        T     +                                   
Sbjct: 239 GAAGTYQTDTDGDGVPDGTATAETTGGWRGSVLKFNSVGVYTGSDPAIVTTETLGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +TI  +  TQ A  F   +   +G   G+  +  +  DG +   Y +G+
Sbjct: 299 VLGPGADGTQNLTIKFNAPTQYAAPFAATELTQDGTTVGRLTNVEIGADGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  + +SG    G       G I S ALE +N+D+
Sbjct: 359 TVPLARVALVRFANEQGLTQVGNTSWKASLNSGPALAGEANSGTFGSISSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|294140184|ref|YP_003556162.1| flagellar hook protein FlgE [Shewanella violacea DSS12]
 gi|293326653|dbj|BAJ01384.1| flagellar hook protein FlgE [Shewanella violacea DSS12]
          Length = 454

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 102/456 (22%), Positives = 179/456 (39%), Gaps = 44/456 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+++G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNSIGFKESRAEFADVYANSIFANSKTAVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T +  D+AI G GFF+         +  TRAG F +N+  +L +  
Sbjct: 62  SQVAQQFHQGSLQFTNNALDMAINGGGFFVTSSELEAKDHSFTRAGAFKVNSADYLVDSQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S   T    I  NL+     + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTTKPVRIPDTAGSPKKTENINIQMNLNAADATLDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW-------------------- 220
                    Y + ++   YD+LG   +   Y+ +  +  +                    
Sbjct: 179 LFDPNDRDTYNNSTAVTMYDSLGEPHILTTYFVRPPNAAYTGESNWAAFYAIDGQQVDLA 238

Query: 221 -------EVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI 273
                  + +         N+   N        + F+    +        ++     +G 
Sbjct: 239 GPAGVFDQDTTGDGVADVLNTPAVNAGGWKGAVIKFNDTGAHTTTDPDPILTVQLGVAGA 298

Query: 274 D---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG 324
                     Q +TID +  TQ A  F   +   +G   G+  +  V  DG ++  Y +G
Sbjct: 299 GVLGPGTDGTQTLTIDFNNPTQYASTFEVTELNQDGTTVGRLTNVEVGADGLINASYSNG 358

Query: 325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVD 384
           + V + R+A+A   +E  L      ++  + DSG    G       G I S ALE +NVD
Sbjct: 359 STVALARVALARFANEQGLTQVGNTSWRASLDSGLALAGEANSGTFGSIRSSALEQSNVD 418

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 LTTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 454


>gi|24374758|ref|NP_718801.1| flagellar hook protein FlgE [Shewanella oneidensis MR-1]
 gi|24349424|gb|AAN56245.1|AE015762_2 flagellar hook protein FlgE [Shewanella oneidensis MR-1]
          Length = 453

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 99/455 (21%), Positives = 175/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ DLAI+G GFF+         +  TRAG F ++   ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTNNSLDLAIKGGGFFVTASEIGTLDHQFTRAGAFKVDKNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NL+     + P   
Sbjct: 122 GNFLQTFPVDKD-GNSTSVSLTTAKPVQIPDTAGSPVQTENVTLQMNLNAKEGSLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y   +S   YD+LG   +   Y+ K  +        W        +  + S
Sbjct: 180 -FDPLDSKTYNSVTSMTIYDSLGEPHIMTTYFVKPNNGSYNGENNWVAYYAIDGKQVDVS 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHK-----------------------------AIS 265
            P      +T        TG    +                                   
Sbjct: 239 GPAGTYQTDTNGDGTPDATGTAQTTGGWKGSVLKFNSVGVYTGSDPAVVTTEALGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q + I  +  TQ +  F   +   +G   G+  +  + +DG +   Y +G+
Sbjct: 299 VLGPGADGTQAVNIKFNAPTQYSAPFAATELSQDGTTVGRLTNVEIGEDGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  +  SG    G P     G + S ALE +N+D+
Sbjct: 359 TVPLARVALVRFANEQGLTQVGNTSWKASLSSGPALAGEPNSGTFGSLSSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|306845419|ref|ZP_07477993.1| flagellar hook protein FlgE [Brucella sp. BO1]
 gi|306274162|gb|EFM55978.1| flagellar hook protein FlgE [Brucella sp. BO1]
          Length = 396

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 172/421 (40%), Positives = 240/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G    NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGNFIVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             + A
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGA 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNVFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPRGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|294852968|ref|ZP_06793640.1| flagellar hook protein FlgE [Brucella sp. NVSL 07-0026]
 gi|294818623|gb|EFG35623.1| flagellar hook protein FlgE [Brucella sp. NVSL 07-0026]
          Length = 396

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 238/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL      A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLDAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQT S+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTDSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|312962588|ref|ZP_07777078.1| flagellar hook protein FlgE [Pseudomonas fluorescens WH6]
 gi|311283168|gb|EFQ61759.1| flagellar hook protein FlgE [Pseudomonas fluorescens WH6]
          Length = 437

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 96/438 (21%), Positives = 177/438 (40%), Gaps = 27/438 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A + ++    +NIANV T G+K +   F+ +   S   T  + +  G+ +
Sbjct: 2   SFNIGLSGLYAANKQLDVTGNNIANVATTGFKSSRAEFADIYAASKLGTGQNSIGNGVNL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG +  +    D+AIQG GFF+ KG D     TR+G F  + +GF+ N  G 
Sbjct: 62  AAVSQQFTQGDVNGSGGILDMAIQGGGFFVQKGSDGSLEYTRSGAFRADKDGFITNNTGT 121

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
             L     +    +I     GL  + +  + L    +T    ++NL+ +  +I     P 
Sbjct: 122 SRLQGYAADDDGKII---KGGLTDLQLNLSNLPPKASTKVDSTSNLNSSEPVIDQTLKPF 178

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQ--------------- 227
                + +T + S   YD+ G++     Y  KT   KW                      
Sbjct: 179 DPSDTSTFTTQYSTTLYDSQGNAHPMVQYLVKTDGNKWNAYTLIDGRNPNGSSPTGGTPP 238

Query: 228 ------DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
                   + + +   +         +   +TG++  +    +   +        I I++
Sbjct: 239 TPPVASTLTFDGAGKLSSIVTGGSSSTTLTLTGWVPGTVTNGVWKANGADANPTGIAINM 298

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
           +  TQ            +G+A G+     +  +G +   + +     I ++++A+  +E 
Sbjct: 299 ANITQYNSATYRNPPITDGYATGQITGLKIDGNGVMFATFSNQQSKAIGQISLASFNNEQ 358

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L+     T+  T  SG      P     G I + +LE +NV++ +EL +LI+AQ NY  
Sbjct: 359 GLQPAGSTTWRETFASGQPGYDTPQSGTLGSIVANSLENSNVNLTNELVDLIKAQSNYQA 418

Query: 402 NSKVFQTGSDFMDILISL 419
           N+K   T S  M  +I +
Sbjct: 419 NAKTISTQSTIMQTIIQM 436


>gi|82702453|ref|YP_412019.1| flagellar hook protein FlgE [Nitrosospira multiformis ATCC 25196]
 gi|82410518|gb|ABB74627.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 406

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 101/418 (24%), Positives = 181/418 (43%), Gaps = 16/418 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGG---LEI 62
           S +  +SG++A S  +  + +N+AN +TVG+K++   F+ +   S S    +     +++
Sbjct: 2   SFQQGLSGLNAASKNLDVIGNNVANTNTVGFKQSQAQFADMFANSLSGGGGTQAGIGVKL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QGS+  + +  D+AI G GF+ +  +      +R G FH + +G++ N +G 
Sbjct: 62  AGIAQQFSQGSITVSNNPFDIAISGAGFYRLSDQ-GTISYSRNGQFHPDKDGYIVNSSGL 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY   +               + +  A+L  + TT      NLD     ++      
Sbjct: 121 RLTGYMANSTGQINT----GTPTDLRLSTADLPPVTTTRVNALVNLDSRGAPLSAAA--F 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                A Y   +S + YD+LG+S     Y+ KT    W         + NN    N    
Sbjct: 175 DLMDPATYHSSTSLSVYDSLGNSTPLSTYFVKTAANSW------DVFAANNGSLLNGGLS 228

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
                     +    +SS   ++    T        ID + TTQ    F       +G+A
Sbjct: 229 IGTLNFLSNGSLDPLSSSSFNVTAPVTTGASPLAFDIDFANTTQFGSNFGINALSQDGYA 288

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G+   FS+ +DG V   Y +G  + + ++A+A   +   L+    NT+  +  SG   +
Sbjct: 289 SGQLTGFSIGEDGIVSGSYSNGKFLSMGQIALANFANPQGLQAVGNNTWKESAASGAALV 348

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             P     G + +GA+E +NV++ SEL  +I AQR Y  N++  +T    +  +++LK
Sbjct: 349 AAPATGGLGVLQAGAVEDSNVELTSELVNMITAQRVYQANAQTIKTQDQILQTVVNLK 406


>gi|227820875|ref|YP_002824845.1| flagellar hook protein FlgE [Sinorhizobium fredii NGR234]
 gi|227339874|gb|ACP24092.1| putative flagellar hook protein FlgE [Sinorhizobium fredii NGR234]
          Length = 404

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 173/422 (40%), Positives = 235/422 (55%), Gaps = 19/422 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G+M+T +SGM+AQ+NR+S V++NIAN  T GYKR +  FSS++ PS++ SY SGG+
Sbjct: 1   MSLYGTMRTGVSGMNAQANRLSTVAENIANSSTTGYKRASTEFSSMILPSSNGSYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E S +  IS+QGS  +T S +DLAI G GFFIV+G +    LTRAG F  ++ G L N A
Sbjct: 61  ETSVRYSISDQGSTTYTTSASDLAIDGDGFFIVQGANGQEYLTRAGAFVQDDSGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L+GY  +    P +V +   GL  +N+    L+A  +T G +  NL   A       
Sbjct: 121 GFTLMGYEYEAGVDPTVVVNGFDGLTEVNLASDGLTAAGSTAGAMGANLPSGAANGDVST 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T                  YDT G++ + D  YTK  D +WE+ I     S  +     +
Sbjct: 181 TS--------------LVVYDTQGNTRILDFNYTKVADNQWELDI-VDRTSATSLGTATL 225

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
                  ++  P T  L  +    IS    T      ITID ++TTQL   F P    I+
Sbjct: 226 DFDADGVLTTSPATLTLDGT---LISPITGTGAELNNITIDFTETTQLGTSFTPDGGSID 282

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G+AP K   + +  DG V I Y +G   P YR+A+A+V S D L    GN Y    DSG 
Sbjct: 283 GNAPSKVSGYQIDTDGVVYIKYANGELEPRYRIALASVQSPDKLVPESGNVYSQGVDSGV 342

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           I  GF G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L++L
Sbjct: 343 IVTGFAGSGSFGEILSGALESSNVDIADELTSMIESQRNYTANSKVFQTGSELLEVLVNL 402

Query: 420 KR 421
           KR
Sbjct: 403 KR 404


>gi|271500066|ref|YP_003333091.1| fagellar hook-basal body protein [Dickeya dadantii Ech586]
 gi|270343621|gb|ACZ76386.1| fagellar hook-basal body protein [Dickeya dadantii Ech586]
          Length = 399

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 103/415 (24%), Positives = 184/415 (44%), Gaps = 17/415 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A S+ +  + +NIAN  TVG+K + I+F+ +       S V  G ++++ 
Sbjct: 2   SFSQAVSGLNAASSNLDVIGNNIANSATVGFKASNISFADMYA----GSNVGLGTKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS+ +T+   D+AI G GF+ +   +     +R G F +++   + N  G  L 
Sbjct: 58  LQDFGNGSINNTSRALDVAINGNGFYRLLDTNGSVVYSRNGQFTLDSSRNIVNSQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        +++    +SA  T+T  I  NL+ + +  T + T   N 
Sbjct: 118 GYPA--TGTPPTIQQGASPVALSIPETTMSAKATSTASIIANLNSSDSTNTWNATDPTN- 174

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
                 +K S   YD+LG++  + +Y+ KT    W+V       S               
Sbjct: 175 ---TSNYKGSITTYDSLGNAHNFGLYFVKTAANSWDVYAQDTSIS-------GAGFQGPT 224

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            +SF+        +         N S              Q +G    +    +G+APG+
Sbjct: 225 TLSFNSSGALTTTTPATISMATLNGSAASTFTLAFTGTVQQNSGSNSTKTPTQDGYAPGE 284

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              +S+S DG V   Y +     + ++A+A   + + L     N +  T +SG   +G  
Sbjct: 285 LTGYSISDDGTVVGSYSNSKTQVLGQIALANFANPEGLSPQGDNVWAATSNSGQAVVGLA 344

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++   A E++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 345 GSGNLGKLVGKATESSNVDMSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 399


>gi|319403978|emb|CBI77566.1| Flagellar hook protein FlgE [Bartonella rochalimae ATCC BAA-1498]
          Length = 402

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 138/421 (32%), Positives = 196/421 (46%), Gaps = 19/421 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M+T +SGM+AQ  R+S V+DN+AN  T+GYKRT + FS+ V PS   +YVSGG+
Sbjct: 1   MGIYGMMRTGVSGMNAQGTRLSGVADNVANAGTIGYKRTNVQFSNYVTPSGQYAYVSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T  + D  I G GFF V   +    LTRAG F  + +G+L N A
Sbjct: 61  KSHIGHDISIGGPARATGRSGDTMIHGNGFFRVADENGKEFLTRAGSFVRDKDGYLRNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL                + ++             TT      N + +A ++ P   
Sbjct: 121 GYYLLN------------EDGEKIQIKGGPTDLFGPEATTKIDFKVNFNPSAKVVEPKDG 168

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                +   Y+ K S   YD+ G  V  D Y  KT + KW V  +        S  +N  
Sbjct: 169 KIDPEKPETYSQKKSMTTYDSQGKKVQVDFYMRKTAENKWVVDAYSD-GKKVGSTEFNFD 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
               +          L +S       N N  G+        S  TQ    F  +  E +G
Sbjct: 228 KEGNLIAPTKEFKLTLPDSEGNTFEVNVNFGGVGAD-----SLVTQKGNLFAFEG-EADG 281

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G    F+  K+G ++++Y +     I  + + TV S D+L    G  +     +G  
Sbjct: 282 MESGAFDGFTFGKNGEIEVMYSNQKTRTIGYIGVTTVASPDSLTFLGGTVFETNSQTGPQ 341

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +G PG    G + SG LE +NVD+  ELT++IEAQRNY  NSKVFQTGS+ MD++++LK
Sbjct: 342 MMGRPGDGVFGTLSSGYLEDSNVDMGDELTDMIEAQRNYTANSKVFQTGSELMDVIVNLK 401

Query: 421 R 421
           R
Sbjct: 402 R 402


>gi|254699262|ref|ZP_05161090.1| flagellar hook protein FlgE [Brucella suis bv. 5 str. 513]
 gi|254706497|ref|ZP_05168325.1| flagellar hook protein FlgE [Brucella pinnipedialis M163/99/10]
 gi|254711218|ref|ZP_05173029.1| flagellar hook protein FlgE [Brucella pinnipedialis B2/94]
 gi|254711818|ref|ZP_05173629.1| flagellar hook protein FlgE [Brucella ceti M644/93/1]
 gi|254714887|ref|ZP_05176698.1| flagellar hook protein FlgE [Brucella ceti M13/05/1]
 gi|256015898|ref|YP_003105907.1| flagellar hook protein [Brucella microti CCM 4915]
 gi|256030153|ref|ZP_05443767.1| flagellar hook protein FlgE [Brucella pinnipedialis M292/94/1]
 gi|256158332|ref|ZP_05456236.1| flagellar hook protein FlgE [Brucella ceti M490/95/1]
 gi|256252734|ref|ZP_05458270.1| flagellar hook protein FlgE [Brucella ceti B1/94]
 gi|260166795|ref|ZP_05753606.1| flagellar hook protein FlgE [Brucella sp. F5/99]
 gi|261216577|ref|ZP_05930858.1| flagellar hook protein flgE [Brucella ceti M13/05/1]
 gi|261219813|ref|ZP_05934094.1| flagellar hook protein flgE [Brucella ceti B1/94]
 gi|261313950|ref|ZP_05953147.1| flagellar hook protein flgE [Brucella pinnipedialis M163/99/10]
 gi|261318810|ref|ZP_05958007.1| flagellar hook protein flgE [Brucella pinnipedialis B2/94]
 gi|261319447|ref|ZP_05958644.1| flagellar hook protein flgE [Brucella ceti M644/93/1]
 gi|261749702|ref|ZP_05993411.1| flagellar hook protein flgE [Brucella suis bv. 5 str. 513]
 gi|261756173|ref|ZP_05999882.1| trypsin inhibitor Kunitz [Brucella sp. F5/99]
 gi|265987183|ref|ZP_06099740.1| flagellar hook protein flgE [Brucella pinnipedialis M292/94/1]
 gi|265996846|ref|ZP_06109403.1| flagellar hook protein flgE [Brucella ceti M490/95/1]
 gi|255998558|gb|ACU50245.1| flagellar hook protein [Brucella microti CCM 4915]
 gi|260918397|gb|EEX85050.1| flagellar hook protein flgE [Brucella ceti B1/94]
 gi|260921666|gb|EEX88234.1| flagellar hook protein flgE [Brucella ceti M13/05/1]
 gi|261292137|gb|EEX95633.1| flagellar hook protein flgE [Brucella ceti M644/93/1]
 gi|261298033|gb|EEY01530.1| flagellar hook protein flgE [Brucella pinnipedialis B2/94]
 gi|261302976|gb|EEY06473.1| flagellar hook protein flgE [Brucella pinnipedialis M163/99/10]
 gi|261736157|gb|EEY24153.1| trypsin inhibitor Kunitz [Brucella sp. F5/99]
 gi|261739455|gb|EEY27381.1| flagellar hook protein flgE [Brucella suis bv. 5 str. 513]
 gi|262551143|gb|EEZ07304.1| flagellar hook protein flgE [Brucella ceti M490/95/1]
 gi|264659380|gb|EEZ29641.1| flagellar hook protein flgE [Brucella pinnipedialis M292/94/1]
          Length = 396

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 171/421 (40%), Positives = 240/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|253996319|ref|YP_003048383.1| flagellar hook protein FlgE [Methylotenera mobilis JLW8]
 gi|253982998|gb|ACT47856.1| flagellar basal body FlaE domain protein [Methylotenera mobilis
           JLW8]
          Length = 421

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 98/426 (23%), Positives = 180/426 (42%), Gaps = 17/426 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL---EI 62
           S +  +SG++A S ++  + +N++N +TVG+K++   F+ +   S +    S       +
Sbjct: 2   SFQQGLSGLNAASKQLEVIGNNVSNANTVGFKQSRAEFADVFANSITGGGGSQIGIGTNL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +T      QG++  T ++ D+AI G GFF           TR G F ++ +GF+ + A  
Sbjct: 62  ATVAQQFTQGNITATNNSLDIAINGNGFFR-MSSGGAVTYTRNGQFQLDKQGFIVDSASK 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY        L          + +  A++  + TT    + NLD     + P     
Sbjct: 121 RLTGYAADANGNIL----SGAAVDLQINTADIQPVATTKIEGTINLDSRNNPM-PAAPVF 175

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
            +     Y + ++   YD+LG+S     ++ KT    W++           S        
Sbjct: 176 SSTDPTTYNNSTAVTVYDSLGNSHTLQNFFRKTAANVWDIYTTVDGAPIPASGAATAQMT 235

Query: 243 NTVEVSFDPVTGYLANSSHKAISFND--------NTSGIDQQITIDISKTTQLAGGFIPQ 294
            T       +T     +   +++F               +   TID SK+TQ    F   
Sbjct: 236 FTGTGVSPTITPTAPATGIPSVTFTPMNTATTPVANGAANVTTTIDYSKSTQFGSAFSIN 295

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
               +G   G+   F+ + DG +   Y +G    + R+ +++  + + L+   GN +  +
Sbjct: 296 ALSQDGFTSGRLSGFNTASDGTIVGRYSNGQSKNLGRVVLSSFTNPNGLQSLGGNAWAVS 355

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
             SG    G PG    G + S A+E +NVD+ +EL  +I AQR Y  N++  +T    + 
Sbjct: 356 ASSGPALTGAPGSGLLGVLQSSAVEDSNVDLTAELVNMITAQRVYQANAQTIKTQDQVLQ 415

Query: 415 ILISLK 420
            L++L+
Sbjct: 416 TLVNLR 421


>gi|110805093|ref|YP_688613.1| flagellar hook protein FlgE [Shigella flexneri 5 str. 8401]
 gi|110614641|gb|ABF03308.1| flagellar hook protein FlgE [Shigella flexneri 5 str. 8401]
          Length = 402

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 97/415 (23%), Positives = 173/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N  G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLLNTQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+     P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPV--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++  ++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYKSNAQTIKTQDQILNTRVNLR 402


>gi|149191153|ref|ZP_01869411.1| flagellar hook protein E [Vibrio shilonii AK1]
 gi|148834991|gb|EDL51970.1| flagellar hook protein E [Vibrio shilonii AK1]
          Length = 408

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 107/417 (25%), Positives = 180/417 (43%), Gaps = 16/417 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A ++ ++ +S+NIANV T G+K +   F+S+   S +      G+E+   
Sbjct: 2   SFSIALSGLNASNSELNTISNNIANVSTTGFKESRTEFASVYSGSEAG-----GVEVVGV 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               E  G++  T  + D+A+ G GFF+++        TR+G F++N +G +   +G  L
Sbjct: 57  SQNFEKSGTVTGTGRSLDMALSGNGFFVLEDSKGQTLYTRSGIFNMNADGVITANSGAAL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L       +  + +  A L A  T +     NLD    +          
Sbjct: 117 QGYSVDGNNNLL----LGSVGTVQISTASLQARETDSIEFVANLDAREQVPAAAFDY--- 169

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF---PYNVAP 241
              + Y H  +   YD+LG+      Y+ K     W V +    Q+ N +    P     
Sbjct: 170 SDSSTYNHSYTTPVYDSLGNPHTVSQYFVKGASNDWNVHVLVDGQAINAADALVPAGSPT 229

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
                       G +A+  + ++SF+         + ID+S  TQ    F+  K+  NG+
Sbjct: 230 TTDSANFTFNADGTIASGGNYSVSFDPANGANGVTVNIDLSSVTQFGSDFVVSKNSPNGY 289

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G      +  DG +   Y +G      ++ +A   +  NL       +L +  SG   
Sbjct: 290 TSGDYASVRMENDGRIFATYTNGQSQLQGQVVLADFAAPQNLIKTSDTAWLQSFSSGTPV 349

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           +G  G    G++ SGALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 350 LGTAGSGVFGDLTSGALEGSNVDLTSELVALMTAQRNYQANTKSISTSDQLTQALFN 406


>gi|118589967|ref|ZP_01547371.1| flagellar basal body FlaE [Stappia aggregata IAM 12614]
 gi|118437464|gb|EAV44101.1| flagellar basal body FlaE [Stappia aggregata IAM 12614]
          Length = 424

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 168/427 (39%), Positives = 244/427 (57%), Gaps = 9/427 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G M++ +SGM+AQS+++  V++NI N  T GYKR    FSSLV    + S+ SGG+
Sbjct: 1   MGLFGVMRSGVSGMNAQSSKLGTVAENIMNSSTTGYKRAKSEFSSLVVSQGAGSFNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E  T+  I+++G+L  T S  DLAI G GFF+V      + LTRAG F  + +G+L N A
Sbjct: 61  EAHTQYEITKKGNLSFTTSKLDLAIDGNGFFVVGNEAGESFLTRAGHFVPDGDGYLLNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           G  L GYP+   +AP  V +   GLERIN+   +L A PT+  F+  N+ ++A I+    
Sbjct: 121 GYYLQGYPITGNTAPTTVANGLGGLERINITQNQLEATPTSEAFLRVNVSEDAAIVPAAD 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK----KWEVSIFRQDQS-TNNS 234
            P  N   A Y+HK+S   YD LG+ V  DVYY+K  +      WEV+I+    +     
Sbjct: 181 LPSANAATASYSHKTSMIVYDNLGNEVKLDVYYSKVTETGTDSDWEVTIYNAADAAPGGG 240

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ 294
           FPY    LNT  ++FD  TG L  +S  +I+      G      +D+ ++T L   F   
Sbjct: 241 FPYTAPALNTQTLTFDVTTGNLTGASATSINIAVPNGGT---FDLDLDQSTYLNADFTVT 297

Query: 295 KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPT 354
             + +G+AP   K+   + DG +  +Y +G R  IY++ +A VPS D L    GN Y  +
Sbjct: 298 NVDADGNAPSAVKNVEFADDGTLFAVYANGDRRAIYKIPLANVPSPDRLSNRSGNVYSTS 357

Query: 355 RDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMD 414
            DSGD+ +GF G    G I  G LE +NVD+ +ELT +IE+QR Y  NS+VF+ GSD ++
Sbjct: 358 FDSGDVRVGFAGEGGMGAIKVGGLEDSNVDLGNELTSMIESQRTYTANSQVFKAGSDLLE 417

Query: 415 ILISLKR 421
            L++L R
Sbjct: 418 QLVNLVR 424


>gi|152965624|ref|YP_001361408.1| hypothetical protein Krad_1658 [Kineococcus radiotolerans SRS30216]
 gi|151360141|gb|ABS03144.1| protein of unknown function DUF1078 domain protein [Kineococcus
           radiotolerans SRS30216]
          Length = 462

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 102/465 (21%), Positives = 179/465 (38%), Gaps = 49/465 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L SM + +SG+ +    +  V +NIANV+T G+K +++ F+  +               
Sbjct: 1   MLRSMFSGVSGLRSHQTMMDVVGNNIANVNTAGFKSSSVVFADTLSQLTKAAGAPTDAAA 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+ + V  G+ ++       QGS   T  +TDL +QG G F ++  D     +R G F 
Sbjct: 61  GTNPAQVGLGVRVNAITQNMTQGSAQATGKSTDLMLQGDGMFAIQQGDG-TFYSRNGSFT 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++  G +    GG ++G+    A A         L   +     + A+ TT      N+D
Sbjct: 120 LDANGSVVTNDGGYVMGWKADAAGAVNTNGQIGKLVIPSDTV--MPAVATTEAKFKGNID 177

Query: 170 KN--------ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWE 221
           +         A       +   +G        SSF++YD  G +    V +T   +    
Sbjct: 178 RTFKTPTALPAADQYVTGSSPGDGVIKGTAVTSSFSSYDDQGIATKVFVTFTNDVNYTAA 237

Query: 222 VSIFRQDQSTNNSFPYNVAPLNTVE-----------------------VSFDPVTGYLAN 258
            +               V     V                               G    
Sbjct: 238 TAASTDANGVVTPAKAAVYEPTNVWHVKAVDSNGKEVVLKKADGTTAETVEFDPDGAAKG 297

Query: 259 SSHKAISFNDNTSGIDQQITIDISKTTQL--AGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
           ++    +     +  D  +++D++  T      G        +G   G    FS   DG 
Sbjct: 298 TNSMVATVEGAGTKADSTVSLDLTGLTSYVGTTGTSNVNPVADGAPIGTLTGFSFGTDGV 357

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           +   Y +G +  + ++AIA+  +   L+    + Y  + +SG    G  G    G I +G
Sbjct: 358 ITGNYSNGYKQTLGQIAIASFNNSAGLRKEGNSLYSVSTNSGQPVFGIAGSAGRGSILAG 417

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +LE +NVD+++E T LI AQR +  NSKV  +  + +  L++LKR
Sbjct: 418 SLEMSNVDLSAEFTNLILAQRGFQANSKVITSSDELLQDLVNLKR 462


>gi|319405421|emb|CBI79040.1| Flagellar hook protein FlgE [Bartonella sp. AR 15-3]
          Length = 402

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 136/421 (32%), Positives = 197/421 (46%), Gaps = 19/421 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I G M+T +SGM+AQ  R+S V+DN+ANV TVGYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MSIYGMMRTGVSGMNAQGTRLSGVADNVANVGTVGYKRTNVQFSNYVTPSGQYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T  + D+ I G GFF V   +    LTRAG F  +  G+L N A
Sbjct: 61  KSHIGHDISISGPAHATGRSGDVMIHGSGFFRVADENGKEFLTRAGSFTRDKGGYLRNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL                + ++             TT      N + +A ++  +  
Sbjct: 121 GYYLLN------------EDGERIQIKGGPTDLFGPEATTKIDFKANFNPSAKVVESEDG 168

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y+ K S   YD+ G  V  D Y  KT + KW V  +        S  +N  
Sbjct: 169 EIDPDDPKSYSQKKSMTTYDSQGKKVQVDFYMRKTAENKWVVDAYSN-GEKVGSTEFNFD 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
               +    +     L +S  +    + N  G+        S  TQ    F  +  E +G
Sbjct: 228 KEGNLIEPTEEFKLTLPDSEGETFEVDVNFGGVGAD-----SLVTQKGNLFAFEA-EADG 281

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G    F+  K+G ++++Y +     I  + + TV S ++L    G+ +     +G  
Sbjct: 282 MESGAFDGFTFGKNGEIEVMYSNQKTRIIGYVGMTTVASPESLTFLGGSVFETNSQTGAQ 341

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +G PG    G + SG LE +NVDI  ELT++IEAQRNY  NSKVFQTGS+ MD++++LK
Sbjct: 342 MMGRPGDGVFGTLSSGYLEDSNVDIGDELTDMIEAQRNYTANSKVFQTGSELMDVIVNLK 401

Query: 421 R 421
           R
Sbjct: 402 R 402


>gi|2832235|gb|AAC01569.1| flagellar hook [Brucella abortus]
          Length = 396

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKD---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|94312669|ref|YP_585878.1| flagellar hook protein [Cupriavidus metallidurans CH34]
 gi|93356521|gb|ABF10609.1| flagellar hook protein [Cupriavidus metallidurans CH34]
          Length = 415

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 94/419 (22%), Positives = 169/419 (40%), Gaps = 10/419 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A ++ +  + +NIAN +TVG+K++   F+ +       S +  G  +++ 
Sbjct: 2   GFGQGVSGLNAAASNLDVIGNNIANANTVGFKQSTAQFADVYA----GSKIGLGTRVNSV 57

Query: 66  DMISEQGSLMHTASNTDLAI-QGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 G++  T  N D+AI  G GFF +   D     +R G F   ++G L N +G  +
Sbjct: 58  VQSFTNGNISSTGRNLDVAISNGNGFFRLASTDGGVYYSRNGQFQRLDDGRLVNASGLQV 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP    +  +               A  +          + +  NA + TP  TP   
Sbjct: 118 TGYPAGTTAGGVAPQPIVISNAQMPPQATTNIKAQFQLDSRSTVPTNAFVSTPGATPPVL 177

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW----EVSIFRQDQSTNNSFPYNVA 240
                + + ++   YD+LG+      Y+ K+                          NV 
Sbjct: 178 PNSTMFNYSTAMTVYDSLGNKQQLTAYFGKSIPATTPAPPNAFGGTDWDMNVTDASGNVL 237

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
               +    + +    + ++   ++            T+D+S TTQ      P+    NG
Sbjct: 238 QTVKLSFDANGMLKAPSATTMPTVTLPAANGAAAMTATLDLSGTTQFGADNDPKSIVQNG 297

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G    FSV  DG +   + +     + ++A+A   + + LK    N +  T  SG  
Sbjct: 298 FTSGSLLGFSVQSDGTILGSFSNEQTKSLGQIAMAAFGNAEGLKPEGNNVWSATGASGQE 357

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            +G  G    G + SG++E +NVD++ +L  LI AQRNY  N++  +     M  L++L
Sbjct: 358 LLGVAG-GSMGTLQSGSVEESNVDLSGQLVNLIVAQRNYQANAQTIKAQDTVMQTLVNL 415


>gi|187478185|ref|YP_786209.1| flagellar hook protein [Bordetella avium 197N]
 gi|115422771|emb|CAJ49299.1| flagellar hook protein [Bordetella avium 197N]
          Length = 406

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 103/419 (24%), Positives = 178/419 (42%), Gaps = 18/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG+ A S  +  + +NIAN  T+G+K  + +F+ +      NS V  G++++  
Sbjct: 2   GFGQGLSGLQAASQNLDVIGNNIANSGTIGFKSGSTSFADVYA----NSRVGLGVKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQG-KGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
           +     G++  T    D+AI G KGFF V    +    TR+G+F I+   F+ N  G  L
Sbjct: 58  NQRFTAGTVSGTGGEYDIAIDGAKGFFRVTDASDNIVYTRSGEFGIDKNFFITNAMGYRL 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+              L  + V  A ++   T    I  NL+ NA I  P       
Sbjct: 118 TGYPVGG--------IGTNLVPLQVPQANIAPQETNAASIQTNLNANAKI-VPAAPAFDP 168

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                YT       YD+LG+S     Y+ K        S++    + +           +
Sbjct: 169 ANQDTYTDLVPTTIYDSLGNSHQMVQYFVKRAPVNG-ESVYDIYYTVDGKPATVDGGQPS 227

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQ---KSEINGH 301
             ++F+          ++ I      S       I +    Q    F      K   NG+
Sbjct: 228 SRLTFNSAGVLTGGQPNRDIEITGLGSTTSPARDITVRMNYQNVTHFGSDFGPKVTANGY 287

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           + G+    S+ K+G +   Y +G    +  +A+A   +   LK    ++++ T +SG   
Sbjct: 288 SSGEFSGISIEKNGTIMAKYTNGESQAVGTIALANFNNVGGLKPVGDSSWVETGESGQAI 347

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG N    +F  ALE +NV+++ EL  +I AQR Y  N++  +T  + + +LI+++
Sbjct: 348 MGQPGTNGLATLFGQALEQSNVEMSQELVNMIVAQRTYQANAQTIKTQDEVLQVLINMR 406


>gi|23500854|ref|NP_700294.1| flagellar hook protein FlgE [Brucella suis 1330]
 gi|38257619|sp|Q8FUS9|FLGE_BRUSU RecName: Full=Flagellar hook protein FlgE
 gi|23464518|gb|AAN34299.1| flagellar hook protein FlgE [Brucella suis 1330]
          Length = 396

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 240/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S + + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|254720773|ref|ZP_05182584.1| flagellar hook protein FlgE [Brucella sp. 83/13]
 gi|265985831|ref|ZP_06098566.1| flagellar hook protein flgE [Brucella sp. 83/13]
 gi|306840136|ref|ZP_07472921.1| flagellar hook protein FlgE [Brucella sp. NF 2653]
 gi|264664423|gb|EEZ34684.1| flagellar hook protein flgE [Brucella sp. 83/13]
 gi|306404781|gb|EFM61075.1| flagellar hook protein FlgE [Brucella sp. NF 2653]
          Length = 396

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 171/421 (40%), Positives = 241/421 (57%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             + A
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGA 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNVFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ +D+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELIDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|116248740|ref|YP_764581.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115253390|emb|CAK11778.1| putative flagellar hook protein flgE [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 430

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 180/431 (41%), Positives = 245/431 (56%), Gaps = 11/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +T GYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTTGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNGA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +++ + S NL+  AT++T   T
Sbjct: 121 GFTLMGYSYDSGVPAVVVNGFDGLVPVNVSQSGLSAIASSSAYFSGNLNSEATVVTNTTT 180

Query: 181 PK--HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW--------EVSIFRQDQS 230
               +     + T K S  AYD+LG +V YD Y+TKTG               +     +
Sbjct: 181 LPSANTASVTDDTQKMSLVAYDSLGGTVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
              +      P ++  VS   ++         A   +       + +T+D S  TQLA  
Sbjct: 241 DAATGSTTSFPYSSDAVSVATLSFDADGQLTSATDTDIVDPVTAKTVTMDYSDFTQLASD 300

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F       +G A       S+  DG V + Y +G    +Y++ +ATV S DNL L  GN 
Sbjct: 301 FSATG-SADGQAASAVSSVSIGADGVVSVSYANGATKALYQIPLATVASPDNLTLLSGNV 359

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  NSKVFQTGS
Sbjct: 360 YSANGLSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKVFQTGS 419

Query: 411 DFMDILISLKR 421
           D MD+L++LKR
Sbjct: 420 DIMDVLVNLKR 430


>gi|327254554|gb|EGE66170.1| hypothetical protein ECSTEC7V_0308 [Escherichia coli STEC_7v]
          Length = 400

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 125/414 (30%), Positives = 192/414 (46%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF++         TRAG F  + +G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKDGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ ++           +  I +K   + A  +++   + NLD +   I     P   
Sbjct: 117 QGYPVDDSGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANLDASDDAIDRTTVPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  +G+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSDFSVTTNAADGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P++D L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNDDGLQAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SGALE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLTSGALESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|241113584|ref|YP_002973419.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240861792|gb|ACS59458.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 430

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 180/431 (41%), Positives = 246/431 (57%), Gaps = 11/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +T GYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTTGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNGA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +++ + S NL+  AT++T   T
Sbjct: 121 GFTLMGYSYDSGVPAVVVNGFDGLVPVNVSQSGLSAVASSSAYFSGNLNSEATVVTDTTT 180

Query: 181 PK--HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW--------EVSIFRQDQS 230
               +     + T K S  AYD+LG +V YD Y+TKTG               +     +
Sbjct: 181 LPSANTASVTDDTQKMSLVAYDSLGGTVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
             ++      P ++  VS   ++         A   +       + IT+D S  TQL+  
Sbjct: 241 DASTGSTTSFPYSSDAVSVATLSFDADGQLTSATDTDIVDPVTAKTITMDYSDFTQLSSD 300

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F       +G A       S+  DG V + Y +G    +Y++ +ATV S DNL L  GN 
Sbjct: 301 FSATG-SADGQAASAVSSVSIGTDGVVSVSYANGATKALYQIPLATVASPDNLTLLSGNV 359

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  NSKVFQTGS
Sbjct: 360 YSANGLSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKVFQTGS 419

Query: 411 DFMDILISLKR 421
           D MD+L++LKR
Sbjct: 420 DIMDVLVNLKR 430


>gi|148980302|ref|ZP_01815989.1| flagellar hook protein E [Vibrionales bacterium SWAT-3]
 gi|145961321|gb|EDK26631.1| flagellar hook protein E [Vibrionales bacterium SWAT-3]
          Length = 408

 Score =  239 bits (608), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 106/417 (25%), Positives = 182/417 (43%), Gaps = 16/417 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A ++ ++ +S+NIANV T G+K +   F+S+   S +      G+E+   
Sbjct: 2   SFSIALSGLNASNSELNTISNNIANVSTTGFKESRTEFASVYSGSEAG-----GVEVVGV 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               E  G++  T  + D+A+ G GFF+++        TR+G F++N +G +   +G  L
Sbjct: 57  SQNFEKSGTVTGTGRSLDMALSGNGFFVLEDSKGQTLYTRSGIFNMNADGVITANSGAAL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L       +  + +  A L A  T +     NLD    +          
Sbjct: 117 QGYSVDGNNNLL----LGSVGTVQISTASLQARETDSIEFVANLDAREQVPASAFDY--- 169

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + Y H  +   YD+LG+      Y+ K     W+V I    ++ + +     A   T
Sbjct: 170 SDSSTYNHSYTTPVYDSLGNPHTVSQYFVKGASNDWDVHILVDGKAIDGADALVPAASPT 229

Query: 245 VEVSF---DPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
              +        G +++  + ++SF+         + ID+S  TQ    F+  K+  NG 
Sbjct: 230 ATDTANFTFNADGTISSGGNYSVSFDPANGANSVTVNIDLSAVTQFGSDFVVSKNSPNGS 289

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
             G      +  DG +   Y +G      ++ +A   S  N+       +L +  SG   
Sbjct: 290 TSGDYASVRMENDGRIFATYTNGQSQLQGQVVLADFASPQNMIKTSDTAWLQSFSSGTPV 349

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           +G  G    G++ SGALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 350 LGTAGSGVFGDLTSGALEGSNVDLTSELVALMTAQRNYQANTKSISTSDQLTQALFN 406


>gi|209547530|ref|YP_002279448.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209538774|gb|ACI58708.1| protein of unknown function DUF1078 domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 430

 Score =  239 bits (608), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 183/431 (42%), Positives = 246/431 (57%), Gaps = 11/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S+ DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSDYDLAISGDGFFIVQSADGTPVLTRAGDFSVDSDGNLVNGA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 121 GFTLMGYSYDSGVPAVVVNGFDGLVPVNVSQSGLSAVASTSAYFSGNLNSEATVVTDTTT 180

Query: 181 PK--HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW--------EVSIFRQDQS 230
               +     + T K S  AYD+LG +V YD Y+TKT                +     +
Sbjct: 181 LPSANTSAVTDDTQKMSLVAYDSLGGTVQYDYYFTKTSVTTDSAGAVTGSTWEVAVYRNA 240

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
              +      P ++  VS   ++         A   +       Q IT+D S  TQLA  
Sbjct: 241 DATTGGTTSFPYSSDAVSVATLSFDADGQLTSAADTDIVDPVTAQTITMDYSDFTQLASD 300

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F       +G A       S+  DG V + Y +G    +Y++ +ATV S DNL L  GN 
Sbjct: 301 FSATG-SADGQAASAVSSVSIGTDGVVSVSYANGATKALYQIPLATVASPDNLTLLSGNV 359

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  NSKVFQTGS
Sbjct: 360 YSANGQSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKVFQTGS 419

Query: 411 DFMDILISLKR 421
           D MD+L++LKR
Sbjct: 420 DIMDVLVNLKR 430


>gi|119775450|ref|YP_928190.1| flagellar hook protein FlgE [Shewanella amazonensis SB2B]
 gi|119767950|gb|ABM00521.1| flagellar hook protein FlgE [Shewanella amazonensis SB2B]
          Length = 453

 Score =  238 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 103/455 (22%), Positives = 172/455 (37%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+T G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNTTGFKESRAEFADVYAASIFSNSKTQVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
           +       QGSL  T++  DLAI G GFF+     +      TRAG F +++  +L + A
Sbjct: 62  TQVAQQFHQGSLQFTSNALDLAISGGGFFVTSADPSARDYSFTRAGAFKVDSNNYLVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S      + +     S + T    +  NL+       P   
Sbjct: 122 GNFLQTFPVDK-FGNSTSVSLTTTRPVQIPDTAGSPVMTENVGVQMNLNAGEKTKDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    + + +S   YD+LG   +   Y+ +  D        W        Q  N  
Sbjct: 180 -FDPDDPTTFNNSTSSTIYDSLGEPHILTTYFVRPNDGAYTGENNWVAYYALDGQPVNLG 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID-------------------- 274
                   +T              +     S     S                       
Sbjct: 239 GGAGTYQTDTDGDGVPDTPATAQTTGGWTGSVLTFNSTGTYTGTNPAIITTEPLGIGGAG 298

Query: 275 ---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                    Q +TI+ +  TQ A  F   +   +G   G+  +  V +DG +   Y +G+
Sbjct: 299 ILGPGADGSQTLTINFANPTQYASAFEVTELTQDGTTVGRLTNVEVGEDGLIKAAYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  +  SG    G       G I S ALE +NVD+
Sbjct: 359 TVPLGRVALVRFANEQGLTQVGNTSWKESLASGTALAGEANSGTFGAIRSAALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 453


>gi|152985192|ref|YP_001349650.1| flagellar hook protein FlgE [Pseudomonas aeruginosa PA7]
 gi|150960350|gb|ABR82375.1| flagellar hook protein [Pseudomonas aeruginosa PA7]
          Length = 462

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 106/468 (22%), Positives = 183/468 (39%), Gaps = 60/468 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A S+ ++   +NIAN  TVG+K++   F+ +   S   + ++    G+ +
Sbjct: 2   SFNIGLSGIQAASSGLNVTGNNIANAGTVGFKQSRAEFADVYAASVLGSGSNPQGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S    + +QG+   T S  DLAI G GFF+    +     TRAG F+ + + F+ +  G 
Sbjct: 62  SDISQMFKQGNFETTNSVLDLAINGNGFFVT-SNNGAISYTRAGYFNTDKQDFIVDNNGY 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY +            Q     ++K    +  P  T  I  + + ++T   P  TP 
Sbjct: 121 RLQGYAVGPNG------QLQNGVVTDLKVERANQAPKATSSIQQSYNLDSTKKPPTVTPF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDK----------KWEVSIFRQD---- 228
                + YT  SS   YD+ G++     ++ K               W + +        
Sbjct: 175 DPSDASTYTSSSSLGIYDSQGNAHTMSQFFIKNEPNPNATPPIPENSWTMKVLIDGVNPL 234

Query: 229 -------------------------QSTNNSFPYNVAPLNTVEVSFDPVTGYLA------ 257
                                       + + P       T  + F   +G         
Sbjct: 235 DPSNKTPMSFNVSFDASGQMTSVRAPDGSTAGPGFSIDPATNVIQFSAASGNPPTPGTGW 294

Query: 258 -----NSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVS 312
                +         +  +G    IT D+ K+TQ +  F       +G+  G+     + 
Sbjct: 295 IPAASDGKTPPTYAWNGATGSASGITFDMRKSTQYSTAFAQSNPIQDGYTTGQLAGLEID 354

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
           + G V   Y +G      ++ +A   +   L      +++ + +SG+ ++G P     G 
Sbjct: 355 ETGVVFARYTNGQSKVQGQVVLANFANIQGLTPIGKTSWVQSSESGEPAVGAPRSGTLGA 414

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + SGALE +NVDI+SEL  LI  QRNY  N+K  QT       +I+L+
Sbjct: 415 LQSGALEASNVDISSELVNLIVHQRNYQANAKTIQTEDAVTQTIINLR 462


>gi|71906391|ref|YP_283978.1| flagellar hook protein FlgE [Dechloromonas aromatica RCB]
 gi|71846012|gb|AAZ45508.1| Flagellar basal body rod protein:Protein of unknown function
           DUF1078:Flagellar basal body FlaE [Dechloromonas
           aromatica RCB]
          Length = 442

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 95/442 (21%), Positives = 177/442 (40%), Gaps = 28/442 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
           + +  +SG++  S  +   S+NIAN  TVG+K  +  F+ +   S +      V  G+  
Sbjct: 2   AFQQGLSGLNTSSKALDVTSNNIANASTVGFKSASTHFADVYAASLAGGGASQVGIGVSA 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S       QG++  T+++ D+A+ G GFF    +D     TR G FH+++ G++ N    
Sbjct: 62  SAIAQQFTQGNITTTSNSLDIALNGNGFFR-MTQDGAVRYTRNGQFHLDSTGYIVNDNKE 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY        +                + +   +     S NL+    +     T  
Sbjct: 121 NLTGYAADAQGKIVASTPSGIKVDTAPISPQATGATSDGVRFSLNLNSTDKVPGTAWTSP 180

Query: 183 ---HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK------------WEVSIFRQ 227
              +    + Y + ++   YDTLG++    +Y+ K+                W+V     
Sbjct: 181 TGTNVPDTSTYNYSNAVTVYDTLGNAHTMTMYFVKSAPTAAEVLANPTTTGAWDVHYQVD 240

Query: 228 DQSTNNSFP---------YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT 278
             S  N                   T   +       +A +     +   N++       
Sbjct: 241 GTSEANVGGSPLRMTFDSTGAYLAPTTPATLAVNLNGVATNLSTPANVVTNSATSPLSFA 300

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
           ++ + +TQ    F       +G+A G+    ++  +G +  +Y +G    + ++ +A   
Sbjct: 301 MNFAGSTQYGSDFAIASKTQDGYASGQLSSLTIGDNGVIQGVYSNGQTRNMAQIVLANFQ 360

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           + + L     N Y+ T DSG   IG P     G + SGA+E +NVD+ +EL  +I  QRN
Sbjct: 361 NPNGLMSIGNNDYIETADSGQSMIGTPNTGTFGVLQSGAVEDSNVDLTAELVNMIVQQRN 420

Query: 399 YAVNSKVFQTGSDFMDILISLK 420
           Y  N++  +T    M  L++++
Sbjct: 421 YQANAQSIKTQDQIMQTLVNIR 442


>gi|86360902|ref|YP_472789.1| flagellar hook protein FlgE [Rhizobium etli CFN 42]
 gi|86285004|gb|ABC94062.1| flagellar hook protein [Rhizobium etli CFN 42]
          Length = 430

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 184/431 (42%), Positives = 248/431 (57%), Gaps = 11/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM AQ+NR+S VSDNIAN +TVGYK  + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAVSGMSAQANRLSTVSDNIANANTVGYKAVSTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + S +  IS+QG + +T S  DLAI G GFFIV+  D    LTRAGDF ++++G L N A
Sbjct: 61  QTSVRQAISQQGDISYTTSAYDLAISGDGFFIVESADGTPVLTRAGDFSVDSDGNLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   +    ++VN F GL  +NV  + LSA+ +T+ + S NL+  AT++T   T
Sbjct: 121 GYTLMGYSYDSGVPAVVVNGFDGLVPVNVAQSGLSAIASTSAYFSGNLNSEATVVTDTTT 180

Query: 181 PK--HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKW--------EVSIFRQDQS 230
               +     + T K S  AYD+LG++V YD Y+TKTG               +     +
Sbjct: 181 LPSANTSGVTDDTQKMSLVAYDSLGATVQYDYYFTKTGVTTDASGAVTGSTWEVAVYRNA 240

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGG 290
              +      P ++  VS   ++         A   +       + IT+D S  TQLA  
Sbjct: 241 DAATGGTTSFPYSSSAVSVATLSFDADGQLTSATDTDIVDPVTAKTITMDYSDFTQLASD 300

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F       +G A       S+  DG V + Y +GT   +Y++ +ATV S DNL L  GN 
Sbjct: 301 FSATG-SADGQAASAVSSVSIGTDGVVSVSYANGTTKSLYQIPLATVASPDNLTLLSGNV 359

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y     SG    GFP  N  G I SGALE++NVD+A ELTE+IEAQR+Y  NSKVFQTGS
Sbjct: 360 YTANGMSGVTVTGFPQTNGLGSIQSGALESSNVDLAGELTEMIEAQRSYTANSKVFQTGS 419

Query: 411 DFMDILISLKR 421
           D MD+L++LKR
Sbjct: 420 DIMDVLVNLKR 430


>gi|153011508|ref|YP_001372722.1| flagellar hook protein FlgE [Ochrobactrum anthropi ATCC 49188]
 gi|151563396|gb|ABS16893.1| flagellar basal body FlaE domain protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 426

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 24/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+SAV+DNIAN  TVGYKR    FSSLV PST   Y SG +
Sbjct: 30  MSLYGMMRTGVSGMNAQANRLSAVADNIANASTVGYKRAETQFSSLVLPSTGGQYNSGSV 89

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G D    LTRAG F  +  G L N A
Sbjct: 90  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGADGSTFLTRAGSFVPDKNGNLVNSA 149

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG    +   P    +  GL  INV  A L    +T+G  + NL     I      
Sbjct: 150 GYYLLGAGPND---PAGALTMAGLNIINVNSAALPPEASTSGNFTVNLPSTDQIPAAG-- 204

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                   E+ HK+S  +Y+  G  +  DVY+TKTG  +W V++           P    
Sbjct: 205 --------EFNHKTSLISYNDKGEKITLDVYFTKTGADEWSVTVKNAADDAVVGGPTT-- 254

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
                 ++FDP TG + ++   A+          Q + +++  +TQ AG +   +++ING
Sbjct: 255 ------LTFDPTTGDMTSAGGVAVDLGPYGG---QNLNLNLGASTQRAGDYTISQAQING 305

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V+ DG V  IY++GT+  + R+ +A V S D + +  GN +LP+ DSGD+
Sbjct: 306 QAPSAVKGVDVANDGSVVAIYENGTQKVLARIPLANVASPDRMTVVSGNVFLPSADSGDV 365

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G++ SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 366 RLGFPQSDGMGKVMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 425

Query: 421 R 421
           R
Sbjct: 426 R 426


>gi|161621182|ref|YP_001595068.1| flagellar hook protein FlgE [Brucella canis ATCC 23365]
 gi|254702383|ref|ZP_05164211.1| flagellar hook protein FlgE [Brucella suis bv. 3 str. 686]
 gi|260568714|ref|ZP_05839183.1| flagellar hook protein FlgE [Brucella suis bv. 4 str. 40]
 gi|261752946|ref|ZP_05996655.1| flagellar hook protein FlgE [Brucella suis bv. 3 str. 686]
 gi|161337993|gb|ABX64297.1| flagellar basal body FlaE domain protein [Brucella canis ATCC
           23365]
 gi|260155379|gb|EEW90460.1| flagellar hook protein FlgE [Brucella suis bv. 4 str. 40]
 gi|261742699|gb|EEY30625.1| flagellar hook protein FlgE [Brucella suis bv. 3 str. 686]
          Length = 396

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
                  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVHYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S + + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|262276417|ref|ZP_06054226.1| flagellar hook protein FlgE [Grimontia hollisae CIP 101886]
 gi|262220225|gb|EEY71541.1| flagellar hook protein FlgE [Grimontia hollisae CIP 101886]
          Length = 435

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 98/439 (22%), Positives = 173/439 (39%), Gaps = 29/439 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           ++  A+SG+ A    ++  S+NIAN +T G+K +   F  +   S    + +    G++ 
Sbjct: 2   ALNIALSGLAAAQKDMNTTSNNIANANTFGFKESRAEFGDVYSASIFSNAKTTTGSGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG---RDNVNCLTRAGDFHINNEGFLENV 119
           S       +GS ++T +  DL I G G+F V         N LTR G FH++ +  + N 
Sbjct: 62  SIVAQQFHEGSSIYTNNPLDLRISGNGYFSVANDKLATQDNVLTRNGAFHLDKDNNIVNS 121

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  LLGY + + +  +     + L   NV         +    I  NL    +   P  
Sbjct: 122 EGQFLLGYNVDSETLQVGSFEPRAL---NVPDQFGQPRASENVEIGLNLPAGGSEKDP-- 176

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
              +      Y   +S   +D+LG       YY K      + +++          P ++
Sbjct: 177 ALFNPEDPDTYNKSTSATIFDSLGQPYKLTTYYVKDNVTPNKWAVYYTATDATGEKPLSL 236

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFN------------------DNTSGIDQQITIDI 281
                   S         NS     + N                   N +   Q +TI+ 
Sbjct: 237 TSGEFTSASGQVGHSVQFNSDGSVNAVNGGAPIQTVEFGPGGAGLEMNGADGTQSLTINF 296

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
            + TQ A  F  ++   +G   G      +   G +   Y +G  V + R+A+  V ++ 
Sbjct: 297 EEPTQYASPFEMRRFTEDGATTGYLAKVDIDPKGTIMATYSNGENVALGRVAMVRVSNQQ 356

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401
            L       +  T+ SG+   G       G++ SG +E +N+D+  EL +LI AQRN+  
Sbjct: 357 GLSQAGNTQWKVTQQSGEAIWGEAMQGAFGKVKSGTIEQSNIDMTQELVDLITAQRNFQA 416

Query: 402 NSKVFQTGSDFMDILISLK 420
           NS+  + G+     ++ ++
Sbjct: 417 NSRSLEVGNQMQQTILQIR 435


>gi|17988503|ref|NP_541136.1| flagellar hook protein FlgE [Brucella melitensis bv. 1 str. 16M]
 gi|256042866|ref|ZP_05445812.1| flagellar hook protein FlgE [Brucella melitensis bv. 1 str. Rev.1]
 gi|260564103|ref|ZP_05834588.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. 16M]
 gi|265989301|ref|ZP_06101858.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. Rev.1]
 gi|38257707|sp|Q8YDL6|FLGE_BRUME RecName: Full=Flagellar hook protein flgE
 gi|17984295|gb|AAL53400.1| flagellar hook protein flge [Brucella melitensis bv. 1 str. 16M]
 gi|260151746|gb|EEW86839.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. 16M]
 gi|262999970|gb|EEZ12660.1| flagellar hook protein flgE [Brucella melitensis bv. 1 str. Rev.1]
          Length = 396

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNIVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|15639714|ref|NP_219164.1| flagellar hook protein FlgE [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025952|ref|YP_001933724.1| flagellar hook protein FlgE [Treponema pallidum subsp. pallidum
           SS14]
 gi|6015169|sp|O07884|FLGE_TREPA RecName: Full=Flagellar hook protein flgE
 gi|2196893|gb|AAB61251.1| FlgE [Treponema pallidum]
 gi|3323028|gb|AAC65692.1| flagellar hook protein (flgE) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018527|gb|ACD71145.1| flagellar hook protein [Treponema pallidum subsp. pallidum SS14]
 gi|291060091|gb|ADD72826.1| flagellar hook protein FlgE [Treponema pallidum subsp. pallidum
           str. Chicago]
          Length = 463

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 109/467 (23%), Positives = 202/467 (43%), Gaps = 52/467 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           ++ S+ + +SGM     R+  + +N+ANV+T G+KR  + F  L+               
Sbjct: 1   MMRSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSAAARPNEEVG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
             +   V  G+ I++ D +  QG+L  T  NTD++IQG GFF++K  +     TRAG F 
Sbjct: 61  GVNPKEVGLGVLIASIDTVHTQGALQTTGINTDVSIQGSGFFVLKSGE-KTFFTRAGAFG 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAP--LIVNSFQGLERINVKHAELSAMPTTTGFISNN 167
           ++N G L N A G+ +   +    A   LI +S Q  + +     ++ A  T+T   + N
Sbjct: 120 VDNAGTLVNPANGMRVQGWMAQDVAGERLINSSAQTQDLVIPIGQKIDAQQTSTVHYACN 179

Query: 168 LDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYY--TKTGDKKWEVSIF 225
           LDK    +  D          + T  + F  YD+ G      + +      + +W+ ++ 
Sbjct: 180 LDKRLPELAADANE---ADVRKSTWTTDFQVYDSFGQQHTLQINFSRVPGTNNQWQATVA 236

Query: 226 RQDQSTNNSFP----YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDI 281
               +  ++                +      G+LA+ +  A +    T  +  + + D+
Sbjct: 237 VDPGTEVDTQTRVGVGTSDGAANTFIVNFDNFGHLASVTDTAGNVTGPTGQVLLEASYDV 296

Query: 282 ---------------------------SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKD 314
                                      +  TQ A     +    +G+A G  ++F + + 
Sbjct: 297 VGANPDDAGQVTRHAFTLNLGEIGTARNTITQFAERSTTKAYRQDGYAMGYLENFKIDQS 356

Query: 315 GYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIF 374
           G +  +Y +G    I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++ 
Sbjct: 357 GVITGVYSNGVSQDIGQLALAGFANQGGLEKAGENTYVQSNNSGIANISTSGVMGKGKLI 416

Query: 375 SGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +G LE +NVD+  + T++I  Q+ +   +K  QT    +D ++SLKR
Sbjct: 417 AGTLEMSNVDLTDQFTDMIITQKGFQAGAKTIQTSDTMLDTVLSLKR 463


>gi|332533175|ref|ZP_08409044.1| flagellar hook protein FlgE [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037457|gb|EGI73911.1| flagellar hook protein FlgE [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 455

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 104/457 (22%), Positives = 181/457 (39%), Gaps = 45/457 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A++G+ A    +   ++NIANV+T G+K +   F+ +   S   +  +    G++ 
Sbjct: 2   SFNIALTGLAAAQKDLDVTANNIANVNTTGFKESRAEFADVYASSVFSSGKTKNGDGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--RDNVNCLTRAGDFHINNEGFLENVA 120
           +       QGSL  T ++ DLAI G+G+F +           TRAG F +N + F+ +  
Sbjct: 62  TMVAQQFHQGSLQFTNNSLDLAITGEGYFAMTDDLSSQDLTYTRAGAFKLNQDNFMVDAK 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+ +++      S    + I +  +  S   T   F+S NLD  A        
Sbjct: 122 GNFLQAFPVDSSTGDTTSVSLSTTDPIQIPDSSGSPRATENVFLSFNLDATADAP---GI 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-------KKWEVSIFRQDQSTNN 233
                    Y   +S   YD+LG   +   ++ K  D         WEV      +  + 
Sbjct: 179 AFDPTSSGTYNSSTSTTVYDSLGEPHILQYFFAKEDDAAAGGTDNSWEVYATLDGKVVDA 238

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNT---------SGIDQQITIDISKT 284
           +         T   +    +  L +++  A + N  T         SG      +D   T
Sbjct: 239 TTGGEQTAPYTPLTTLGFNSSGLPSTTGGAANTNTTTFDEILLPAGSGTGLSTLLDNGAT 298

Query: 285 ---------------------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDD 323
                                TQ + GF  +  + +G   G+     +  DG +   Y +
Sbjct: 299 FPGTGIELNWRDENNTAGRIPTQYSSGFEVKALDQDGSTVGRLAGIDIGTDGKIVASYSN 358

Query: 324 GTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANV 383
           G    + ++A+   P+   L      ++  + DSG+   G  G    G I S ALE +N 
Sbjct: 359 GDSTFLGQVAMVRFPNSQGLSQVGDTSWKQSIDSGEPVAGEAGSGTFGGINSSALEQSNT 418

Query: 384 DIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ++ +EL +LI AQRNY  NS+  +  S     ++ ++
Sbjct: 419 NLTNELVDLITAQRNYQANSRALEVNSTIQQSILQIR 455


>gi|62317957|ref|YP_223810.1| flagellar hook protein FlgE [Brucella abortus bv. 1 str. 9-941]
 gi|83269934|ref|YP_419225.1| flagellar hook protein FlgE [Brucella melitensis biovar Abortus
           2308]
 gi|189023208|ref|YP_001932949.1| flagellar hook protein FlgE [Brucella abortus S19]
 gi|225686885|ref|YP_002734857.1| flagellar hook protein FlgE [Brucella melitensis ATCC 23457]
 gi|254691611|ref|ZP_05154865.1| flagellar hook protein FlgE [Brucella abortus bv. 6 str. 870]
 gi|254731634|ref|ZP_05190212.1| flagellar hook protein FlgE [Brucella abortus bv. 4 str. 292]
 gi|256112177|ref|ZP_05453098.1| flagellar hook protein FlgE [Brucella melitensis bv. 3 str. Ether]
 gi|256256798|ref|ZP_05462334.1| flagellar hook protein FlgE [Brucella abortus bv. 9 str. C68]
 gi|256261978|ref|ZP_05464510.1| trypsin inhibitor Kunitz [Brucella melitensis bv. 2 str. 63/9]
 gi|260544142|ref|ZP_05819963.1| trypsin inhibitor Kunitz [Brucella abortus NCTC 8038]
 gi|260757242|ref|ZP_05869590.1| flagellar hook protein flgE [Brucella abortus bv. 6 str. 870]
 gi|260759393|ref|ZP_05871741.1| flagellar hook protein flgE [Brucella abortus bv. 4 str. 292]
 gi|260883046|ref|ZP_05894660.1| flagellar hook protein flgE [Brucella abortus bv. 9 str. C68]
 gi|265993603|ref|ZP_06106160.1| flagellar hook protein flgE [Brucella melitensis bv. 3 str. Ether]
 gi|297250151|ref|ZP_06933852.1| flagellar hook protein flgE [Brucella abortus bv. 5 str. B3196]
 gi|68845076|sp|O52070|FLGE_BRUAB RecName: Full=Flagellar hook protein flgE
 gi|12330680|gb|AAG52877.1| FlgE [Brucella abortus]
 gi|62198150|gb|AAX76449.1| FlgE, flagellar hook protein [Brucella abortus bv. 1 str. 9-941]
 gi|82940208|emb|CAJ13264.1| Flagellar basal body rod protein:Trypsin inhibitor Kunitz [Brucella
           melitensis biovar Abortus 2308]
 gi|189021782|gb|ACD74503.1| Trypsin inhibitor Kunitz [Brucella abortus S19]
 gi|225642990|gb|ACO02903.1| flagellar basal body FlaE domain protein [Brucella melitensis ATCC
           23457]
 gi|260097413|gb|EEW81287.1| trypsin inhibitor Kunitz [Brucella abortus NCTC 8038]
 gi|260669711|gb|EEX56651.1| flagellar hook protein flgE [Brucella abortus bv. 4 str. 292]
 gi|260677350|gb|EEX64171.1| flagellar hook protein flgE [Brucella abortus bv. 6 str. 870]
 gi|260872574|gb|EEX79643.1| flagellar hook protein flgE [Brucella abortus bv. 9 str. C68]
 gi|262764473|gb|EEZ10505.1| flagellar hook protein flgE [Brucella melitensis bv. 3 str. Ether]
 gi|263091462|gb|EEZ15998.1| trypsin inhibitor Kunitz [Brucella melitensis bv. 2 str. 63/9]
 gi|297174020|gb|EFH33384.1| flagellar hook protein flgE [Brucella abortus bv. 5 str. B3196]
 gi|326411303|gb|ADZ68367.1| flagellar hook protein FlgE [Brucella melitensis M28]
 gi|326554592|gb|ADZ89231.1| flagellar hook protein FlgE [Brucella melitensis M5-90]
          Length = 396

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|149189836|ref|ZP_01868116.1| flagellar hook protein E [Vibrio shilonii AK1]
 gi|148836322|gb|EDL53279.1| flagellar hook protein E [Vibrio shilonii AK1]
          Length = 398

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 113/414 (27%), Positives = 179/414 (43%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA + +++ +S NIAN  T G+K     FS++      N   +GG+E+++ 
Sbjct: 2   SFDIALSGLDATNTQLNTISHNIANASTYGFKEARTEFSAVY-----NGMQAGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TRAG F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVSGTGRAMDLAINGNGFFVTKDHMGQTLYTRAGVFGTDKDNYVVGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +  L       +  + +  + L+A  T       N D ++ I+     P   
Sbjct: 117 QGYGVDSNNNLLT----GSVGDLKISTSSLAAQATDKLDFVANFDASSKIVDQTVNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+S     Y+TKT D  WEV++                P  T
Sbjct: 173 ADPDSFNSSYTSKVYDSLGNSHTVTQYFTKTADNTWEVNVQVD---------GGSTPAQT 223

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
           V V+F+P  G LA+ +                I I +  +TQ    F    +  NG+  G
Sbjct: 224 VPVTFNPD-GTLASPTGSFNVAFPAAGANAMSIDISLEGSTQFGAAFGVSTNNPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L   +G  +  +  SG   +G 
Sbjct: 283 ELAGVRVEDNGMVFATYTNGQSQLQGQVVLANFANPQGLAKTNGTAWTQSYGSGAPVMGT 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGSGVLGDLTPGALEGSNVDLTSELVNLMTAQRNYQANAKTISTSDKLTQALFN 396


>gi|90422624|ref|YP_530994.1| flagellar hook protein FlgE [Rhodopseudomonas palustris BisB18]
 gi|90104638|gb|ABD86675.1| flagellar basal body FlaE [Rhodopseudomonas palustris BisB18]
          Length = 411

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 171/421 (40%), Positives = 235/421 (55%), Gaps = 10/421 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T  SGM AQSN++SAV+DNIANV+T GYKR +  FSSL+  S S SY SG +
Sbjct: 1   MSLYGVMRTGGSGMTAQSNKLSAVADNIANVNTTGYKRASTEFSSLILKSGSGSYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E   +  IS+ G+L +T S TDLAIQG GFF V        LTRAG F  + +G L N A
Sbjct: 61  ETQVRYAISDPGTLQYTTSATDLAIQGNGFFAVSNAGGTPFLTRAGSFVPDGQGNLYNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY LKN    ++ N   GLE +N+    L   P+T         K A     +  
Sbjct: 121 GYYLMGYNLKNGPPNVVANGLTGLEVVNIGQTALEGNPST---------KAAATANLNAN 171

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    YT K+S   YD +G+ V  D+Y  KT    W + ++    ST   FPY  A
Sbjct: 172 AGITAGAPNYTSKTSLVTYDNIGNKVTLDIYAYKTAANAWTMEVYDSADSTGGGFPYTGA 231

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
           PL T   SFD         +  + +    T       T+D+S  TQ+A  F  +   ++G
Sbjct: 232 PLATGNFSFDVSATGKGRLAGGSPTSLSLTIPNGSPFTLDLSSMTQVAADFQFKA-TVDG 290

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           ++P       V+ DG +  IY+DGTR+  Y++ +ATVPS DNL    GN Y    +SG++
Sbjct: 291 NSPSSIDKVEVATDGTMYAIYNDGTRIATYKIPLATVPSPDNLVPEVGNVYSIGINSGNV 350

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            + F GH+  G + + ALE +NVD+A+ELT +IE+QR Y  NSKVFQTG+D +D+L++LK
Sbjct: 351 QVDFAGHSGLGIVKAEALEASNVDLANELTAMIESQRGYTANSKVFQTGADLLDVLVNLK 410

Query: 421 R 421
           R
Sbjct: 411 R 411


>gi|254503336|ref|ZP_05115487.1| Flagellar basal body protein FlaE [Labrenzia alexandrii DFL-11]
 gi|222439407|gb|EEE46086.1| Flagellar basal body protein FlaE [Labrenzia alexandrii DFL-11]
          Length = 421

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 176/425 (41%), Positives = 240/425 (56%), Gaps = 14/425 (3%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKD 66
           M+T +SGM+AQS+++ AV+DNIAN  T GYKR    F+S V      SY SGG++  TK 
Sbjct: 1   MRTGVSGMNAQSSKLGAVADNIANSSTTGYKRAETEFASQVLAQGGGSYNSGGVQAHTKY 60

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVKGRDN---VNCLTRAGDFHINNEGFLENVAGGV 123
            IS+QGS+  T S  DLA+ G GFFIV           LTRAG F  + +G+L N AG  
Sbjct: 61  AISDQGSMSFTTSKLDLAVDGNGFFIVSDSTGAGASQALTRAGSFVPDGQGYLVNTAGMY 120

Query: 124 LLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
           L GYP+ N +AP +V +   GLE +N+   +L A PT+T  +  N+D+++ I+     P 
Sbjct: 121 LQGYPITNGNAPSVVANGLGGLEPVNITQNQLEATPTSTATLHANVDEDSAIVAAANLPS 180

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK----WEVSIFR--QDQSTNNSFP 236
            N   AEY+HK+S   YD LG+ V  DVYYTKT D      WEV+++           FP
Sbjct: 181 ANAATAEYSHKTSMVVYDNLGNEVTLDVYYTKTTDTPPTTDWEVTVYNAADRDPATGGFP 240

Query: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKS 296
           Y  A + T  + FD  TG    +         N    D    ID+  +T    GF     
Sbjct: 241 YGAANIGTSTIQFDTTTGQRTGAVTAVNITVPNGGTYD----IDLENSTYTDAGFTVTNV 296

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
           + +G+AP   +     +DG +  IY +G R PIY++ +A VPS D L    GN Y P+ D
Sbjct: 297 DADGNAPSSVEKVEFGEDGTLYSIYTNGDRRPIYKIPLADVPSPDKLDPVSGNIYRPSID 356

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SGD+ +GFPG    GE+  GALE +NVD+A+ELT +IE+QR Y  NS+VF+ GSD M  L
Sbjct: 357 SGDVRVGFPGDGGLGELAVGALEGSNVDLANELTSMIESQRTYTANSQVFKAGSDLMQEL 416

Query: 417 ISLKR 421
           ++L R
Sbjct: 417 VNLVR 421


>gi|90408060|ref|ZP_01216231.1| flagellar hook protein [Psychromonas sp. CNPT3]
 gi|90310817|gb|EAS38931.1| flagellar hook protein [Psychromonas sp. CNPT3]
          Length = 473

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 111/476 (23%), Positives = 186/476 (39%), Gaps = 65/476 (13%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    + + ++NIANV+TVG+K +   F S+   S    S + V  G+  
Sbjct: 2   SFNIALSGISAAQTDLDSTANNIANVNTVGFKESRAEFESVYANSLFTNSKTKVGDGVST 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           +       QGSL  T +  DLAI G GFF   G   D     TR+G F +N+E F+ + +
Sbjct: 62  AAVAQQFHQGSLKFTQNPLDLAITGSGFFATAGNLEDRDLSYTRSGTFKLNSENFVVDNS 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + I +     + +PT+   I+ NL      + P   
Sbjct: 122 GNYLQAFPVNED-GTSSSVSLSTTQPIQIPETAGTPIPTSEIGITLNLPAGDKALDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + +S   YD+LG S +   YY K  +       +W   +    +  +  
Sbjct: 179 KFDPDDPDTYNNATSVTIYDSLGESHITTTYYVKPENASYTGENQWITFVTVDGKPVDVW 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFND-------------------------- 268
                          D     +A+ + +A S+ D                          
Sbjct: 239 DKAGGTGQVAGTYDVDADGDGVADGTPQAASYVDKDGNVHTGAVLKFDSVGAYKGSSPVV 298

Query: 269 ------------------------NTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                                     +   Q+ T++    TQ +  F     E NG   G
Sbjct: 299 LTFQSLGVDDPSSAAGGDGAGVLSPGADGAQRFTLNFKTPTQFSSAFEVTSLEQNGLTVG 358

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     + KDG V   Y +GT  P+ R++I    +E  L     + ++ T++SG+   G 
Sbjct: 359 RLTGVEIGKDGLVKATYSNGTSQPLSRVSIVRFRNEQGLTQTGSS-WIATQNSGEPLAGE 417

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
                 G + S ALE +NV++ +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 418 ANSGSFGAVNSAALEQSNVNLTTELVDLITAQRNFQANSRALEINNTLQQTILQIR 473


>gi|73539450|ref|YP_299817.1| flagellar hook protein FlgE [Ralstonia eutropha JMP134]
 gi|72122787|gb|AAZ64973.1| Flagellar basal body rod protein:Protein of unknown function
           DUF1078:Flagellar basal body FlaE [Ralstonia eutropha
           JMP134]
          Length = 417

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 99/427 (23%), Positives = 181/427 (42%), Gaps = 24/427 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A +  +  + +NIAN +TVGYK +   F+ +       + +  G  +++ 
Sbjct: 2   GFGQGVSGINAAAANLDVIGNNIANSNTVGYKASTAQFADVYA----GTKIGLGTTVNSV 57

Query: 66  DMISEQGSLMHTASNTDLAI-QGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                QG++  T  + D+AI  G GFF + G D     +R G F   ++G + N  G  L
Sbjct: 58  VQSFTQGNIQATNRSLDVAITNGSGFFRLVGTDGSVHFSRNGQFARTDDGRIVNAQGLQL 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            G+P      P         + + V  A++   PT    +  NLD  +++     +    
Sbjct: 118 TGFP------PAGSGGGALPQPLVVSSAQMPPKPTGNIKVGYNLDSRSSVPATAFSSTAA 171

Query: 185 GRDAE------------YTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
              A             Y++ +S   YD+LG+S     Y+ K+              +  
Sbjct: 172 DPTATPPTPAALPTSDMYSYSNSMTVYDSLGNSQQLVAYFGKSSSGPTVTGGTDWTMNVT 231

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
           ++    +                  + +   ++        D  + +D++ TTQ      
Sbjct: 232 DAAGNVMGGSPITLAFDSNGKLTSTSPATITLTKTMTNGASDLSMKLDLAGTTQFGSDND 291

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G+A G    F++  DG V   Y +     + ++ +A+  + + LK   GNT+ 
Sbjct: 292 VMSPSQDGYASGALLGFAIEGDGTVRASYSNEQTQVLGQVVLASFGNPEGLKPEGGNTWA 351

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T  SG+  +G PG    G++ S A+E +NVD++ EL  LI AQRNY  N+K  +T +  
Sbjct: 352 ATGASGEAIVGAPG-GARGQLLSSAVEASNVDLSGELVNLIVAQRNYQANAKTIETQNQV 410

Query: 413 MDILISL 419
           M+ L+++
Sbjct: 411 MNSLMNM 417


>gi|309779447|ref|ZP_07674208.1| flagellar hook protein FlgE [Ralstonia sp. 5_7_47FAA]
 gi|308921688|gb|EFP67324.1| flagellar hook protein FlgE [Ralstonia sp. 5_7_47FAA]
          Length = 404

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 107/419 (25%), Positives = 190/419 (45%), Gaps = 20/419 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S   +    +  G+ +
Sbjct: 2   GFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVSV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  G++ +  G
Sbjct: 62  TKVSQAFTQGNVTITGNPLDIAINGSGFYRMVDQGSGQVSYTRNGQFQTDKNGYVISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY + +            L ++ +   +L+ + TT    + NLD  AT+  P  TP
Sbjct: 122 QNLTGYGVDSTGKVNT----AVLTKLQIPVNDLAPLATTNTAFAINLDAAATV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A + H  S   YD  G++ +   YY +TG      S    +  T  +   ++  
Sbjct: 176 FSATNSATFNHSVSEQVYDGTGTAHMLTNYYVRTGTGWNVYSQVDGNNPTGGNPVTSLTF 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
             + +++          SS   ++    T        ID + TTQ  GG+       +G+
Sbjct: 236 NTSGQLT----------SSPSKVAVAFGTPTGMSISNIDFTGTTQYGGGYNDTTVTQDGY 285

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG +   Y +G    + ++A+A   + + L+   GN ++ T +SG   
Sbjct: 286 ATGRLASYSVGTDGTITGRYSNGRTSVLGQIAMANFKAPEGLQNIGGNQWVETSNSGAPG 345

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+SL+
Sbjct: 346 LGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDTILQTLVSLR 404


>gi|323975930|gb|EGB71024.1| fagellar hook-basal body protein [Escherichia coli TW10509]
          Length = 400

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 190/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF++         TRAG F  + +G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKDGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ ++           +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDSGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNSANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|119899027|ref|YP_934240.1| FlgE protein [Azoarcus sp. BH72]
 gi|119671440|emb|CAL95353.1| FlgE protein [Azoarcus sp. BH72]
          Length = 445

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 100/445 (22%), Positives = 179/445 (40%), Gaps = 31/445 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YVSGGLE 61
           + +  +SG+++ S  +  +S+N+AN  TVG+K +   F+ +   + +       V  G +
Sbjct: 2   AFQQGLSGLNSSSKALDVISNNVANASTVGFKASNTIFADMYASAMTGGTSSLQVGIGSK 61

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           ++       QG+L  T +  D+AI G GFF +   D     +R G F ++  G + N  G
Sbjct: 62  VAAVTQSFTQGNLTATNNPLDMAINGNGFFRLSRSDGSIAYSRNGQFDVDRNGNIVNATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L G+   + S    V S +           ++   T T  +  NLD +          
Sbjct: 122 EKLTGFQALDTSGTQTVFSGEPSVIYIDTTN-IAPRETGTASVGVNLDSSEKNPLNKNPV 180

Query: 182 KHNGRDA---------EYTHKSSFAAYDTLGSSVVYDVYYTKTG------DKKWEVS--- 223
             +  +           Y + +S   YD+LG++ + ++Y+ +           W V    
Sbjct: 181 GSDINNFLNYTAIPVESYNYTTSMTVYDSLGNASLMNLYFVRDPDVAGVSPNTWTVYGRL 240

Query: 224 ---IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDN----TSGIDQQ 276
              +         S    +  L T+  +   V       +             T   D  
Sbjct: 241 SNDVVPDPADPALSTGAPLENLGTITFTNLGVPDSTIAGNGVFNVTRTGAQLGTGADDLN 300

Query: 277 ITIDISKTTQLAGGFIPQ-KSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIA 335
            T+D+S++TQ             +G+  G+    SVS  G V   + +G    I RLA+A
Sbjct: 301 FTLDLSRSTQWNTDSGVTTSPRQDGYTTGRLTGLSVSNTGVVQGTFSNGQVRDIARLALA 360

Query: 336 TVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEA 395
              S   L     N +  + +SG  ++G PG    G + +G +E +NVD+  EL  +I  
Sbjct: 361 NFSSPQGLTSLGDNLWAESFESGQPTVGAPGTGVLGSVTAGQIEESNVDLTQELVSMIVQ 420

Query: 396 QRNYAVNSKVFQTGSDFMDILISLK 420
           QRNY  N++  +T    +  L++L+
Sbjct: 421 QRNYQANAQSIRTQDQILQTLVNLR 445


>gi|77460469|ref|YP_349976.1| flagellar hook protein FlgE [Pseudomonas fluorescens Pf0-1]
 gi|77384472|gb|ABA75985.1| putative flagellar hook protein [Pseudomonas fluorescens Pf0-1]
          Length = 443

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 99/445 (22%), Positives = 174/445 (39%), Gaps = 35/445 (7%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY---VSGGLEI 62
           S    +SG+ A + ++    +NIANV T G+K +   F  +   +   S    +  G+ +
Sbjct: 2   SFNIGLSGLYAANKQLDVTGNNIANVATAGFKSSRAEFEDVYSSTRLGSGSKVIGNGVRL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           +       QG + +T +  D+ I G GFF     +     TRAG F ++N GF+ N    
Sbjct: 62  ANVSQQFTQGDINNTGNVLDMGINGSGFFT-MSNNGSISYTRAGTFKVDNNGFITNTD-- 118

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
                                L  + +  + L+   T++   + NL+ +   I     P 
Sbjct: 119 -YTSRLQGYGVDSNGKIINGVLTDLKIDTSNLAPKSTSSVTSTINLNSSEKPIDQTAFPF 177

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
              +   YT + S   YDT G+S V D Y  KT D  W+V      ++ + +    V   
Sbjct: 178 DPSKLESYTKQFSTPIYDTQGNSHVMDQYMVKTSDNTWKVYTLVDGRNPDATGSNPVTTP 237

Query: 243 NTVEVSFDPV----------------------------TGYLANSSHKAISFNDNTSGID 274
                                                 TG++  +    +   +  +   
Sbjct: 238 PVASTLTFDSSGKLLQVSTPSTLPAPAPNPIISSDLKLTGWVPGTVTNGVFTPNGAAANP 297

Query: 275 QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
             +TI ++KTTQ            +G+A G+  + ++   G +   + +     I ++A+
Sbjct: 298 AGVTISLAKTTQYNADTARSIPTQDGYATGQITNLTIDGTGTLFANFSNNQSKAIGQVAL 357

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A+  +E  L+   G  +  T  SG      P     GE+ S +LE +NV++ +EL +LI+
Sbjct: 358 ASFTNEQGLQPIGGTGWKETFASGVPGYDAPKTGTLGEVVSNSLEESNVNLTNELVDLIK 417

Query: 395 AQRNYAVNSKVFQTGSDFMDILISL 419
            Q NY  N+K   T S  M  +I +
Sbjct: 418 GQSNYQANAKTISTQSTIMQTIIQM 442


>gi|116694219|ref|YP_728430.1| flagellar hook protein FlgE [Ralstonia eutropha H16]
 gi|113528718|emb|CAJ95065.1| flagellar hook protein [Ralstonia eutropha H16]
          Length = 408

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 91/417 (21%), Positives = 172/417 (41%), Gaps = 13/417 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A ++ +  + +NIAN +TVGYK++A  F+ +       + +  G+ +++ 
Sbjct: 2   GFGQGVSGLNAAASNLDVIGNNIANANTVGYKQSAAQFADVYA----GTKIGLGVRVNSV 57

Query: 66  DMISEQGSLMHTASNTDLAI-QGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                QG++  +  + D+AI  G GFF +   +     +R G F    +G + N+ G  +
Sbjct: 58  VQSFNQGNIEASGRSLDVAITNGNGFFRLTSPEGAVYYSRNGQFQRQEDGRITNMQGLQV 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK-- 182
            GYP   A    +       + + + +A++    T+       LD  AT+ T        
Sbjct: 118 TGYPAGVAGGAGVQ-----PQPLVISNAQMEPRATSNITAKFQLDSRATVPTQAFASAAG 172

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPL 242
                  + + ++   YD+LG+      Y+ K+                 +     V   
Sbjct: 173 SPPTSNMFNYSTAINVYDSLGNKQQLMAYFAKSAGAPTVAGGTDWRMYVTDVNGNAVGGA 232

Query: 243 NTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
                  +        +    +S           + +D++ TTQ       ++   NG+ 
Sbjct: 233 PVTLAFDNAGALQSPAAGAITLSQPAANGAQAMAMKLDLTGTTQFGADNDVKQLSQNGYT 292

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G    FSV+ DG +   Y +    P+ ++ +A   + + LK    N +  T  SG   +
Sbjct: 293 SGSLLGFSVNGDGTITGNYSNEQTKPLGQIVMAAFGNVEGLKPEGDNVWSATGASGQALV 352

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           G  G    G + S A+E +NVD++ +L  LI AQRNY  N++  +     M  L++L
Sbjct: 353 GVAG-GSMGTLRSNAVEASNVDLSGQLVNLIVAQRNYQANAQTIKAQDTVMQTLVNL 408


>gi|304409978|ref|ZP_07391597.1| fagellar hook-basal body protein [Shewanella baltica OS183]
 gi|307302309|ref|ZP_07582067.1| fagellar hook-basal body protein [Shewanella baltica BA175]
 gi|304351387|gb|EFM15786.1| fagellar hook-basal body protein [Shewanella baltica OS183]
 gi|306914347|gb|EFN44768.1| fagellar hook-basal body protein [Shewanella baltica BA175]
          Length = 453

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 99/455 (21%), Positives = 179/455 (39%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    + + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNAKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T+++ D+AI+G GFF+         +  TRAG F +++  ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTSNSLDMAIKGGGFFVTSSELGTLDHSFTRAGAFKVDSNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NL+  A  + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTAKPVQIPDFAGSPVKTENVTLQMNLNAKAEALDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + +S   YD+LG S +   Y+ K  +        W       ++  N +
Sbjct: 179 LFDPSDGKTYNNVTSMTIYDSLGESHIMTTYFVKPKNGAYDGENNWVAYYAIDNKPVNLN 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFND-------------------------- 268
            P      +T        T     +     S                             
Sbjct: 239 GPAGTYQTDTTGDGNPDSTSTAQTAGGWTGSVLKFNSVGAYIDSNPAVITTQPLGNTGAG 298

Query: 269 ---NTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +T+  +  TQ A  F   +   +G   G+  +  +  DG +   Y +G+
Sbjct: 299 VLGAGADGTQTLTVKFNSPTQYADPFAATELTQDGTTVGRLTNVEIGADGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            V + R+A+    +E  L      ++  +  SG    G       G I S ALE +N+D+
Sbjct: 359 SVALARVALVRFANEQGLTQVGNTSWKASLASGQALAGEANSGTFGSISSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 453


>gi|332759635|gb|EGJ89940.1| flagellar hook protein flgE [Shigella flexneri 2747-71]
 gi|332767683|gb|EGJ97876.1| flagellar hook protein FlgE [Shigella flexneri 2930-71]
          Length = 402

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 172/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N  G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLLNTQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+     P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPV--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V     +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGSNSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++  ++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYKSNAQTIKTQDQILNTRVNLR 402


>gi|308273521|emb|CBX30123.1| hypothetical protein N47_D29320 [uncultured Desulfobacterium sp.]
          Length = 469

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 110/469 (23%), Positives = 181/469 (38%), Gaps = 58/469 (12%)

Query: 11  MSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS----TSNSYVSGGLEISTKD 66
           MSG++A  N ++ + DNIANV+TVG+K + + F  ++  +      ++ V  G  ++   
Sbjct: 1   MSGLNALGNAMTVIGDNIANVNTVGFKESRVTFQDVLSQTVATTAGSAQVGRGTSLADIS 60

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN--CLTRAGDFHINNEGFLENVAGGVL 124
               QGS   T S+TDLAI G GFF+V+     N    TRAG+F  + +G   N +  ++
Sbjct: 61  SSFSQGSFESTDSSTDLAIGGAGFFMVRDPGTSNNDYYTRAGEFRFDKDGNFVNPSDYIV 120

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAE--------LSAMPTTTGFISNNLDKNATIIT 176
            G+ L  A+                            ++   ++T          + +  
Sbjct: 121 QGWKLDEATGQDQGTITDITLSSFTSSPSETSSLSMIMNLDSSSTNNSIGANTALSALWN 180

Query: 177 PDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK---WEVSIFRQDQ---- 229
                     D +Y+++++   YD+LGS+    +Y+ K        WE  +         
Sbjct: 181 GSDASGEYIADTDYSYQTTLKVYDSLGSTHDVSIYFDKGETAADPVWEYIVTVNPSEDLR 240

Query: 230 -------------------------------------STNNSFPYNVAPLNTVEVSFDPV 252
                                                     +        T    +   
Sbjct: 241 TITDATQQGLLARGTIEFNGTSGDISGGVNSITCSLSDGAGGWTALANTDATANGGYFTF 300

Query: 253 TGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVS 312
                  S   +  +  T     +   D   TTQ A          +G+  G  +  SV+
Sbjct: 301 APEFIAGSPMNVKLDFGTRFNGSEWANDALSTTQYASASTTVFQSADGYGAGDLQAISVA 360

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
            DG +   Y +G  +P+YR+A+A   +E  L    GN +  TR SG+   G PG N  G 
Sbjct: 361 TDGVITGQYSNGQVLPLYRVALAKFQNEQGLYKVGGNLFSQTRLSGEPITGKPGGNGLGS 420

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +   +LE +NVD+A+E   +I  QR Y  NSK+  T    +  LI+LKR
Sbjct: 421 LSPNSLEQSNVDLATEFVRMITTQRGYQANSKIITTIDQMLSELINLKR 469


>gi|332669198|ref|YP_004452206.1| flagellar hook-basal body protein [Cellulomonas fimi ATCC 484]
 gi|332338236|gb|AEE44819.1| flagellar hook-basal body protein [Cellulomonas fimi ATCC 484]
          Length = 392

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 102/432 (23%), Positives = 172/432 (39%), Gaps = 53/432 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------- 49
           +L S+ + +SG+ +    +    +NIANV+T G+K +   F   +               
Sbjct: 1   MLRSLFSGISGLRSHQTMLDVTGNNIANVNTTGFKSSQTQFQDTLSQMLQNGGGAQDGVG 60

Query: 50  STSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFH 109
            T+ + V  G+ ++       QG+   T  +TD+ IQG GFF+V+ +   +  TRAG F 
Sbjct: 61  GTNPAQVGLGVRVAGITTNFTQGASQMTGRSTDMMIQGDGFFVVR-KGAESYYTRAGSFD 119

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            ++ G +     G L+                  L         + A+ T+T     NLD
Sbjct: 120 FDSTGQMVLPGEGALVQGWAAVNGVVDTNGPLSDLRVP--AGTLMPAVATSTASYEGNLD 177

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
             A   T                  +   YD  G+     + +TK               
Sbjct: 178 AAAANGTILN--------------RTIDVYDATGNVRELQLTFTK------------AAA 211

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAG 289
             + +     A +    ++F         ++                + +DIS  T  AG
Sbjct: 212 GWSVAATDGTATVVAAPMTFAADGSLTTPTTLTV-----------GGVAVDISDLTGFAG 260

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGN 349
               +    NG A G  + F++  DG +   + +G +  I RLAI +  +   L+   G+
Sbjct: 261 IDSVKARTQNGQAAGTLQSFALGADGTITGAFSNGLKQTIGRLAIGSFTNPSGLEKAGGS 320

Query: 350 TYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTG 409
            +  + +SGD  +G  G    G +  GALE +NVD++SE T LI AQR +  NS+V  T 
Sbjct: 321 LFRTSVNSGDPQVGPAGTGGRGTLAGGALEMSNVDLSSEFTSLIIAQRGFQANSRVITTS 380

Query: 410 SDFMDILISLKR 421
            + +  L++LKR
Sbjct: 381 DEVLQELVNLKR 392


>gi|90577344|ref|ZP_01233155.1| flagellar hook protein [Vibrio angustum S14]
 gi|90440430|gb|EAS65610.1| flagellar hook protein [Vibrio angustum S14]
          Length = 408

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 106/414 (25%), Positives = 174/414 (42%), Gaps = 10/414 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA + +++ +S+NIANV T G+K +   FS++      N   +GG+E++  
Sbjct: 2   SFDIALSGLDATNVQLNTISNNIANVSTSGFKESRTEFSAVY-----NGMQAGGVEVAAI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F+ + +  + +  G  L
Sbjct: 57  SQNFDKTGSITGTGRPLDLAISGSGFFVTKDHTGQTLYTRSGVFNSDKDNNIVSNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +          ++ + +  A L A  T       NLD  +++I P   P   
Sbjct: 117 QGYTVDANNNL----QAGAVDNLKITTASLQAKATDDLAFVANLDARSSVINPATNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+      Y++K  +          ++   N          T
Sbjct: 173 NATDSFNSSYTSKVYDSLGNPHTVTQYFSKREEYDPNSPNTTANRWDVNVVVDGDDANIT 232

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
            E       G L + +       +        I IDI+ TTQ    F    +  NG+  G
Sbjct: 233 TEEIIFNTDGTLQSPTAPFAVNFNPAGADAANINIDIAGTTQFGADFGVSTNAPNGYTSG 292

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L   +G +++ +  SG    G 
Sbjct: 293 ELAGVRVEDNGMVFATYTNGQSQLQGQVMLADFANPQGLVKTNGTSWIQSFSSGAPVNGA 352

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           P     G + +GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 353 PSTGTLGGLVAGALEGSNVDLTSELVSLMTAQRNYQANAKTISTSDKLTQSLFN 406


>gi|254695093|ref|ZP_05156921.1| flagellar hook protein FlgE [Brucella abortus bv. 3 str. Tulya]
 gi|261215444|ref|ZP_05929725.1| flagellar hook protein flgE [Brucella abortus bv. 3 str. Tulya]
 gi|260917051|gb|EEX83912.1| flagellar hook protein flgE [Brucella abortus bv. 3 str. Tulya]
          Length = 396

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 239/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L+++K
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNMK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|91792664|ref|YP_562315.1| flagellar hook protein FlgE [Shewanella denitrificans OS217]
 gi|91714666|gb|ABE54592.1| protein of unknown function DUF1078-like protein [Shewanella
           denitrificans OS217]
          Length = 455

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 100/457 (21%), Positives = 178/457 (38%), Gaps = 45/457 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+T+G+K +   F+ +   S      + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNTIGFKESRAEFADVYANSIFSNGKTAVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFF---IVKGRDNVNCLTRAGDFHINNEGFLENV 119
           +       QGSL  T++  DLAI G GFF              +RAG F +++  ++ + 
Sbjct: 62  TQVAQQFSQGSLQFTSNALDLAISGGGFFVTSANIDTSQDQSFSRAGAFKVDSNNYMVDS 121

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
           AG  L  +P+    +   V+     + + +     S + T++  +  NL+    ++ P  
Sbjct: 122 AGNFLQAFPVDETGSSTSVS-LTTTKPVKIPDTAGSPVKTSSIGMQMNLNSGDKVLDPAA 180

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNN 233
                     +   +S   +D+LG S V   Y+ K  +        W V      +  + 
Sbjct: 181 --FDPTDSKTFNKLTSVTMFDSLGESHVMTSYFVKPTNGSYTGESNWVVFYAVDGKQVDL 238

Query: 234 SFPYNVAPLNTVEVS------------------------------FDPVTGYLANSSHKA 263
           +           +                                 DP            
Sbjct: 239 AGTDVGTYQTDTDGDRIADTPQLAQTAGGWRGSVLKFNDVGAYTGSDPAVLTTEALGLPG 298

Query: 264 ISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDD 323
                  +   Q ++I  +  TQ +  F   +   NG   G+  + S+  DG V   Y +
Sbjct: 299 AGILGPGADGTQTLSIAFNNPTQYSSNFEVTELTQNGTTVGRLTNVSIGSDGLVIAKYSN 358

Query: 324 GTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANV 383
           G+ VP+ R+A+    +E  L      ++  + DSG    G       G I S ALE +NV
Sbjct: 359 GSTVPLARVALVRFANEQGLTQVGNTSWKASLDSGPALAGEANSGTFGSIRSSALEQSNV 418

Query: 384 DIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           D+ +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 DLTTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 455


>gi|30062613|ref|NP_836784.1| flagellar hook protein FlgE [Shigella flexneri 2a str. 2457T]
 gi|161485924|ref|NP_706995.2| flagellar hook protein FlgE [Shigella flexneri 2a str. 301]
 gi|30040859|gb|AAP16590.1| flagellar hook protein FlgE [Shigella flexneri 2a str. 2457T]
 gi|313650473|gb|EFS14880.1| flagellar hook protein flgE [Shigella flexneri 2a str. 2457T]
 gi|332758235|gb|EGJ88558.1| flagellar hook protein flgE [Shigella flexneri 4343-70]
 gi|333005591|gb|EGK25109.1| flagellar hook protein flgE [Shigella flexneri K-218]
          Length = 402

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 172/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N  G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLLNTQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP+     P  +        I++ +  ++A  TTT  +  NL+ +  +  P  TP    
Sbjct: 118 GYPV--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PTVTPFSAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  W+V         + +        N  
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNAN 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
               D        +         N +         ++   Q  G      +  NG+ PG 
Sbjct: 234 GTLVDGAMANNIATGA------INGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V     +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINDDGTVVGNNSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++  ++L+
Sbjct: 348 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYKSNAQTIKTQDQILNTRVNLR 402


>gi|260431756|ref|ZP_05785727.1| flagellar hook protein FlgE [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415584|gb|EEX08843.1| flagellar hook protein FlgE [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 439

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 116/431 (26%), Positives = 193/431 (44%), Gaps = 10/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++ + A +NR++ +SDNIAN  T GYKR    F S+V      SY +GG+
Sbjct: 9   MTISSSLNAGVAALKANANRLATISDNIANSSTFGYKRVETDFHSMVTAGQGGSYSAGGV 68

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGF------FIVKGRDNVNCLTRAGDFHINNEG 114
             +++ +I ++GSL+ T ++TDLA+QG+G         +    N   LT  G F  N EG
Sbjct: 69  RTTSQRLIDQRGSLVTTNNSTDLAVQGRGLLPVRPSSQIGTPSNEMLLTTTGSFRTNAEG 128

Query: 115 FLENVAGGVLLGYPLKNA--SAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
           +L   +G VLLG+P  +      +  ++   LE + +   +LS  PTT   +  NL   A
Sbjct: 129 YLVTESGLVLLGWPANSDGSIPNVSRDTPAALEPVQLSVNQLSGAPTTEMNLRMNLPATA 188

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
           T       P+    +              L   V       +      + +         
Sbjct: 189 TDAGASGDPQPLSVEYFDNLGKPETVDIELVPIVPATGSSNQWTMTLRDSASGGAVIGEY 248

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITI--DISKTTQLAGG 290
                +         S   V+G   + +  +   N     ++  + +  D    TQL+  
Sbjct: 249 TLTFTDSRTAGGTLASVTAVSGGAYDPATGSFVVNVAGGPVEVNVGLIGDPDGITQLSDT 308

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F P     +G A G      + ++GYV  +YD G    +Y++ +A VP+ + L   +  T
Sbjct: 309 FAPVSITRDGSAVGTMASVEIDENGYVYALYDTGVTRRMYQIPLADVPNPNGLTALNSQT 368

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y P+R+SG   +   G    GE+ S A E +  D+A+ELT +I+ QR Y+ ++KV QT  
Sbjct: 369 YAPSRESGTYFLWNAGEGPTGELISFAREESTTDVATELTSMIQTQRAYSSSAKVIQTVD 428

Query: 411 DFMDILISLKR 421
           + +    ++KR
Sbjct: 429 EMLQETTNIKR 439


>gi|221639495|ref|YP_002525757.1| Flagellar hook protein FlgE [Rhodobacter sphaeroides KD131]
 gi|221160276|gb|ACM01256.1| Flagellar hook protein FlgE [Rhodobacter sphaeroides KD131]
          Length = 423

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 104/429 (24%), Positives = 178/429 (41%), Gaps = 22/429 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+ +   S    S + V  G++ 
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFADVFNSSPYSISRTAVGSGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEGFL 116
               M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG  
Sbjct: 62  LRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGVA 121

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNAT--- 173
            N +G  LL +P+       +         + +     S + T+T  +S +L  +     
Sbjct: 122 INASGQKLLAWPVSVE-GDALSQVPGSATPLTIPLTMGSPVGTSTVALSVDLPTDDAMLG 180

Query: 174 --IITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
                P            Y   ++   +D  G++V    Y+ KT +            + 
Sbjct: 181 RQAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTAGNPQTD--WAV 238

Query: 232 NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGF 291
                         +++FD        +   +      T+      T+D+++T      F
Sbjct: 239 RLVVAGEPLTPAQGDLTFDATGALSGGTGALSF-----TAASGNSYTLDLTETQLADRSF 293

Query: 292 IPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTY 351
                  +G +        V   G V   Y  G+ V + ++ + T  +   L+    + +
Sbjct: 294 EVNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQVVLVTFANPQALRQLGASGF 353

Query: 352 LPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSD 411
             T DSG    G  G +  G I +GALE ANVD+  EL  LI AQRNY  ++K  +T + 
Sbjct: 354 AATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITAQRNYQASAKAMETSNS 413

Query: 412 FMDILISLK 420
            M  +++++
Sbjct: 414 LMQTIMNIR 422


>gi|119947177|ref|YP_944857.1| flagellar hook protein FlgE [Psychromonas ingrahamii 37]
 gi|119865781|gb|ABM05258.1| flagellar hook protein FlgE [Psychromonas ingrahamii 37]
          Length = 398

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 105/414 (25%), Positives = 177/414 (42%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A + +++ +S+NIANV T G+K +   F+S+     +      G+E+S  
Sbjct: 2   SFNIAISGLNATNKQLNTISNNIANVSTYGFKESRAEFASIYNGGQAG-----GVEVSGI 56

Query: 66  DMISEQ-GSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               ++ GSL  T    DLAI G GFF           TR+G F  + + F+ + AG  L
Sbjct: 57  TQNFDRNGSLEATGRALDLAISGNGFFATVDNKGQQIYTRSGAFSTDKDNFIVSSAGNKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +          ++ + +  A LSA  T +   + N D  AT +         
Sbjct: 117 QGYTVDAKANL----QKGNIDDLAISTASLSAKATDSIEFTANFDARATPVASAA--FDP 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +T   +  A+D+LG++     Y+  TG  +W + +             +V P   
Sbjct: 171 ADPTSFTSSYTAQAFDSLGNAHTVSQYFINTGSNQWNIKVIAD--------DNDVTPDPA 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             + F         S+   +            + ID++ +TQ    F    +  NG+  G
Sbjct: 223 PVIEFTTEGLLADTSTIPILVSIPALGANLIAVEIDLTGSTQYGADFGVSTNNPNGYTAG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G +   + +G      +L +A  P+   L+  +  +++ T  SG    G 
Sbjct: 283 ELTGIRVEDNGMIFAQFTNGQSQLQGQLVLADFPNPTALEQSNNTSWMQTFGSGTPVKGA 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++ S  LET+NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGSGVLGKLTSNMLETSNVDLTSELVSLMTAQRNYQANTKTISTADQLTKALFN 396


>gi|4928060|gb|AAD33398.1|AF129422_1 flagellar hook protein FlgE [Sinorhizobium meliloti]
          Length = 396

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 164/416 (39%), Positives = 229/416 (55%), Gaps = 21/416 (5%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKD 66
           M+T +SGM+AQSNR+S V++NIAN +T GYKR +  FSS++ PS + SY SGG++   + 
Sbjct: 1   MRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGVQTEVRY 60

Query: 67  MISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLG 126
            IS+QG+   T S +DLAI G GFFIV+G +    LTRAG F  ++EG L N +G  L+G
Sbjct: 61  SISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNASGFTLMG 120

Query: 127 YPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           Y  +    P +V +   GL R+N+    L A  +T G +  NL   A +     T     
Sbjct: 121 YEYEAGVDPTVVVNGFDGLTRVNLASDGLIATGSTKGSMGANLPSGAAVGDVSTTS---- 176

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
                        YD+ G++ + D  Y KTG   W V +         +    +      
Sbjct: 177 ----------LVVYDSQGNTRILDFNYEKTGANAWSVEVVD------RTSSTVLGTQTLN 220

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             +   +T   A  +  A++    T      +TID++KTTQL   F      I+G+AP K
Sbjct: 221 FNADGSLTATPATLTTSAMTALPGTGANLSALTIDLTKTTQLGYAFNADGGNIDGNAPSK 280

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + +  DG V + Y++G   P YR+A+A V S D LK   GN Y    DSG I  GF 
Sbjct: 281 VAGYQIDSDGIVYVKYENGKLDPRYRIALANVQSPDKLKPESGNVYSQGVDSGVIITGFA 340

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           G    GEI SGALE++NVDIA ELT +IE+QRNY  NSKVFQTGS+ +++L++LKR
Sbjct: 341 GSGDFGEILSGALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVLVNLKR 396


>gi|212634348|ref|YP_002310873.1| flagellar hook protein FlgE [Shewanella piezotolerans WP3]
 gi|212555832|gb|ACJ28286.1| Flagellar basal body rod protein FlaE [Shewanella piezotolerans
           WP3]
          Length = 453

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 100/455 (21%), Positives = 178/455 (39%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ +    ++  ++NIANV+T G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISSAQKDLNTTANNIANVNTTGFKESRAEFADVYASSIFANSKTTVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNC--LTRAGDFHINNEGFLENVA 120
           S       QGSL  T ++ D+AI G GFF+            TRAG F  ++  ++ + A
Sbjct: 62  SQVAQQFHQGSLQFTNNSLDMAINGGGFFVTSSEIGSQDHSFTRAGAFKFDSNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    E + +     S + T    +  NL+       P   
Sbjct: 122 GNFLQTFPVDKD-GNSTSVSLTTTEPVQIPDTAGSPVKTDNIGMQMNLNAGDKTFDPAN- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD----------------------- 217
                    + + +S   YD+LG   V   Y+ +  +                       
Sbjct: 180 -FDPDDPDTFNNSTSVTMYDSLGEPHVMTTYFVRPPNAAHTGESNWVAFYAVDGKQVDLD 238

Query: 218 ---KKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID 274
                +++           +            +SF+    Y  ++     +      G +
Sbjct: 239 PASGTYDIDTTGDGNPDGTANAETAGGWKGAAISFNDTGAYTGSNPAVIQTEALGVGGAN 298

Query: 275 ---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                    Q +T++ +  TQ A  F   +   +G   G+  +  V  DG ++  Y +G+
Sbjct: 299 VLGPGADGAQTLTLNFNNPTQYASPFEVTELTQDGTTVGRLTNVEVGADGLINASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  + DSG    G       G I S ALE +NVD+
Sbjct: 359 TVPLARVALVRFANEQGLSQAGNTSWKASLDSGPALAGEANSGTFGSIRSSALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|188592117|ref|YP_001796715.1| flagellar hook protein flge [Cupriavidus taiwanensis LMG 19424]
 gi|170938491|emb|CAP63478.1| FlgE: Flagellar hook protein [Cupriavidus taiwanensis LMG 19424]
          Length = 414

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 96/423 (22%), Positives = 177/423 (41%), Gaps = 19/423 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
                +SG++A ++ +  + +NIAN +TVGYK++A  F+ +       + +  G+ +++ 
Sbjct: 2   GFGQGVSGLNAAASNLDVIGNNIANANTVGYKQSAAQFADVYA----GTKIGLGVRVNSV 57

Query: 66  DMISEQGSLMHTASNTDLAI-QGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                QG++  +  + D+AI  G GFF +   +     +R G F    +G + N+ G  +
Sbjct: 58  VQSFNQGNIEASGRSLDVAITNGNGFFRLTSPEGAVYYSRNGQFQRQEDGRITNMQGLQV 117

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK-- 182
            GYP   A    +       + + + +A++    T++      LD  AT+ T        
Sbjct: 118 TGYPAGVAGGAGVQ-----PQPLVISNAQMEPRATSSITAKFQLDSRATVPTQAFASSAG 172

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI-----FRQDQSTNNSFPY 237
                  + + ++   YD+LG+      Y+ K  D                Q        
Sbjct: 173 SPPTSNMFNYSTAINVYDSLGNKQQLMAYFAKVADSAVAPVHPTVAGGTDWQMYVTDVNG 232

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDN-TSGIDQQITIDISKTTQLAGGFIPQKS 296
           N      V ++FD      + ++                 + +D+S TTQ       ++ 
Sbjct: 233 NAVGGAPVTLAFDNAGALQSPAAGAVTLTQPAVNGAQAMAMKLDLSGTTQFGADNDVKQL 292

Query: 297 EINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRD 356
             NG+  G    FSV+ DG +   Y +    P+ ++ +A   + + LK    N +  T  
Sbjct: 293 SQNGYTSGSLLGFSVNGDGTITGNYSNEQTKPLGQIVMAAFGNVEGLKPEGDNVWSATGS 352

Query: 357 SGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           SG   +G  G    G + S A+E +NVD++ +L  LI AQRNY  N++  +     M  L
Sbjct: 353 SGQPLLGVAG-GSLGTLRSNAVEASNVDLSGQLVNLIVAQRNYQANAQTIKAQDTVMQTL 411

Query: 417 ISL 419
           ++L
Sbjct: 412 VNL 414


>gi|153001472|ref|YP_001367153.1| flagellar hook protein FlgE [Shewanella baltica OS185]
 gi|160876203|ref|YP_001555519.1| flagellar hook protein FlgE [Shewanella baltica OS195]
 gi|217972598|ref|YP_002357349.1| flagellar hook protein FlgE [Shewanella baltica OS223]
 gi|151366090|gb|ABS09090.1| flagellar basal body FlaE domain protein [Shewanella baltica OS185]
 gi|160861725|gb|ABX50259.1| flagellar basal body FlaE domain protein [Shewanella baltica OS195]
 gi|217497733|gb|ACK45926.1| flagellar basal body FlaE domain protein [Shewanella baltica OS223]
 gi|315268393|gb|ADT95246.1| fagellar hook-basal body protein [Shewanella baltica OS678]
          Length = 453

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 98/455 (21%), Positives = 176/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIAN +T+G+K +   F+ +   S    S + V GG+  
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANANTIGFKESRAEFADVYANSIFSNSKTAVGGGVAT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV--NCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T+++ D+AI+G GFF+         +  TRAG F +++  ++ + A
Sbjct: 62  SQVAQQFHQGSLQLTSNSLDMAIKGGGFFVTASEIGSLDHSFTRAGAFKVDSNNYMVDSA 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S + T    +  NL+   + + P   
Sbjct: 122 GNFLQTFPVDKD-GNSTSVSLTTAKPVQIPDTAGSPIKTENVSLQMNLNAKESTLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + +S   YD+LG   +   Y+ K  D        W        +  +  
Sbjct: 180 -FDPLDPKTYNNVTSMTMYDSLGEPHIMTTYFVKPNDASYNGESNWVAYYAIDGKQVDLD 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHK-----------------------------AIS 265
                   +T        T     +                                   
Sbjct: 239 GAAGTYQTDTTGDGNPDSTSTAQTTGGWKGSVLKFNSVGVYTGSDPAVVKTETLGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +TI  +  TQ A  F   +   +G   G+  +  +  DG +   Y +G+
Sbjct: 299 VLGAGADGTQDLTIKFNAPTQYAAPFAATELTQDGTTVGRLTNVEIGADGLITASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+    +E  L      ++  + +SG    G       G I S ALE +N+D+
Sbjct: 359 SVPLARVALVRFANEQGLTQVGNTSWKASLNSGPALAGEANSGTFGSISSSALEQSNIDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|317047691|ref|YP_004115339.1| flagellar hook-basal body protein [Pantoea sp. At-9b]
 gi|316949308|gb|ADU68783.1| flagellar hook-basal body protein [Pantoea sp. At-9b]
          Length = 406

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 109/416 (26%), Positives = 187/416 (44%), Gaps = 12/416 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+ A S+ +  + +NIAN  T G+K + IAF+ L       S V  G +++  
Sbjct: 2   SFSQAVSGLSAASSNLDVIGNNIANSATAGFKSSTIAFADLFA----GSDVGLGTKVAAV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T+   D+A+ G GFF +         +R G F ++    L N  G  + 
Sbjct: 58  IQNFNDGTTTTTSRGLDVALSGNGFFRMTDSSGAVYYSRNGQFTLDENRNLVNTQGLYVT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP   + +P  + +      +++   ++SA  TTT     NL+  + I  P  T   + 
Sbjct: 118 GYPA--SGSPATIQTGANPVALSIPTTQMSAKATTTATQVANLNSTSDI--PSVTTFDSS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  KS+   YD+ G+    D+YY KTGD  W V       ST  +   +       
Sbjct: 174 NVDSYNAKSTMTVYDSQGNDHTLDMYYVKTGDNAWTVHAVD---STTGASAGDFDLTFDS 230

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK-TTQLAGGFIPQKSEINGHAPG 304
             +   V G    ++        N +   Q IT+++     Q  G         +G+APG
Sbjct: 231 SGNLTSVGGVTGATTVALSIDGTNGAAAGQSITLNMQGSLQQNTGTTTFGNPTQDGYAPG 290

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               ++++ DG +   Y +     + ++ +A+  + + L+    N +  T  SG  +IG 
Sbjct: 291 DLTTYTINDDGTITGTYSNQQTQLLGQIVLASFSNPEGLQSEGDNVWSATSSSGQAAIGT 350

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 351 AGTGTFGSLTAGALEASNVDLSQELVNMIVAQRNYQANAQTIKTQDQILNTLVNLR 406


>gi|330447903|ref|ZP_08311551.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492094|dbj|GAA06048.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 398

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 108/414 (26%), Positives = 175/414 (42%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA + +++ +S+NIANV T G+K +   FS++      N   +GG+E++  
Sbjct: 2   SFDIALSGLDATNVQLNTISNNIANVSTSGFKESRTEFSAVY-----NGMQAGGVEVAAI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F  + +  + +  G  L
Sbjct: 57  SQNFDKTGSITGTGRPLDLAISGSGFFVTKDHTGQTLYTRSGVFGSDKDNNIVSNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +          +  + +  A L A  T       NLD  +++I P   P   
Sbjct: 117 QGYTVDANNNL----QAGAVGNLKITTASLPAKATDELAFVANLDARSSVIDPAINPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+      Y+TKT   +W+V++               A  + 
Sbjct: 173 NSTDSFNSSYTSKVYDSLGNPHTVTQYFTKTNANEWQVNVVVD----------GAATPSQ 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
            +       G L   +       +        I IDI+ TTQ    F    +  NG+  G
Sbjct: 223 TQNVAFNTDGTLQLPTAPFAVNFNPAGADAANINIDIAGTTQFGADFGVSTNAPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L   +G +++ +  SG    G 
Sbjct: 283 ELAGVRVEDNGMVFATYTNGQSQLQGQVMLADFANPQGLVKTNGTSWIQSFSSGAPVNGA 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           P     G + +GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PSTGTLGGLVAGALEGSNVDLTSELVSLMTAQRNYQANAKTISTSDKLTQSLFN 396


>gi|116049009|ref|YP_792189.1| flagellar hook protein FlgE [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296390556|ref|ZP_06880031.1| flagellar hook protein FlgE [Pseudomonas aeruginosa PAb1]
 gi|313106035|ref|ZP_07792294.1| flagellar hook protein FlgE [Pseudomonas aeruginosa 39016]
 gi|115584230|gb|ABJ10245.1| flagellar hook protein FlgE [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310878796|gb|EFQ37390.1| flagellar hook protein FlgE [Pseudomonas aeruginosa 39016]
          Length = 462

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 108/468 (23%), Positives = 181/468 (38%), Gaps = 60/468 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A S+ ++   +NIAN  TVG+K++   F+ +   S   + ++    G+ +
Sbjct: 2   SFNIGLSGIQAASSGLNVTGNNIANAGTVGFKQSRAEFADVYAASVLGSGSNPQGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S    + +QG++  T S  DLAI G GFF+    +     TRAG F+ + + F+ +  G 
Sbjct: 62  SDVSQMFKQGNIDSTNSVLDLAINGNGFFVT-SNNGAISYTRAGYFNTDKQDFIVDNNGY 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY +                    K    +  P  T  I  + + N+T+  P  TP 
Sbjct: 121 RLQGYAVGPNGQLQNGVVTDL------KVERANQAPQATSSIQQSYNLNSTLKPPTVTPF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD----------KKWEVSIFRQD---- 228
                A Y   SS   YD+ G+S     ++ K               W + +        
Sbjct: 175 DPSDAATYNSSSSLGIYDSQGNSHTMSQFFIKNEPDPNATPPIPENSWTMKVLIDGVNPL 234

Query: 229 -------------------------QSTNNSFPYNVAPLNTVEVSFDPVTGYLA------ 257
                                       + S P       T  + F P TG         
Sbjct: 235 DPSNKTPMSFNVTFDASGQMTSVRAPDGSTSGPGFSIDATTNVIQFSPATGNPPTPGTGW 294

Query: 258 -----NSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVS 312
                +         +  +G    I+ D+ KTTQ +  F       +G+  G+     + 
Sbjct: 295 IPAASDGKTPPTYAWNGATGAASGISFDMRKTTQYSTAFAQSNPIQDGYTTGQLAGLEID 354

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
             G +   Y +G      ++ +A   +   L      +++ + +SG+ ++G P     G 
Sbjct: 355 DTGVIFARYTNGQSKVQGQVVLANFANIQGLTPIGKTSWVQSAESGEPAVGAPRSGTLGA 414

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + SGALE +NVDI++EL  LI  QRNY  N+K  QT       +I+L+
Sbjct: 415 LQSGALEASNVDISNELVNLIVHQRNYQANAKTIQTEDAVTQTIINLR 462


>gi|15596277|ref|NP_249771.1| flagellar hook protein FlgE [Pseudomonas aeruginosa PAO1]
 gi|107100525|ref|ZP_01364443.1| hypothetical protein PaerPA_01001550 [Pseudomonas aeruginosa PACS2]
 gi|218892956|ref|YP_002441825.1| flagellar hook protein FlgE [Pseudomonas aeruginosa LESB58]
 gi|254234216|ref|ZP_04927539.1| flagellar hook protein FlgE [Pseudomonas aeruginosa C3719]
 gi|254239438|ref|ZP_04932760.1| flagellar hook protein FlgE [Pseudomonas aeruginosa 2192]
 gi|9946996|gb|AAG04469.1|AE004539_11 flagellar hook protein FlgE [Pseudomonas aeruginosa PAO1]
 gi|126166147|gb|EAZ51658.1| flagellar hook protein FlgE [Pseudomonas aeruginosa C3719]
 gi|126192816|gb|EAZ56879.1| flagellar hook protein FlgE [Pseudomonas aeruginosa 2192]
 gi|218773184|emb|CAW28996.1| flagellar hook protein FlgE [Pseudomonas aeruginosa LESB58]
          Length = 462

 Score =  236 bits (601), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 108/468 (23%), Positives = 181/468 (38%), Gaps = 60/468 (12%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S    +SG+ A S+ ++   +NIAN  TVG+K++   F+ +   S   + ++    G+ +
Sbjct: 2   SFNIGLSGIQAASSGLNVTGNNIANAGTVGFKQSRAEFADVYAASVLGSGSNPQGSGVLL 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGG 122
           S    + +QG++  T S  DLAI G GFF+    +     TRAG F+ + + F+ +  G 
Sbjct: 62  SDVSQMFKQGNIDSTNSVLDLAINGNGFFVT-SNNGAISYTRAGYFNTDKQDFIVDNNGY 120

Query: 123 VLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPK 182
            L GY +                    K    +  P  T  I  + + N+T+  P  TP 
Sbjct: 121 RLQGYAVGPNGQLQNGVVTDL------KVERANQAPQATSSIQQSYNLNSTLKPPTVTPF 174

Query: 183 HNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD----------KKWEVSIFRQD---- 228
                A Y   SS   YD+ G+S     ++ K               W + +        
Sbjct: 175 DPSDAATYNSSSSLGIYDSQGNSHTMSQFFIKNEPDPNATPPIPENSWTMKVLIDGVNPL 234

Query: 229 -------------------------QSTNNSFPYNVAPLNTVEVSFDPVTGYLA------ 257
                                       + S P       T  + F P TG         
Sbjct: 235 DPSNKTPMSFNVTFDASGQMTSVRAPDGSTSGPGFSIDATTNVIQFSPATGNPPTPGTGW 294

Query: 258 -----NSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVS 312
                +         +  +G    I+ D+ KTTQ +  F       +G+  G+     + 
Sbjct: 295 IPAASDGKTPPTYAWNGATGAASGISFDMRKTTQYSTAFAQSNPIQDGYTTGQLAGLEID 354

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
             G +   Y +G      ++ +A   +   L      +++ + +SG+ ++G P     G 
Sbjct: 355 DTGVIFARYTNGQSKVQGQVVLANFANIQGLTPIGKTSWVQSSESGEPAVGAPRSGTLGA 414

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + SGALE +NVDI++EL  LI  QRNY  N+K  QT       +I+L+
Sbjct: 415 LQSGALEASNVDISNELVNLIVHQRNYQANAKTIQTEDAVTQTIINLR 462


>gi|89072315|ref|ZP_01158894.1| flagellar hook protein [Photobacterium sp. SKA34]
 gi|89051847|gb|EAR57299.1| flagellar hook protein [Photobacterium sp. SKA34]
          Length = 398

 Score =  236 bits (601), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 108/414 (26%), Positives = 174/414 (42%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA + +++ +S+NIANV T G+K +   FS++      N   +GG+E++  
Sbjct: 2   SFDIALSGLDATNIQLNTISNNIANVSTSGFKESRTEFSAVY-----NGMQAGGVEVAAI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F  + +  + +  G  L
Sbjct: 57  SQNFDKTGSITGTGRPLDLAISGSGFFVTKDLTGQTLYTRSGVFGSDKDNNIVSNNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +          +  + +  A L A  T       NLD  +++I P   P   
Sbjct: 117 QGYTVDANNNL----QAGAVGNLKITTASLPAKATDELAFVANLDARSSVIDPAINPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+      Y+TKT   +W+V++               A    
Sbjct: 173 NATDSFNSSYTSKVYDSLGNPHTVTQYFTKTNANEWQVNVVVD----------GAATPTQ 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
            +       G L + +                I IDI+ TTQ    F    +  NG+  G
Sbjct: 223 TQNVVFNTDGTLQSPTAPFAVNFIPAGADAANINIDIAGTTQFGANFGVSTNAPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L   +G +++ +  SG    G 
Sbjct: 283 ELAGVRVEDNGMVFAAYTNGQSQLQGQVMLADFANPQGLVKTNGTSWIQSFSSGAPVNGA 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           P     G + +GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PSTGTLGGLVAGALEGSNVDLTSELVSLMTAQRNYQANAKTISTSDKLTQSLFN 396


>gi|332558508|ref|ZP_08412830.1| FlgE [Rhodobacter sphaeroides WS8N]
 gi|12057218|gb|AAF14370.2|AF133240_4 flagellar hook protein FlgE [Rhodobacter sphaeroides]
 gi|332276220|gb|EGJ21535.1| FlgE [Rhodobacter sphaeroides WS8N]
          Length = 423

 Score =  236 bits (601), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 101/428 (23%), Positives = 171/428 (39%), Gaps = 20/428 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+ +   S    S + V  G++ 
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFADVFNSSPYSISRTAVGSGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEGFL 116
               M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG  
Sbjct: 62  LRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGVA 121

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS----AMPTTTGFISNNLDKNA 172
            N +G  LL +P+      L                        +  +    ++N     
Sbjct: 122 INASGQKLLAWPVSVEGDALSQVPGSATPLTIPLTMGSPVGTSTVALSVDLPTDNAMLGR 181

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
               P            Y   ++   +D  G++V    Y+ KT +            +  
Sbjct: 182 QAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTAGNPQTD--WAVR 239

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
                        +++FD        +   +      T+      T+D+++T      F 
Sbjct: 240 LVVAGEPLTPAQGDLTFDATGALSGGTGALSF-----TAASGNSYTLDLTETQLADRSFE 294

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G +        V   G V   Y  G+ V + ++ + T  +   L+    + + 
Sbjct: 295 VNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQVVLVTFANPQALRQLGASGFA 354

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T DSG    G  G +  G I +GALE ANVD+  EL  LI AQRNY  ++K  +T +  
Sbjct: 355 ATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITAQRNYQASAKAMETSNSL 414

Query: 413 MDILISLK 420
           M  +++++
Sbjct: 415 MQTIMNIR 422


>gi|170722892|ref|YP_001750580.1| flagellar hook protein FlgE [Pseudomonas putida W619]
 gi|169760895|gb|ACA74211.1| flagellar basal body FlaE domain protein [Pseudomonas putida W619]
          Length = 451

 Score =  236 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 92/450 (20%), Positives = 169/450 (37%), Gaps = 37/450 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP----STSNSYVSGGLE 61
           S    +SG+ A + ++    +NIANV+T G+K +   F+ +           + V  G+ 
Sbjct: 2   SFNIGLSGLYAANKQLDVTGNNIANVNTTGFKSSRAEFADVYAGANRLGVGKNQVGNGVR 61

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
           ++       QG + +T +  D+ IQG+GFF++   +     TRAG F  +   F+    G
Sbjct: 62  LAAISQQFSQGDVNNTGNVLDMGIQGQGFFVLSD-NGSRVYTRAGAFQADKNNFVVTSDG 120

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK------NATII 175
             L GY                    +    + +++      ++++         + T  
Sbjct: 121 LRLQGYAADANGKIQKGVLSDLQIDTSALQPKATSLIDQGINLNSSATDIPLEIDDGTGA 180

Query: 176 TPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF 235
                P     +  YT       YD+ G+    + +Y KTG  +W +      ++  +  
Sbjct: 181 MVPNLPFDPTDETTYTKSFPTKVYDSQGNEHTMEQFYRKTGTNEWTMYTLVDGRNPFDPA 240

Query: 236 PYNVAPLNTVEVSFDPVTGYLANSSHKA--------------------------ISFNDN 269
                       S   V+G  A+++                                ++ 
Sbjct: 241 STTPLTGTISFSSDGSVSGMTADNTGHPAGASFTVTNNTFTMTGWVPAVEDAAGNWASNG 300

Query: 270 TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
            +G    + + ++ TT             +G+A G     S+   G +   + +     I
Sbjct: 301 AAGNADGMKLSMNSTTSYNTETARMSQSQDGYATGILSSLSIDSTGVLFASFSNQQSRAI 360

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASEL 389
            ++A+A+  +E  L+   G  +  T  SG   I  P     G + S ALE +NV++  EL
Sbjct: 361 GQVALASFANEQGLQQIGGTRWTETFSSGLPGIDEPKTGTLGSVESNALEASNVNLTQEL 420

Query: 390 TELIEAQRNYAVNSKVFQTGSDFMDILISL 419
            ELI+AQ NY  N+K   T S  M  +I +
Sbjct: 421 VELIKAQSNYQANAKTISTESTIMQTIIQM 450


>gi|331671804|ref|ZP_08372600.1| LfgE [Escherichia coli TA280]
 gi|331070793|gb|EGI42152.1| LfgE [Escherichia coli TA280]
          Length = 400

 Score =  236 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 189/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKNGYIVNASGDYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +A           +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDAGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  +G+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAADGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLTSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|254227983|ref|ZP_04921413.1| Flagellar hook protein FlgE [Vibrio sp. Ex25]
 gi|262396035|ref|YP_003287888.1| flagellar hook protein FlgE [Vibrio sp. Ex25]
 gi|151939479|gb|EDN58307.1| Flagellar hook protein FlgE [Vibrio sp. Ex25]
 gi|262339629|gb|ACY53423.1| flagellar hook protein FlgE [Vibrio sp. Ex25]
          Length = 398

 Score =  236 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 109/414 (26%), Positives = 171/414 (41%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFSAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F  + + F+   +G  L
Sbjct: 57  SQNFDKDGSISGTGRAMDLAINGGGFFVTKDNMGQTLYTRSGVFATDKDNFVTANSGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +          +  I V  + L+A  T       N D +A+ I    TP + 
Sbjct: 117 QGYSVDSNNNL----MTGSVGNIQVSTSSLNAKATDGLDFVANFDASASAIDKTVTPFNP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+S     Y+TKT    WEV++               A   T
Sbjct: 173 DDPNSFNSSYTTKVYDSLGNSHTVTQYFTKTASNSWEVNVQVD----------GGATPVT 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L++ +                + I++  +TQ    F    +  NG+  G
Sbjct: 223 TVPVTFDKDGSLSSPTAPFNVSFPAAGANAMSVDINLKGSTQFGAKFGVSTNSPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG    G 
Sbjct: 283 ELAGVRVEGNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTAWTQSFSSGAPITGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGSGTLGDLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQALFN 396


>gi|300024588|ref|YP_003757199.1| flagellar hook-basal body protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526409|gb|ADJ24878.1| flagellar hook-basal body protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 417

 Score =  236 bits (600), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 163/423 (38%), Positives = 237/423 (56%), Gaps = 8/423 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MG+ G M T++SGM  QS+R+  V+DNIANV+T GYK  +  F++LV      SYV G +
Sbjct: 1   MGLYGLMTTSISGMAVQSDRMGTVADNIANVNTTGYKEASAEFATLVAEGHVASYVPGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  ++ QG L +T S TDLA+ G GFF+V+       LTRAG F I+  G L N A
Sbjct: 61  STIARRAVTHQGDLSYTNSPTDLAVSGNGFFMVQSPSGTPYLTRAGSF-ISTNGELVNAA 119

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLGY L N  +  ++NS  GL  +   +  L A P+T+G    NL  +A + T   +
Sbjct: 120 GFTLLGYDLLNGGSSSVINSAAGLVPVGTANLGLKATPSTSGNFQVNLPSDAAVSTSLPS 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSF--PYN 238
              N   A++  K+S   YD LG  V  D+Y  KTG  +WEVS++    ++         
Sbjct: 180 --ANAAGADFAGKTSIITYDNLGHKVTLDIYSAKTGPNQWEVSVYDNAGASAGGGFPYAA 237

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
            + L T  ++F   TG L + S   +S N         +  ++  TTQLAG +IP  +  
Sbjct: 238 GSQLTTQALTFSGTTGKLTSPSPATLSVNVPNGAT---LNFNMGNTTQLAGAYIPVDASA 294

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           NG+ P       +S  G V  +Y DG+RV  +++ +A V S DNL    GN +   ++SG
Sbjct: 295 NGNGPSAVDRLEISAQGIVTAVYADGSRVDAFKIPLANVASPDNLTAISGNVFATNKESG 354

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           D+ +G       G+I SGALE ++VD+ASELT ++EAQR+Y  NSKVFQTG++ +D+L++
Sbjct: 355 DLQLGTANSGSLGKIVSGALEKSSVDLASELTTMVEAQRSYTANSKVFQTGTELLDVLVN 414

Query: 419 LKR 421
           L R
Sbjct: 415 LVR 417


>gi|319406994|emb|CBI80631.1| Flagellar hook protein FlgE [Bartonella sp. 1-1C]
          Length = 402

 Score =  236 bits (600), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 136/421 (32%), Positives = 195/421 (46%), Gaps = 19/421 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M+T +SGM+AQ  R+S V+DN+AN  T+GYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MGIYGMMRTGVSGMNAQGTRLSGVADNVANAGTIGYKRTDVQFSNYVTPSGKYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      +S  G    T  + D  I G GFF V   +    LTRAG F  + +G+L N A
Sbjct: 61  KSHIGHDVSIGGPARATGRSGDTMIHGNGFFRVADENGKEFLTRAGSFIRDKDGYLRNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL                + ++             TT      N + +A ++ P   
Sbjct: 121 GYYLLN------------EDGEKIQIKGGPTDLFGPEATTKIDFKANFNPSAKVVEPKDG 168

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
             +      Y+ K S   YD+ G  V  D Y  KT + KW V  +        S  +N  
Sbjct: 169 TINPENPETYSQKKSMTTYDSQGKKVQVDFYMRKTDENKWVVDAYSD-GKKVGSTEFNFD 227

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
               +          L +S       N N  G+        S  TQ    F  +  E +G
Sbjct: 228 KEGNLIEPTKEFKLTLPDSEGNTFEVNVNFGGVGAD-----SLVTQKGNLFAFEG-EADG 281

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G    F+  K+G ++++Y +     I  + + TV S D+L    G  +     +G  
Sbjct: 282 MESGAFDGFTFGKNGEIEVMYSNQKTRTIGYIGVTTVASTDSLTFLGGTVFETNSQTGPQ 341

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +G PG    G + SG LE +NVD+  ELT++IEAQRNY  NSKVFQTGS+ MD++++LK
Sbjct: 342 MMGRPGDGVFGTLSSGYLEDSNVDMGDELTDMIEAQRNYTANSKVFQTGSELMDVIVNLK 401

Query: 421 R 421
           R
Sbjct: 402 R 402


>gi|254698190|ref|ZP_05160018.1| flagellar hook protein FlgE [Brucella abortus bv. 2 str. 86/8/59]
 gi|260762637|ref|ZP_05874969.1| flagellar hook protein flgE [Brucella abortus bv. 2 str. 86/8/59]
 gi|260673058|gb|EEX59879.1| flagellar hook protein flgE [Brucella abortus bv. 2 str. 86/8/59]
          Length = 396

 Score =  235 bits (599), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 238/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN  TVGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDL I G G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLTIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S D + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTG + MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|331645418|ref|ZP_08346522.1| LfgE [Escherichia coli M605]
 gi|331045580|gb|EGI17706.1| LfgE [Escherichia coli M605]
          Length = 400

 Score =  235 bits (599), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 123/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  +G+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAADGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|77463652|ref|YP_353156.1| flagellar hook protein FlgE [Rhodobacter sphaeroides 2.4.1]
 gi|77388070|gb|ABA79255.1| flagellar hook protein FlgE [Rhodobacter sphaeroides 2.4.1]
          Length = 423

 Score =  235 bits (599), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 101/428 (23%), Positives = 171/428 (39%), Gaps = 20/428 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+ +   S    S + V  G++ 
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFADVFNSSPYSISRTAVGSGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEGFL 116
               M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG  
Sbjct: 62  LRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGVA 121

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS----AMPTTTGFISNNLDKNA 172
            N +G  LL +P+      L                        +  +    ++N     
Sbjct: 122 INASGQKLLAWPVSVEGDALSQVPGSATPLTIPLTMGSPVGTSTVALSVDLPTDNAMLGT 181

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
               P            Y   ++   +D  G++V    Y+ KT +            +  
Sbjct: 182 QAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTAGNPQTD--WAVR 239

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
                        +++FD        +   +      T+      T+D+++T      F 
Sbjct: 240 LVVAGEPLTPAQGDLTFDATGALSGGTGALSF-----TAASGSSYTLDLTETQLADRSFE 294

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G +        V   G V   Y  G+ V + ++ + T  +   L+    + + 
Sbjct: 295 VNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQVVLVTFANPQALRQLGASGFA 354

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T DSG    G  G +  G I +GALE ANVD+  EL  LI AQRNY  ++K  +T +  
Sbjct: 355 ATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITAQRNYQASAKAMETSNSL 414

Query: 413 MDILISLK 420
           M  +++++
Sbjct: 415 MQTIMNIR 422


>gi|260767923|ref|ZP_05876857.1| flagellar hook protein FlgE [Vibrio furnissii CIP 102972]
 gi|260615953|gb|EEX41138.1| flagellar hook protein FlgE [Vibrio furnissii CIP 102972]
          Length = 398

 Score =  235 bits (599), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 108/414 (26%), Positives = 173/414 (41%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFSAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDSMGQTLYTRSGVFGTDKDNYVVGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +  ++  L       +  I +  + LSA  T +     N + +A  I     P   
Sbjct: 117 QGYSVDGSNNLL----SGSVGDIKISTSSLSAKATDSLEFVANFNASADAIDQTVYPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +  AYD+LG+S     Y+TKT D  WEV++               A  + 
Sbjct: 173 ADPNSFNSSYTSKAYDSLGNSHTVTQYFTKTADNTWEVNVQVD----------GAATASA 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L++ +                I + ++ +TQ    F    +  NG+  G
Sbjct: 223 TVPVTFNTDGTLSSPTGSFNVAFPAAGANAMSIDVSLTGSTQFGADFGVSTNNPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG  ++G 
Sbjct: 283 ELAGVRVEGNGMVYATYTNGESQLQGQVVLANFANPQGLAKVSGTAWTQSFSSGSPTVGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGTGTLGDLTPGALEGSNVDLTSELVSLMTAQRNYQANAKTISTEDKLTQALFN 396


>gi|293408367|ref|ZP_06652206.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291471545|gb|EFF14028.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 400

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 188/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ ++           +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDSGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSDFSVTTNSANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLTSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|157147102|ref|YP_001454421.1| hypothetical protein CKO_02879 [Citrobacter koseri ATCC BAA-895]
 gi|157084307|gb|ABV13985.1| hypothetical protein CKO_02879 [Citrobacter koseri ATCC BAA-895]
          Length = 396

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 117/414 (28%), Positives = 188/414 (45%), Gaps = 22/414 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A SG++A + +++A+S+NIAN  TVG+K     FSSL   S        G+ +S  
Sbjct: 2   SFNIATSGLNAITEQLNAISNNIANSGTVGFKSGRAEFSSLYAESQP-----LGVGVSGV 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              I+  G++  T +  DLAI   GFF+V+        TRAG F  ++ G L N  G  L
Sbjct: 57  TQSITRGGNISTTGNALDLAISDSGFFMVRDSTGTTAYTRAGYFGTDSSGNLINNLGMYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+       +      +  + +    + A  T +   + NLD  A    P+  P + 
Sbjct: 117 QGYPVNANGEIEV----GTIGNLTISSGSIPAKATDSLDFTANLDARAA--EPETAPFNP 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y +  +   +D+LG     + Y+ KTG+  W+V  +            +V   ++
Sbjct: 171 KDSTSYNNTYTTQVFDSLGREHTLNQYFVKTGENTWQVHYYMD----------DVEIPDS 220

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
            +       G L +           +   D  I +  + T+Q    F   K+  +G+A G
Sbjct: 221 SQAIEFTEQGVLKSPVGLTNLTTSISGAADLSIDLSYNGTSQYGSDFSVSKNNSSGYASG 280

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +    ++ +DG V   + +G R+   +L +A   + + L   DG T++ T  SG    G 
Sbjct: 281 ERTGQAIDEDGSVYATFSNGERMLQGQLVLANFANPNGLASKDGTTWVQTASSGAPLTGT 340

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SGALE++NVD+ SEL  L+ AQRNY  N+KV  T  + M+ L  
Sbjct: 341 PGTGLLGSVKSGALESSNVDLTSELVGLMTAQRNYQANTKVISTNDNMMNALFQ 394


>gi|157376216|ref|YP_001474816.1| flagellar hook protein FlgE [Shewanella sediminis HAW-EB3]
 gi|157318590|gb|ABV37688.1| flagellar basal body FlaE domain protein [Shewanella sediminis
           HAW-EB3]
          Length = 454

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 103/456 (22%), Positives = 174/456 (38%), Gaps = 44/456 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+++G+K +   F+ +   S    S + V GG   
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNSIGFKESRAEFADVYANSIFANSKTGVGGGATT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T +  D+AI G GFF+            TRAG F +++  +L +  
Sbjct: 62  SHVAQQFHQGSLQFTNNALDMAINGGGFFVTSSGFSSQDLSYTRAGAFKVDSNSYLVDSQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  + +          S    + + +     S   T    I  NL+       P   
Sbjct: 122 GNFLQAFEVDKD-GNSTSVSLTETKPVRIPDTAGSPKKTENVGIQMNLNAGDGTKDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + ++   YD+LG   V   Y+ +  +        W        +  + +
Sbjct: 179 LFDPSDRDTYNNSTAVTMYDSLGEPHVMTTYFVRPNNAAYNLESNWVAFYAVDGKQVDIA 238

Query: 235 FP---------------------YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI 273
            P                       +       + F+ +  +        I+      G 
Sbjct: 239 GPVVNYDTDTSGNGTVDGNAPAQATLGNWKGSVIKFNELGSHTTTDPATIITETLGNGGA 298

Query: 274 D---------QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG 324
           D         Q +TID    TQ A  F   +   +G   G+  +  V  DG ++  Y +G
Sbjct: 299 DVLGPGTDGSQALTIDFDNPTQYASAFEVTELTQDGTTVGRLTNVEVGADGLINASYSNG 358

Query: 325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVD 384
             V + R+A+A   +E  L      ++  + DSG    G       G I S ALE +NVD
Sbjct: 359 ATVALARVALARFANEQGLTQVGNTSWKASLDSGAALAGEANSGTFGSIRSSALEQSNVD 418

Query: 385 IASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           + +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 LTTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 454


>gi|146281771|ref|YP_001171924.1| flagellar hook protein FlgE [Pseudomonas stutzeri A1501]
 gi|145569976|gb|ABP79082.1| flagellar hook protein FlgE [Pseudomonas stutzeri A1501]
          Length = 438

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/443 (24%), Positives = 187/443 (42%), Gaps = 36/443 (8%)

Query: 7   MKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIS 63
              A+SG++A S  ++   +NIANV T G+K +   F+ L   S   +  + V  G+  +
Sbjct: 3   FNVALSGLNAASTDLNVTGNNIANVGTTGFKASRAEFADLYATSMLGSGGNAVGSGVTTA 62

Query: 64  TKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGV 123
                  QG++ +T ++ DLAI G G+F+V   +     TRAG F  ++EG++ N  G  
Sbjct: 63  DIAQQFTQGNITNTGNSLDLAISGNGYFMV-SNNGSMLYTRAGAFKTDDEGYVINSEGYN 121

Query: 124 LLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
           L GY +      +   +       N+K    +  P  T  +   L  N+    P+ TP  
Sbjct: 122 LQGYGVNANGDIVSGVTT------NLKVDSSNQAPNATSSVVETLALNSNSSVPNNTPFD 175

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNN---------- 233
               + Y   +S   YDT G+S     Y+ K    +W +      ++  +          
Sbjct: 176 ASDSSTYNWSTSVPLYDTQGNSHTMTQYFVKDDSNQWTMYTLIDGRNPADPTSTEAYEVS 235

Query: 234 ---------------SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT 278
                          S  ++V    T+ ++         +++      ++  +     I+
Sbjct: 236 IGFTASGALDLTSLASTDFDVNADGTLTLNTWVPATVTDSTTSPVTWGSNGAAASASGIS 295

Query: 279 IDISKTTQLAGGFIP-QKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
           ID+   +Q    F        +G+  G+    S+   G +   Y +G    I ++ +A  
Sbjct: 296 IDLRNISQTNTSFAVLSSPVQDGYTTGQLSGLSIDDTGMMFATYTNGQSKVIGQVVLANF 355

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
            +   L    G  +  T  SG+ +IG PG    G + SGALE +NVD+ ++L  LI AQR
Sbjct: 356 TNSQGLASVGGTAWAQTLASGEPAIGTPGSGTLGSLQSGALEDSNVDLTAQLVNLIVAQR 415

Query: 398 NYAVNSKVFQTGSDFMDILISLK 420
           NY  N+K  +T S     +I+L+
Sbjct: 416 NYQANAKTVETESAIAQTIINLR 438


>gi|59889780|emb|CAH19136.1| Lateral flagellar hook protein (FlgE-like) [Escherichia coli]
 gi|284920044|emb|CBG33101.1| lateral flagellar hook protein (FlgE-like) [Escherichia coli 042]
          Length = 400

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 188/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ ++           +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDSGTLQT----GTVTDIQIKTGNIPAQASSSLIFTANFDASDDAIDRTTVPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPAMT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|315179626|gb|ADT86540.1| flagellar hook protein E [Vibrio furnissii NCTC 11218]
          Length = 398

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/414 (26%), Positives = 172/414 (41%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFSAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVTGTGRAMDLAINGSGFFVTKDSMGQTLYTRSGVFGTDKDNYVVGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L       +  I +  + LSA  T +     N + +A  I     P   
Sbjct: 117 QGYSVDGNNNLL----SGSVGDIKISTSSLSAKATDSLEFVANFNASADAIDQTVYPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +  AYD+LG+S     Y+TKT D  WEV++               A  + 
Sbjct: 173 ADPNSFNSSYTSKAYDSLGNSHTVTQYFTKTADNTWEVNVQVD----------GAATASA 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L++ +                I + ++ +TQ    F    +  NG+  G
Sbjct: 223 TVPVTFNTDGTLSSPTGSFNVAFPAAGANAMSIDVSLTGSTQFGADFGVSTNNPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG  ++G 
Sbjct: 283 ELAGVRVEGNGMVYATYTNGESQLQGQVVLANFANPQGLAKVSGTAWTQSFSSGSPTVGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGTGTLGDLTPGALEGSNVDLTSELVSLMTAQRNYQANAKTISTEDKLTQALFN 396


>gi|126462484|ref|YP_001043598.1| flagellar basal body FlaE domain-containing protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126104148|gb|ABN76826.1| flagellar basal body FlaE domain protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 423

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 101/428 (23%), Positives = 171/428 (39%), Gaps = 20/428 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+ +   S    S + V  G++ 
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFADVFNSSPYSISRTAVGSGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEGFL 116
               M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N EG  
Sbjct: 62  LRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNAEGVA 121

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS----AMPTTTGFISNNLDKNA 172
            N +G  LL +P+      L                        +  +    ++N     
Sbjct: 122 INASGQKLLAWPVSVEGDALSQVPGSATPLTIPLTMGSPVGTSTVALSVDLPTDNAMLGT 181

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
               P            Y   ++   +D  G++V    Y+ KT +            +  
Sbjct: 182 QAAVPPAAAFDPADPTTYAAVTAVPIFDAKGNAVEAAAYFIKTANPTAGNPQTD--WAVR 239

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
                        +++FD        +   +      T+      T+D+++T      F 
Sbjct: 240 LVVAGEPLTPAQGDLTFDATGALSGGTGALSF-----TAASGNSYTLDLTETQLADRSFE 294

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G +        V   G V   Y  G+ V + ++ + T  +   L+    + + 
Sbjct: 295 VNTVSQDGKSASALTSLEVDASGTVWAAYGAGSPVAMGQVVLVTFANPQALRQLGASGFA 354

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T DSG    G  G +  G I +GALE ANVD+  EL  LI AQRNY  ++K  +T +  
Sbjct: 355 ATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITAQRNYQASAKAMETSNSL 414

Query: 413 MDILISLK 420
           M  +++++
Sbjct: 415 MQTIMNIR 422


>gi|89056664|ref|YP_512115.1| hypothetical protein Jann_4173 [Jannaschia sp. CCS1]
 gi|88866213|gb|ABD57090.1| flagellar hook protein FlgE putative [Jannaschia sp. CCS1]
          Length = 452

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 104/439 (23%), Positives = 180/439 (41%), Gaps = 18/439 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+   ++R++ ++DNIAN  T GYKR    FSS+V      +Y +GG+
Sbjct: 14  MTISSSLNAGVAGLSVNASRLATIADNIANSGTNGYKRATADFSSMVIDQGGGTYSAGGV 73

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN---------CLTRAGDFHIN 111
            ++T  +I + G+L  T + TDLA++G+GF  V     VN          L   G F  +
Sbjct: 74  RVTTGRLIDQSGALATTNNGTDLAVRGRGFLPVTRSSAVNAAAGAELPLYLATTGSFRTD 133

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLI--VNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +G+L   +G  L+G+P            ++  GLE + V   + ++ PTT   +  NL 
Sbjct: 134 ADGYLVTSSGVTLMGWPADADGNVPSFPRDTSAGLEPVQVNVNQFTSEPTTRISLGVNLP 193

Query: 170 KNATIITPDKT-------PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEV 222
              T                 N   ++            +G         T         
Sbjct: 194 GTDTTSESSGDTRQLSVEYFDNLGTSQSIEAFFTPTVPVVGDPASNTWTMTLRDSASNNA 253

Query: 223 SIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS 282
            I       ++S        +  +       G+ A      +        I+       S
Sbjct: 254 VIGEYTVVFDDSRTGGGTIQSVSQPLPVTGGGWSATEGTLTVDVLGGPIEINIGAQGSGS 313

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
             TQL+  F P     +G   G      V  +G+V   +D G    +Y++ +  +P+ + 
Sbjct: 314 GLTQLSDNFAPTSISKDGSPVGNLVSVEVDPNGFVKANFDVGITRTVYQIPLIDLPNPNG 373

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L   D   Y  + +SG   +   G    G++ + ALE +  D+A+ELT+LI+ QR Y+ N
Sbjct: 374 LIAEDNQLYTTSAESGSFFLWDAGDGPTGDVVAFALEESTTDVAAELTQLIQTQRAYSSN 433

Query: 403 SKVFQTGSDFMDILISLKR 421
           +K+ QT  + +    ++ R
Sbjct: 434 AKIIQTVDEMLQETTNIIR 452


>gi|170681389|ref|YP_001742373.1| lateral flagellar hook protein LfgE [Escherichia coli SMS-3-5]
 gi|170519107|gb|ACB17285.1| lateral flagellar hook protein LfgE [Escherichia coli SMS-3-5]
          Length = 400

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGSCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|28900122|ref|NP_799777.1| flagellar hook protein FlgE [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837072|ref|ZP_01989739.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ3810]
 gi|260365772|ref|ZP_05778268.1| flagellar hook protein FlgE [Vibrio parahaemolyticus K5030]
 gi|260880694|ref|ZP_05893049.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AN-5034]
 gi|260897700|ref|ZP_05906196.1| flagellar hook protein FlgE [Vibrio parahaemolyticus Peru-466]
 gi|260899389|ref|ZP_05907784.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ4037]
 gi|28808405|dbj|BAC61610.1| LfgE [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749660|gb|EDM60405.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ3810]
 gi|308086228|gb|EFO35923.1| flagellar hook protein FlgE [Vibrio parahaemolyticus Peru-466]
 gi|308092098|gb|EFO41793.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AN-5034]
 gi|308109176|gb|EFO46716.1| flagellar hook protein FlgE [Vibrio parahaemolyticus AQ4037]
 gi|308114990|gb|EFO52530.1| flagellar hook protein FlgE [Vibrio parahaemolyticus K5030]
 gi|328470101|gb|EGF41012.1| flagellar hook protein FlgE [Vibrio parahaemolyticus 10329]
          Length = 398

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/414 (26%), Positives = 167/414 (40%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFAAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T  + DLAI G GFF+ K        TR+G F  +   F+    G  L
Sbjct: 57  SQNFDKNGSITGTGRSMDLAINGSGFFVTKDHMGQTLYTRSGVFGTDKSNFVTANNGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +          +  I V  + L+A  T       N D +A  I    TP   
Sbjct: 117 QGYSVDSNNNL----MTGSVGNIQVSTSSLNAKATDKLDFVANFDASAKAIDKAVTPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   YD+LG+S     Y+TKT D  WEV++                   +
Sbjct: 173 ADPTSFNSSYTTQVYDSLGNSHTVTQYFTKTADNAWEVNVQVD----------GGKTPVS 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G LA  +                + I++  +TQ    F    +  NG+  G
Sbjct: 223 TIPVTFNKDGTLAAPTGSFNVAFPAAGANAMSVDINLKGSTQFGAAFGVSTNSPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG   +G 
Sbjct: 283 ELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTAWTQSFSSGAPIMGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G +  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGSGTLGNLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQALFN 396


>gi|332305615|ref|YP_004433466.1| flagellar hook-basal body protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172944|gb|AEE22198.1| flagellar hook-basal body protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 460

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 111/462 (24%), Positives = 175/462 (37%), Gaps = 50/462 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    +   ++NIANV+TVG+K +   F  +   S      + V  G+  
Sbjct: 2   SFNIALSGVSAAQRDLDTTANNIANVNTVGFKESRAEFGDVYASSLLAGGKTKVGDGVIT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
                   QGSL  T ++ DLA+ G GFF      +      TRAG F ++ E F+ N  
Sbjct: 62  QEVAQQFSQGSLQFTNNSLDLAVTGNGFFATIPEIDSREFSFTRAGMFKLDAENFVVNSN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG+P+          +    + + +  +  S  PT+   +  NL      +  D  
Sbjct: 122 GDNLLGFPVNPD-GTSSSVALSTTQPVRIPDSSGSPQPTSEVSLKMNLPAGDDAVNLD-- 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG---DKKWEVSIFRQDQSTNNSFPY 237
                    Y   +S   +D+LG S V   Y+ K       +W V+ +  +Q  N     
Sbjct: 179 LFDPSDPLTYNAATSVTVFDSLGDSHVMTYYFMKDSAAASNEWVVATYMDEQPLNTEGDT 238

Query: 238 NVAPLNTVE----------------------VSFDPVTGYLANSSHKAISFNDNTSGIDQ 275
              P  T                          F  +       S      +    G   
Sbjct: 239 IGNPPATGPNVVGETSLGTGVAGYRMTFSAGGDFTEIQNADGTPSPTGDIMSVALGGTIL 298

Query: 276 QITIDISKT-----------------TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVD 318
               D S+T                 TQ A  F     E +G A G+     +  DG V 
Sbjct: 299 ANGSDPSQTISTNFAFDPNVATADEPTQFASAFEVTSLEQDGLAVGRLTGIDIGADGLVR 358

Query: 319 IIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGAL 378
             Y +GT  PI R+A+    ++  L       +  +  SG+   G       G+I S AL
Sbjct: 359 ATYSNGTSEPIIRVALVRFANDQGLTQQSNTQWQESILSGEALAGEATTGTFGDINSSAL 418

Query: 379 ETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           E ANV++ +EL +LI AQRN+  NS+  +  +     +++++
Sbjct: 419 EQANVNLTTELIDLIIAQRNFQANSRALEVNNQLNQTILNIR 460


>gi|256020228|ref|ZP_05434093.1| flagellar basal body FlaE domain-containing protein [Shigella sp.
           D9]
 gi|332281390|ref|ZP_08393803.1| lateral flagellar hook protein [Shigella sp. D9]
 gi|332103742|gb|EGJ07088.1| lateral flagellar hook protein [Shigella sp. D9]
          Length = 400

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|152975165|ref|YP_001374682.1| flagellar hook protein FlgE [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152023917|gb|ABS21687.1| protein of unknown function DUF1078 domain protein [Bacillus
           cytotoxicus NVH 391-98]
          Length = 467

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 108/469 (23%), Positives = 183/469 (39%), Gaps = 52/469 (11%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ S+ T++SGM A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKSLYTSISGMSAMQNALSVTSNNIANAQTVGYKKQKAVFDDLLYNNTVGAKGDDTKAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNV-NCLTRAGDFH 109
           T+   +  G++ S        GS+  T  N  +AI+G GFF+V          TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDYNGGSITMTGINGQVAIEGNGFFVVGDSQGNGVQYTRKGTFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +   ++ N  G  +L Y L     P   +    +       + +    ++ G +  NL 
Sbjct: 121 KSENNYIVNGEGQYVLAYKLDEDGKPDTSHPAGPISIP--LGSAIDGEVSSKGSLIGNLS 178

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAY-------------------DTLGSSVVYDV 210
           ++   I  D    +   D                               D  G+ +  + 
Sbjct: 179 RDNKKIIHDFPVFNKSGDNITMRVQIEQVTELVDPDLPIGADGKPILPKDDKGNPIKPEK 238

Query: 211 YYTKTGDKKWEVSIFRQDQST--------NNSFPYNVAPLNTVEVSFDPVTGYLANSSHK 262
                  K     + R +           ++  P    P  T  + FDP+TG L  +   
Sbjct: 239 VEKPVPGKYKYTVLTRNNSKNEKEFTPIADDKAPGEKKPTLTKTLEFDPITGKLTRTDEA 298

Query: 263 AISFNDNTSG----------IDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVS 312
            +                        +++S+ T L         ++NG A     D+ +S
Sbjct: 299 VVRDPVTKEVIKGGQVDIPFGGDTFKLNLSQLTNLPTKDTLDHKDVNGRAAAVAMDYKIS 358

Query: 313 KDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGE 372
            +GYV + Y D +   + +LA+AT  ++D L       Y+PT  +GD  IG    N  G+
Sbjct: 359 DNGYVMVTYSDNSTRAVSQLAVATFKNQDGLMKVGNGNYVPTASAGDPFIGVAEQNGAGK 418

Query: 373 IFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           I  GA E +NVD++ E  +L+  QR +  N+KV +   D ++ +++L R
Sbjct: 419 IIGGAQEGSNVDLSVEFVDLMLYQRGFQGNAKVIKVSDDVLNEVVNLIR 467


>gi|283784085|ref|YP_003363950.1| lateral flagellar hook protein [Citrobacter rodentium ICC168]
 gi|282947539|emb|CBG87091.1| lateral flagellar hook protein [Citrobacter rodentium ICC168]
          Length = 400

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 121/414 (29%), Positives = 189/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTDFSAMYADSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              I+  GS++ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L
Sbjct: 57  AQSIARGGSMVSTGNALDLAINNGGFFVMCDSAGNITYTRAGSFETDKNGYIVNASGACL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+  +           +  + ++   + A  T+    + N D +   +     P   
Sbjct: 117 QGYPVDGSGTLQT----GTVTDLQIQTGNIPAQATSNMTFTANFDASDETVDRSTMPFDL 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                YT   +   YD+LG+      Y+TKT D  WEV      Q  +   P        
Sbjct: 173 SNSDSYTDSYTTTVYDSLGNEHSVCQYFTKTDDNSWEVQYSFDGQMESGVEPVT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +       +  +     +T D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTSPVSVEFETGAAAPIDMTFDYSSCTQYGSDFSVTTNSANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQIVLATFPNENGLEAVSGTAWVQTGESGSALIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI +EL EL+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGSCGTLSSGMLESSNVDITTELVELMTAQRNYQANTKVISTSTQLDDALFQ 398


>gi|218703525|ref|YP_002411044.1| lateral flagellar hook FlgE-like protein [Escherichia coli UMN026]
 gi|293403355|ref|ZP_06647446.1| flgE [Escherichia coli FVEC1412]
 gi|300900359|ref|ZP_07118535.1| flagellar hook protein FlgE [Escherichia coli MS 198-1]
 gi|218430622|emb|CAR11488.1| Lateral flagellar hook protein (FlgE-like) [Escherichia coli
           UMN026]
 gi|291429208|gb|EFF02228.1| flgE [Escherichia coli FVEC1412]
 gi|300356127|gb|EFJ71997.1| flagellar hook protein FlgE [Escherichia coli MS 198-1]
          Length = 400

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSLTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSDFSVTTNSANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLTSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|170021360|ref|YP_001726314.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli ATCC 8739]
 gi|169756288|gb|ACA78987.1| flagellar basal body FlaE domain protein [Escherichia coli ATCC
           8739]
          Length = 400

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 188/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ ++           +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDSGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|83718065|ref|YP_438389.1| flagellar hook protein flgE [Burkholderia thailandensis E264]
 gi|167614837|ref|ZP_02383472.1| flagellar hook protein flgE [Burkholderia thailandensis Bt4]
 gi|257141422|ref|ZP_05589684.1| flagellar hook protein flgE [Burkholderia thailandensis E264]
 gi|83651890|gb|ABC35954.1| flagellar hook protein flgE [Burkholderia thailandensis E264]
          Length = 395

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 104/414 (25%), Positives = 176/414 (42%), Gaps = 23/414 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +++++ +S NIAN +T G+K     F+++V  + +N     G  I + 
Sbjct: 2   SFNIALSGINAINSQLNTISHNIANANTYGFKAGRANFATMVAGTQAN-----GTYIGSI 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              +  +G  + T    D AI G GFF+ K  D     TR G F  + +G++ +  G   
Sbjct: 57  TQSVGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSMLFTRFGYFQRDADGYIVDGFGRRA 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY    A   + V                 A  + +     NL  +     P       
Sbjct: 117 QGYGTGGAYGDIRV-----------PTDTEPAKASDSLEYVGNLSADWDA--PKNPTFDK 163

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             D  + H  +   YD+LG   +   Y+ K      +V+ +             V     
Sbjct: 164 DDDTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVTTYYAMDGEIVGGSTPVQ---- 219

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             + FD      A +S   +            I ++ + TTQ+AG      +  NG+A G
Sbjct: 220 TVLQFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGETTTTVNRDNGYAAG 279

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
            P + ++ +DG V + Y +G +  +  LA+AT  ++D L       +  +  SG+  IG 
Sbjct: 280 VPGEVTLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLTAVGDTAWRASAASGNPLIGS 339

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
            G    G++ +G+LE +N D+  EL +++ AQRNY  NSKV  T +  M  L+ 
Sbjct: 340 AGSGALGKVVAGSLELSNADVTKELVDMMSAQRNYQANSKVLSTENQMMQALMQ 393


>gi|301645413|ref|ZP_07245354.1| flagellar hook protein FlgE [Escherichia coli MS 146-1]
 gi|307136858|ref|ZP_07496214.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli H736]
 gi|331640713|ref|ZP_08341860.1| LfgE [Escherichia coli H736]
 gi|301076297|gb|EFK91103.1| flagellar hook protein FlgE [Escherichia coli MS 146-1]
 gi|315616827|gb|EFU97444.1| flgE [Escherichia coli 3431]
 gi|323181547|gb|EFZ66967.1| flgE [Escherichia coli 1357]
 gi|331040087|gb|EGI12295.1| LfgE [Escherichia coli H736]
          Length = 400

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSDFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|109899402|ref|YP_662657.1| flagellar hook protein FlgE [Pseudoalteromonas atlantica T6c]
 gi|109701683|gb|ABG41603.1| flagellar basal body FlaE [Pseudoalteromonas atlantica T6c]
          Length = 458

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 111/460 (24%), Positives = 174/460 (37%), Gaps = 48/460 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    +   ++NIANV+TVG+K +   F  +   S      + V  G+  
Sbjct: 2   SFNIALSGVSAAQRDLDTTANNIANVNTVGFKESRAEFGDVYASSLLAGGKTKVGDGVIT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
                   QGSL  T ++ DLA+ G GFF      +      TRAG F ++ E F+ N  
Sbjct: 62  QEVAQQFSQGSLQFTNNSLDLAVTGNGFFATIPEIDSREFSFTRAGMFKLDAENFVVNSN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG+P+          +    + + +  +  S  PT+   +  NL      +  D  
Sbjct: 122 GDNLLGFPVNPD-GTSSSVALSTTQAVRIPDSSGSPQPTSEVSLKMNLPAGDDAV--DLD 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS-------TNN 233
             +      Y   +S   +D+LG S V   Y+ K      E  +                
Sbjct: 179 LFNPDDPLTYNAATSVTVFDSLGDSHVMTYYFMKDQAATNEWVVTTYMDDIALNTEGDTP 238

Query: 234 SFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK---------- 283
             P    P    E +  PV GY    S      +   +      T DI+           
Sbjct: 239 GVPPITGPNVVGETTGSPVAGYRMTFSAGGDFTSIANADGTSSATGDITSVALGGTILAN 298

Query: 284 -----------------------TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDII 320
                                   TQ A  F     E +G A G+     +  DG V   
Sbjct: 299 GSDPSQTITTNFAFDPGNATPDEPTQFASAFEVTSLEQDGLAVGRLTGIDIGADGLVRAT 358

Query: 321 YDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALET 380
           Y +GT  PI R+A+    ++  L       +  +  SG+   G       G+I S ALE 
Sbjct: 359 YSNGTSEPIIRVALVRFANDQGLTQQSNTQWQESILSGEALAGEATTGTFGDINSSALEQ 418

Query: 381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ANV++ +EL +LI AQRN+  NS+  +  +     +++++
Sbjct: 419 ANVNLTTELIDLIIAQRNFQANSRALEVNNQLNQTILNIR 458


>gi|323191538|gb|EFZ76799.1| flgE [Escherichia coli RN587/1]
          Length = 400

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 188/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGDYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ ++           +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDSGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSDFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|260853466|ref|YP_003227357.1| putative lateral flagellar hook protein [Escherichia coli O26:H11
           str. 11368]
 gi|260866413|ref|YP_003232815.1| putative lateral flagellar hook protein [Escherichia coli O111:H-
           str. 11128]
 gi|257752115|dbj|BAI23617.1| predicted lateral flagellar hook protein [Escherichia coli O26:H11
           str. 11368]
 gi|257762769|dbj|BAI34264.1| predicted lateral flagellar hook protein [Escherichia coli O111:H-
           str. 11128]
 gi|323158103|gb|EFZ44202.1| hypothetical protein ECEPECA14_0101 [Escherichia coli EPECa14]
 gi|323178494|gb|EFZ64072.1| hypothetical protein ECOK1180_3007 [Escherichia coli 1180]
          Length = 400

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/414 (29%), Positives = 188/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF++         TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N + +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFNASDEAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPVDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|188494513|ref|ZP_03001783.1| Flagellar basal body protein FlgE [Escherichia coli 53638]
 gi|188489712|gb|EDU64815.1| Flagellar basal body protein FlgE [Escherichia coli 53638]
          Length = 400

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|261856360|ref|YP_003263643.1| flagellar hook-basal body protein [Halothiobacillus neapolitanus
           c2]
 gi|261836829|gb|ACX96596.1| flagellar hook-basal body protein [Halothiobacillus neapolitanus
           c2]
          Length = 418

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 182/422 (43%), Gaps = 12/422 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY---VSGGLEI 62
           S  T+++G++A    +   S+NIAN ++ G+K +   F  +   S   +       G+  
Sbjct: 2   SFNTSITGLNAAQKDLDVTSNNIANANSTGFKSSRAQFGDIYAVSAYGNSKTATGQGVLT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDN--VNCLTRAGDFHINNEGFLENVA 120
                   QGSL  T ++ DLAI G+GFF  +   +   +  +RAG    N +GF+ N  
Sbjct: 62  EAVQQQFTQGSLQFTNNSLDLAISGQGFFTFQPTLDSLQSVYSRAGALGANKDGFIVNTN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIIT--PD 178
           G  L   P+  A+  L   S    + I +  A  +   TT    S NL  +AT+ T  P 
Sbjct: 122 GQYLKALPVS-ANGTLQSTSLASAKPIQLPVAAGAPKATTLVTQSFNLPASATVPTVTPF 180

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
            T +     A YT  +S   YD+LG++     YY KT +       ++ D  T    P  
Sbjct: 181 DTTQATPDPASYTQANSQQVYDSLGNTHTLTSYYVKTANPNEWNVYYQVDTQTPIQGPST 240

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
           +      ++   P    +  ++          +            +TQ    F       
Sbjct: 241 LTFDANGQLPTTPAPFAVTATAASLG----TGAAPLNINVQTQGDSTQYNAPFNMAAQSQ 296

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G+    SV  +G +   Y +G  +P+  +A+A   +   LK    N++  + DSG
Sbjct: 297 DGNTTGQLTGVSVGSNGLIQASYSNGQNIPLGMVALANFSNPQGLKQVGNNSWAESVDSG 356

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
             + G PG    G I  GALE +NVD+  +L  LI AQRN+  N++  QT     D +I+
Sbjct: 357 APTAGQPGTGTFGLIQGGALEQSNVDLTQQLVNLITAQRNFQANAQAIQTDKTATDSVIN 416

Query: 419 LK 420
           ++
Sbjct: 417 IR 418


>gi|332994162|gb|AEF04217.1| flagellar hook protein FlgE [Alteromonas sp. SN2]
          Length = 458

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 112/460 (24%), Positives = 179/460 (38%), Gaps = 48/460 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    +   ++NIANV+TVG+K +   F  +   S    S + V  G+  
Sbjct: 2   SFNIALSGVAAAQKDLDVTANNIANVNTVGFKESRAEFGDVYATSLLAGSKTKVGDGVLT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCL--TRAGDFHINNEGFLENVA 120
                   QGSL  T +  DLAI G GFF     +       TRAG F ++++ ++ N  
Sbjct: 62  QDVAQQFSQGSLQFTNTALDLAITGNGFFATVPDETSRDFSFTRAGQFKLDDDNYVVNSN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G +LLG+P+ +  +     +    E + +  +  S   T+   I  NL      + P   
Sbjct: 122 GDLLLGFPVNSD-STSSSVALSTTEPVQIPDSSGSPAQTSEVDIRMNLPAGDQGLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSI---FRQDQSTNNSFPY 237
                    Y   +S   YD+LG S V   Y+ K      E  +        +   +   
Sbjct: 180 -FDPQDPLTYNAATSVTVYDSLGDSHVMTYYFVKDVAADNEWYVATAVDDQLTDLVNSTG 238

Query: 238 NVAPLNTVEVSFDPVTGYLAN----------------------------SSHKAISFNDN 269
             +   T   S    TG                                ++    S   N
Sbjct: 239 TDSDPTTAVNSLGTNTGNGVTAAKLVFSQGGDFIGIESPDGIQTTDYKLTTEALGSALSN 298

Query: 270 TSGIDQQITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDII 320
            +   QQI ID +         + TQ A  F     E +G   G+     +  DG V   
Sbjct: 299 GADATQQIGIDFNLDPSNATTVEPTQYASAFEVTSLEQDGLPVGRLTGIDIGPDGLVRAT 358

Query: 321 YDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALET 380
           + +GT  PI R+A+    +E  L       +  +  SG+   G       GEI S ALE 
Sbjct: 359 FSNGTSEPIVRVALVRFANEQGLTQQSSTEWKESILSGEALAGEATTGTFGEINSSALEQ 418

Query: 381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           ANV++ +EL ++I AQRN+  NS+  +  +     +++++
Sbjct: 419 ANVNLTTELIDMIIAQRNFQANSRALEVNNSLNQTILNIR 458


>gi|163738039|ref|ZP_02145455.1| S-adenosyl-L-homocysteine hydrolase [Phaeobacter gallaeciensis
           BS107]
 gi|161388655|gb|EDQ13008.1| S-adenosyl-L-homocysteine hydrolase [Phaeobacter gallaeciensis
           BS107]
          Length = 440

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 115/443 (25%), Positives = 189/443 (42%), Gaps = 32/443 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++G+ A ++R++++SDNIAN  T GYKR    F S+V  S+  +Y +GG+
Sbjct: 8   MTISSSLNAGVAGLSANASRLASISDNIANASTPGYKRVQTDFHSMVMSSSGGAYSAGGV 67

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--------RDNVNCLTRAGDFHINN 112
             +   +I E+G L+ T++ TDLA++G+G   V           +    LT    F  N 
Sbjct: 68  RTTNVRLIDERGPLVTTSNATDLAVRGRGMLPVASINEVETGATNPQMMLTTTASFRTNA 127

Query: 113 EGFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VL+G+P        P   ++   LE +     +LS  PTT   +  NL  
Sbjct: 128 DGLLATESGLVLMGWPAQSDGTIPPYARDTSDALEPVRFNVNKLSGEPTTEMSLGVNLPA 187

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS 230
            AT  T   T          +   S   YD LG S    + +  T     E + +    +
Sbjct: 188 TATESTSAGT----------SENLSIEYYDNLGKSESLQIEFVPTVPGTGESNEWTMIIT 237

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG------------IDQQIT 278
              +    +              G L   +          +G            I+    
Sbjct: 238 DTATGGTPIGEYTLTFDDNRTSGGALNAVTATTGGAYAPATGSIIVTVAGGPMEINIGTL 297

Query: 279 IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVP 338
            D +  TQL+  F P     +G   G      + + G+V   YD G    +Y++ +  +P
Sbjct: 298 GDDNGLTQLSDTFAPASISKDGAPVGNFTGVEIDEAGFVHANYDTGVSRVVYQVPLVDLP 357

Query: 339 SEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRN 398
           + + +   D  TY+P+ +SG   +   G    G+I   A E +  D+A ELT +I+ QR 
Sbjct: 358 NPNGMIAMDRQTYMPSSESGSYFLWNAGEGPTGDILGYAREESATDVAGELTNMIQTQRA 417

Query: 399 YAVNSKVFQTGSDFMDILISLKR 421
           Y+ N+KV QT  + +    ++KR
Sbjct: 418 YSSNAKVIQTVDEMLQETTNIKR 440


>gi|167034944|ref|YP_001670175.1| flagellar hook protein FlgE [Pseudomonas putida GB-1]
 gi|166861432|gb|ABY99839.1| flagellar basal body FlaE domain protein [Pseudomonas putida GB-1]
          Length = 440

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 101/445 (22%), Positives = 173/445 (38%), Gaps = 38/445 (8%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-----YVSGGL 60
           S    +SG+ A +  ++   +NIANV T G+K +   F+     S   +      V  G+
Sbjct: 2   SFNIGLSGLYAANKALNVTGNNIANVATTGFKSSRAEFADQYSNSIRGTSAGKNTVGTGV 61

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           + +    +   G++  T    D+AI G GFF++   +     TRAG F+ + +G++ N +
Sbjct: 62  KTAAVSQLFTPGNINGTGQALDMAIDGNGFFVMSD-NGSKIYTRAGAFYSDKDGYVVNAS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L GY +                  +++    +  P  TG IS N++ N++   P  T
Sbjct: 121 GSKLQGYAVDANGKITQGV------LTDLQIDTSNLTPNPTGKISENVNLNSSATAPAVT 174

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT-GDKKWEVSIFRQ------------ 227
           P        Y +  +   YD+ G++   + Y+ K      W +                 
Sbjct: 175 PFDPANTGTYNYTFNTDVYDSQGNAHQLNQYFVKDATSNSWTMYTTIDGRNPADPTSTTP 234

Query: 228 -------------DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGID 274
                        D +   + P           SF       A  +   +   +  +   
Sbjct: 235 LANKLPFKSDGTLDTAAMTAGPVAGGMTIAANKSFTLDNWIPAQKNAAGVWGANGATANV 294

Query: 275 QQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAI 334
             + +D+  TTQ            +G A G+    ++ + G +   + +G    I ++AI
Sbjct: 295 AGVNLDMLGTTQYNAASATTAKSQDGFATGELSGLTIDQSGNMFANFTNGQDKVIGQVAI 354

Query: 335 ATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIE 394
           A   +   L    G  +  +  SG   IG P     G+I  GALE +NVD+  EL  LI+
Sbjct: 355 ANFANLQGLTPIGGTNWKESYASGVPVIGAPDTGTLGQITGGALEDSNVDLTGELVNLIK 414

Query: 395 AQRNYAVNSKVFQTGSDFMDILISL 419
           AQ NY  N+K   T S  M  +I +
Sbjct: 415 AQSNYQANAKTISTESTIMQTIIQM 439


>gi|331666546|ref|ZP_08367420.1| LfgE [Escherichia coli TA271]
 gi|331065770|gb|EGI37654.1| LfgE [Escherichia coli TA271]
          Length = 400

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N + +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFNASDEAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|91224199|ref|ZP_01259462.1| flagellar hook protein E [Vibrio alginolyticus 12G01]
 gi|269965644|ref|ZP_06179757.1| Flagellar hook protein flgE [Vibrio alginolyticus 40B]
 gi|91191110|gb|EAS77376.1| flagellar hook protein E [Vibrio alginolyticus 12G01]
 gi|269829712|gb|EEZ83948.1| Flagellar hook protein flgE [Vibrio alginolyticus 40B]
          Length = 398

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 107/414 (25%), Positives = 172/414 (41%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     FS++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGGRTEFSAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFF+ K        TR+G F  +   F+   +G  L
Sbjct: 57  SQNFDKDGSITGTGRAMDLAINGGGFFVTKDNMGQMLYTRSGVFSTDKNNFVTANSGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY + + +          +  I V  + L+A  T +     N D +A++I    TP + 
Sbjct: 117 QGYSVDSNNNL----MTGSVGNIQVSTSSLNAKATDSLDFVANFDASASVIDKAVTPFNP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + +    +   YD+LG+S     Y+TKT    WEV++                    
Sbjct: 173 KDPSSFNSSYTTKVYDSLGNSHTVTQYFTKTASNSWEVNVQVD----------GGTTPVA 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L+  +                + I++  +TQ    F    +  NG+  G
Sbjct: 223 TVPVTFGKDGSLSAPTAPFNVSFPAAGANAMSVDINLKGSTQFGAAFGVSTNSPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L    G ++  +  SG   +G 
Sbjct: 283 ELAGVRVEGNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTSWTQSFSSGAPIMGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGSGTMGDLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQALFN 396


>gi|300817270|ref|ZP_07097488.1| flagellar hook protein FlgE [Escherichia coli MS 107-1]
 gi|307313519|ref|ZP_07593140.1| fagellar hook-basal body protein [Escherichia coli W]
 gi|300530246|gb|EFK51308.1| flagellar hook protein FlgE [Escherichia coli MS 107-1]
 gi|306906687|gb|EFN37198.1| fagellar hook-basal body protein [Escherichia coli W]
 gi|315059542|gb|ADT73869.1| flagellar hook protein [Escherichia coli W]
 gi|323171064|gb|EFZ56713.1| flgE [Escherichia coli LT-68]
 gi|323379899|gb|ADX52167.1| fagellar hook-basal body protein [Escherichia coli KO11]
          Length = 400

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINNDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|258592496|emb|CBE68805.1| putative Flagellar hook protein flgE [NC10 bacterium 'Dutch
           sediment']
          Length = 412

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 98/434 (22%), Positives = 168/434 (38%), Gaps = 38/434 (8%)

Query: 4   LGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS--------- 54
           + +  TA++G+ A    +  + +NIAN +T GYK +   FS L+  +   +         
Sbjct: 1   MSTFSTAITGLKAYQTDLGVIGNNIANANTTGYKASRAQFSELLVQTIEGATPPSDSTGG 60

Query: 55  ----YVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHI 110
                +  G+ +     I  QG++  T  ++DLAIQG+GF+++   ++    TR G F +
Sbjct: 61  IDPMQIGAGVIVGGILNIQTQGAIEPTGRSSDLAIQGEGFYVLSNGESQI-YTRVGSFEL 119

Query: 111 NNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +  G L +   G+ +     +   PL                   A  TT   +  NL+ 
Sbjct: 120 DANGNLVDAGTGLKVQGIDGDIHIPL---------------GSNEAAGTTEVELVGNLNA 164

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKK---WEVSIFRQ 227
           +        T   +  +  +         DTLG     +V ++  G      W+ ++   
Sbjct: 165 SDADDPITLTENESTLETSF------FIIDTLGGKHQVNVTFSVPGSANTGLWDYAVSAA 218

Query: 228 DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQL 287
              T      +   +               +          N +   Q+ +ID    T  
Sbjct: 219 SNDTGVFTGASAGQIQFASGGNVLSITGPGSGGGIFTFNPGNAAASAQEFSIDFDALTGF 278

Query: 288 AGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFD 347
           A        + +G  PG    F+VS DG V+ IY +G    +  L +A+  +   L    
Sbjct: 279 AALSSVSMKQQDGVPPGSLTSFTVSNDGMVNGIYSNGLVTEMDTLKLASFSNPAGLLRLA 338

Query: 348 GNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQ 407
              +  T +SG    G  G    G I +GALE +NVD+ +EL  LI AQR Y  N++V  
Sbjct: 339 NGQFAETPNSGVAQYGVAGTGGRGTIVAGALEQSNVDLGTELVNLIIAQRGYEANAQVIS 398

Query: 408 TGSDFMDILISLKR 421
             +      ++L R
Sbjct: 399 VANQIQQTTLNLLR 412


>gi|306813303|ref|ZP_07447496.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli NC101]
 gi|305854066|gb|EFM54505.1| flagellar basal body FlaE domain-containing protein [Escherichia
           coli NC101]
          Length = 400

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSVAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDAAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  NG+A  
Sbjct: 227 --LTFDPNTGKLTSPNTPQTIEFQTDAAAPIDLTVDYSSCTQYGSEFSVTTNAANGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|167576662|ref|ZP_02369536.1| flagellar hook protein flgE [Burkholderia thailandensis TXDOH]
          Length = 395

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 104/413 (25%), Positives = 175/413 (42%), Gaps = 21/413 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +++++ +S NIAN +T G+K     F+++V  + +N    G    ST 
Sbjct: 2   SFNIALSGINAINSQLNTISHNIANSNTYGFKAGRANFATMVAGTQANGTYIG----STT 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
             +  +G  + T    D AI G GFF+ K  D     TR G F  + +G++ +       
Sbjct: 58  QSVGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSTLFTRVGYFKRDADGYIVDGFRRRAQ 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY    A   + V                 A  + +     NL  +     P        
Sbjct: 118 GYGASGAYGDIRV-----------PTDTEPAKASDSLEYVGNLSADWDA--PKNPTFDKD 164

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
            D  + H  +   YD+LG   +   Y+ K      +V+ +             V      
Sbjct: 165 DDTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVTTYYAMDGEIVGGSTPVQ----T 220

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + FD      A +S   +            I ++ + TTQ+AG      +  NG+A G 
Sbjct: 221 VLQFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGEPTTTVNRDNGYAAGV 280

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
           P + ++ +DG V + Y +G +  +  LA+AT  ++D L       +  +  SG+  IG  
Sbjct: 281 PGEVTLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLTAVGDTAWRASAASGNPLIGSA 340

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           G    G++ +G+LE +N D+  EL +++ AQRNY  NSKV  T +  M  L+ 
Sbjct: 341 GSGALGKVVAGSLELSNADVTKELVDMMSAQRNYQANSKVLSTENQMMQALMQ 393


>gi|293115683|ref|ZP_05792615.2| flagellar hook protein FlgE [Butyrivibrio crossotus DSM 2876]
 gi|292808788|gb|EFF67993.1| flagellar hook protein FlgE [Butyrivibrio crossotus DSM 2876]
          Length = 440

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 109/453 (24%), Positives = 190/453 (41%), Gaps = 47/453 (10%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------- 54
           ++ ++ + ++G+     ++  + +NIANV+TVG+K  ++ FS + + +T N+        
Sbjct: 1   MMRALYSGVAGLKTHQTKMDVIGNNIANVNTVGFKSQSVTFSDVFYQTTQNASGANAETG 60

Query: 55  -------YVSGGLEISTKDM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAG 106
                   +  G  +S+    +SE G    T++  DL I G   FIV      N  T+AG
Sbjct: 61  MGGTNAKQIGLGSTVSSITTKVSESGGSQSTSNPFDLMINGDSMFIV-NNAGTNYFTKAG 119

Query: 107 DFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISN 166
           +F +++ G L    G  + G+        ++      L     ++   +   T    IS 
Sbjct: 120 NFTVDSAGTLVTSQGYAVQGWKAN-EEGVIMKGPVTSLNLYGAENKYAAPEATENCTISG 178

Query: 167 NLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFR 226
           N+             + +G ++      +   YDTLG      V  T+  D  ++ ++  
Sbjct: 179 NI-----------NKEDDGFESGVGRSMNITFYDTLGYEYQVTVKVTQDPDDDYKYNLVA 227

Query: 227 QDQSTNNSFPYNVAPLNT--------VEVSFDPVTGYLANSSHKAISFNDNTSGIDQ--- 275
              +         A   T        V ++FD VTG LA+ +   ++ N  T GID    
Sbjct: 228 TGLTCGGKAVDFGADAQTKLEGLLKDVTLTFDKVTGELADPADGKVTLNTTTLGIDSLAK 287

Query: 276 QITIDISKTTQLAGGFIPQKSEING------HAPGKPKDFSVSKDGYVDIIYDDGTRVPI 329
            + +D SK T L        +  +          G     S+ KDG +   YD+G    I
Sbjct: 288 DVNLDFSKMTCLGTDTSFTPARGDKEGLGAGRLVGTMSGVSIQKDGIIVAYYDNGDSKII 347

Query: 330 YRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS-IGFPGHNQHGEIFSGALETANVDIASE 388
            ++A+A   +   L+    N +  T +SG+   IG       G    G LE +NVD+A+E
Sbjct: 348 AQIAVANFKNLSGLEKVGDNLFAETLNSGNFDGIGDDITEDGGYFSPGVLEMSNVDLAAE 407

Query: 389 LTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            T++I  QR Y  NS++       ++ LI+LKR
Sbjct: 408 FTDMITTQRGYQANSRIITVSDTLLEELINLKR 440


>gi|323492338|ref|ZP_08097491.1| flagellar hook protein FlgE [Vibrio brasiliensis LMG 20546]
 gi|323313385|gb|EGA66496.1| flagellar hook protein FlgE [Vibrio brasiliensis LMG 20546]
          Length = 398

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 106/414 (25%), Positives = 171/414 (41%), Gaps = 20/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG+DA +  ++ +S NIAN  T G+K     F+++      N    GG+E+++ 
Sbjct: 2   SFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFAAVY-----NGMQPGGVEVASI 56

Query: 66  DMISE-QGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               +  GS+  T    DLAI G GFFI K        TR+G F  + + ++    G  L
Sbjct: 57  SQNFDKNGSVSGTGRAMDLAINGSGFFITKDTSGQLLYTRSGVFGTDKDNYVTGNTGAKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY +   +  L          I +  + L+A  T +     NLD +A+++     P   
Sbjct: 117 QGYSVDGNNNLLT----GASGDIKISTSSLAAKATDSMEFVANLDASASVVDQTVNPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                +    +   +D+LG+S     Y+TKT    WEV++               +   +
Sbjct: 173 NNTDSFNSSYTTKVFDSLGNSHTVTQYFTKTAANSWEVNVQVD----------GGSTPAS 222

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G LA  +                I I+++ +TQ    F    +  NG+  G
Sbjct: 223 TVAMTFNADGTLATPTGSYNVAFPAAGANPMSIDINLAGSTQFGASFGVSTNNPNGYTSG 282

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +     V  +G V   Y +G      ++ +A   +   L    G  +  +  SG   +G 
Sbjct: 283 ELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANPQGLAKVSGTAWTQSFSSGAPIMGV 342

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G++  GALE +NVD+ SEL  L+ AQRNY  N+K   T       L +
Sbjct: 343 PGSGTLGDLTPGALEGSNVDLTSELVNLMTAQRNYQANAKTISTNDKLTQALFN 396


>gi|27464952|gb|AAN63049.1| flagellar component FlgE [Vibrio vulnificus]
          Length = 434

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 103/437 (23%), Positives = 175/437 (40%), Gaps = 29/437 (6%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
             ++SG+ A    ++  S+NIAN +T G+K +   F  +   S    + +   GG++ + 
Sbjct: 3   YVSLSGLSAAQLDLNTTSNNIANANTYGFKESRAEFGDVYSNSLVTNAKTTPGGGVQANQ 62

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFI---VKGRDNVNCLTRAGDFHINNEGFLENVAG 121
                 +GS ++T +  DL I G GFF     +   N N LTR G FH++ + ++     
Sbjct: 63  VAQQFHEGSSIYTNNPMDLRISGTGFFAVAKDRMVPNQNELTRNGAFHLSKDNYMVTAND 122

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             LLGY +   S  +        + +N+         T+   +  NL     +  P    
Sbjct: 123 EYLLGYQVDPLSGDVASYE---PQPLNIPAEFGKPKQTSNVTVGVNLPARGALKDPQA-- 177

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   Y   +S   YD +G S     YY K   +      +     +    P N+A 
Sbjct: 178 FDFEDPDTYNRSTSSTIYDLMGQSYKLTTYYLKDQTQPNTWQTYYTVTDSQGEKPLNIAG 237

Query: 242 LNTVEVSFDPVTGYLANS------------------SHKAISFNDNTSGIDQQITIDISK 283
            +    +         N+                     A+  + N     Q I  D++ 
Sbjct: 238 GDATNATGHIGHTVKFNNDGTLASLNNGQPIISDPLGAGAVPIDMNGGDPTQTIAFDLNS 297

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
           +TQ A  F   K + +G   G      + ++G V   Y +G  V + R+A+  VP+E  L
Sbjct: 298 STQFAAPFELTKFDEDGATTGFLTKVDIDENGSVYGTYSNGENVTLGRVALVRVPNEQGL 357

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               G  +  T +SGD   G       G + SGALE +N+D+  EL +LI AQRN+  NS
Sbjct: 358 DKKGGTQWNSTNNSGDKIWGESNKGSFGTVSSGALEQSNIDMTQELVDLISAQRNFQANS 417

Query: 404 KVFQTGSDFMDILISLK 420
           +  +  +     ++ ++
Sbjct: 418 RALEVHNQLQQNILQIR 434


>gi|254475161|ref|ZP_05088547.1| flagellar hook protein FlgE [Ruegeria sp. R11]
 gi|214029404|gb|EEB70239.1| flagellar hook protein FlgE [Ruegeria sp. R11]
          Length = 441

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 114/444 (25%), Positives = 189/444 (42%), Gaps = 33/444 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   +SG+ A ++R++++SDNIAN  T GYKR    F S+V  S+  +Y +GG+
Sbjct: 8   MTISSSLNAGVSGLTANASRLASISDNIANSSTAGYKRVQTDFHSMVMGSSGGTYSAGGV 67

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--------RDNVNCLTRAGDFHINN 112
             +   +I E+G L+ T + TDLA++G+G   V           +    LT    F  N 
Sbjct: 68  RTTNVRLIDERGPLVSTNNATDLAVRGRGMLPVTSMTEVEVGASNPQMMLTTTASFRTNA 127

Query: 113 EGFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G L   +G VL+G+P        P   ++  GLE +     +LS  PTT   +  NL  
Sbjct: 128 DGLLATESGLVLMGWPAQSDGTIPPYARDTSDGLEPVRFNVNKLSGEPTTEMSLGVNLPA 187

Query: 171 NATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQS 230
            AT      T          +   S   YD LG S    + +  T     E + +    +
Sbjct: 188 TATESGAAGT----------SENLSIEYYDNLGKSESLQIEFVPTVPATGESNEWTMIIT 237

Query: 231 TNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI-------------DQQI 277
              +    +              G L   +  +     + +               +  +
Sbjct: 238 DTATGATPIGEYTLTFDDNRTSGGALNAVTLGSAGGAYDPATGSIIVNVAGGPMEINIGM 297

Query: 278 TIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
             D +  TQL+  F P     +G   G      + + G+V   YD G    +Y++ +  +
Sbjct: 298 IGDDNGLTQLSDTFAPASISKDGAPVGNFTGVEIDEAGFVRANYDTGVSRVVYQVPLVDL 357

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
           P+ + +   D  TY+P+ +SG   +   G    G+I   A E +  D+A ELT +I+ QR
Sbjct: 358 PNPNGMIAMDRQTYMPSSESGSYFLWNAGEGPTGDILGYAREESATDVAGELTNMIQTQR 417

Query: 398 NYAVNSKVFQTGSDFMDILISLKR 421
            Y+ N+KV QT  + +    ++KR
Sbjct: 418 AYSSNAKVIQTVDEMLQETTNIKR 441


>gi|27363705|ref|NP_759233.1| flagellar hook protein FlgE [Vibrio vulnificus CMCP6]
 gi|37679147|ref|NP_933756.1| flagellar hook protein FlgE [Vibrio vulnificus YJ016]
 gi|320157109|ref|YP_004189488.1| flagellar hook protein FlgE [Vibrio vulnificus MO6-24/O]
 gi|27359821|gb|AAO08760.1| Flagellar hook protein flgE [Vibrio vulnificus CMCP6]
 gi|37197889|dbj|BAC93727.1| flagellar hook protein FlgE [Vibrio vulnificus YJ016]
 gi|319932421|gb|ADV87285.1| flagellar hook protein FlgE [Vibrio vulnificus MO6-24/O]
          Length = 434

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 103/437 (23%), Positives = 177/437 (40%), Gaps = 29/437 (6%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
             ++SG+ A    ++  S+NIAN +T G+K +   F  +   S    + +   GG++ + 
Sbjct: 3   YVSLSGLSAAQLDLNTTSNNIANANTYGFKESRAEFGDVYSNSLFTNAKTTPGGGVQANQ 62

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFI---VKGRDNVNCLTRAGDFHINNEGFLENVAG 121
                 +GS ++T +  DL I G GFF     +   N N LTR G FH++ + ++     
Sbjct: 63  VAQQFHEGSSIYTNNPMDLRISGTGFFAVAKDRMVPNQNELTRNGAFHLSKDNYMVTAND 122

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             LLGY +   S  +        + +N+         T+   +  NL  +  +  P    
Sbjct: 123 EYLLGYQVDPLSGDVASYE---PQPLNIPAEFGKPKQTSNVTVGVNLPASGALKDPQA-- 177

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   Y   +S   YD++G S     YY K   +      +     +    P N+A 
Sbjct: 178 FDFEDPDTYNRSTSSTIYDSMGQSYKLTTYYLKDQTQPNTWQTYYTVTDSQGEKPLNIAG 237

Query: 242 LNTVEVSFDPVTGYLANS------------------SHKAISFNDNTSGIDQQITIDISK 283
            +    +         N+                     A+  + N     Q I  D++ 
Sbjct: 238 GDATNATGHIGHTVKFNNDGTLASLNNGQPIISDPLGAGAVPIDMNGGDPTQTIAFDLNS 297

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
           +TQ A  F   K + +G   G      + ++G V   Y +G  V + R+A+  VP+E  L
Sbjct: 298 STQFAAPFELTKFDEDGATTGFLTKVDIDENGSVYGTYSNGENVTLGRVALVRVPNEQGL 357

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               G  +  T +SGD   G       G + SGALE +N+D+  EL +LI AQRN+  NS
Sbjct: 358 DKKGGTQWNSTNNSGDKIWGESNKGSFGTVSSGALEQSNIDMTQELVDLISAQRNFQANS 417

Query: 404 KVFQTGSDFMDILISLK 420
           +  +  +     ++ ++
Sbjct: 418 RALEVHNQLQQNILQIR 434


>gi|300936126|ref|ZP_07151065.1| flagellar hook protein FlgE [Escherichia coli MS 21-1]
 gi|300458704|gb|EFK22197.1| flagellar hook protein FlgE [Escherichia coli MS 21-1]
          Length = 400

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 123/414 (29%), Positives = 187/414 (45%), Gaps = 18/414 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S + A +G++A + ++  +S+NIAN  TVGYK     FS++   S +      G+ ++  
Sbjct: 2   SYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAGSQA-----MGVSMAGT 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS  GSL+ T +  DLAI   GFF+          TRAG F  +  G++ N +G  L
Sbjct: 57  AQSISRGGSLVSTGNALDLAINDDGFFVTCDSAGNISYTRAGSFETDKNGYIVNASGAYL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+ +            +  I +K   + A  +++   + N D +   I     P   
Sbjct: 117 QGYPVDDTGTLQT----GTVTDIQIKTGNIPAQASSSLTFTANFDASDDAIDRTTVPFDA 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
              + YT   +   YD+LG+      Y+TKT D  WEV      Q               
Sbjct: 173 TNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGVPATT------ 226

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             ++FDP TG L + +          +     +T+D S  TQ    F    +  +G+A  
Sbjct: 227 --LTFDPNTGKLTSPTTPQTIEFQTDAAAPIDLTVDYSTCTQYGSEFSVTTNAADGYASA 284

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   Y +G R+   ++ +AT P+E+ L+   G  ++ T +SG   IG 
Sbjct: 285 TQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTPLIGV 344

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + SG LE++NVDI SEL  L+ AQRNY  N+KV  T +   D L  
Sbjct: 345 PGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQ 398


>gi|300696913|ref|YP_003747574.1| flagellar hook protein FlgE [Ralstonia solanacearum CFBP2957]
 gi|299073637|emb|CBJ53157.1| flagellar hook protein FlgE [Ralstonia solanacearum CFBP2957]
          Length = 401

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 107/419 (25%), Positives = 183/419 (43%), Gaps = 23/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S   +    +  G+++
Sbjct: 2   GFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  G++ +  G
Sbjct: 62  TKVSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY                L  + +   +L+ + TT    S NLD   T+  P  TP
Sbjct: 122 QNLTGYAADATGKINT----AVLTNLQIPVNDLAPLATTNTAFSINLDAAGTV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 + Y H  S   YD  G+S +   YY +T    W+V       +     P     
Sbjct: 176 FSATDSSTYNHSVSEQVYDGTGTSHMLTNYYVRT-ASGWDVYSTVDGAAPTGGNPVTSLT 234

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            N+  V     +      +  +I+             +D + TTQ  GGF       +G+
Sbjct: 235 FNSSGVLTSSPSTVAVAFTGMSIA------------NMDFTGTTQYGGGFNDTSVTQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   
Sbjct: 283 ATGRLASYSVGNDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQ 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 MGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVSMR 401


>gi|83747654|ref|ZP_00944690.1| FlgE [Ralstonia solanacearum UW551]
 gi|207728346|ref|YP_002256740.1| flagellar hook protein flge [Ralstonia solanacearum MolK2]
 gi|207739737|ref|YP_002258130.1| flagellar hook protein flge [Ralstonia solanacearum IPO1609]
 gi|83725706|gb|EAP72848.1| FlgE [Ralstonia solanacearum UW551]
 gi|206591592|emb|CAQ57204.1| flagellar hook protein flge [Ralstonia solanacearum MolK2]
 gi|206593119|emb|CAQ60025.1| flagellar hook protein flge [Ralstonia solanacearum IPO1609]
          Length = 401

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 105/419 (25%), Positives = 184/419 (43%), Gaps = 23/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S   +    +  G+++
Sbjct: 2   GFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  G++ +  G
Sbjct: 62  TKVSQSFTQGNVTVTGNPLDIAINGTGFYRMVDTSSGQVSYTRNGQFQTDKNGYIISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY                L  + +   +L+ + TT    + NLD   T+  P  TP
Sbjct: 122 QNLTGYAADATGKINT----AVLTNLQIPVNDLAPLATTNTAFTINLDAAGTV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A Y H  S   YD  G+S +   YY +T       S       T  +   ++  
Sbjct: 176 FSATNSATYNHSVSEQVYDGTGTSHMLTNYYVRTAAGWDVYSTVDGAAPTGGNPVTSLTF 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            ++  ++  P    +A +                  ++D + TTQ  GGF       +G+
Sbjct: 236 NSSGVLTSSPSKVAVAFTGMSIA-------------SMDFTGTTQYGGGFNDTSVTQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   
Sbjct: 283 ATGRLASYSVGNDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQ 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 MGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVSMR 401


>gi|116626495|ref|YP_828651.1| hypothetical protein Acid_7458 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229657|gb|ABJ88366.1| protein of unknown function DUF1078 domain protein [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 421

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 101/433 (23%), Positives = 175/433 (40%), Gaps = 26/433 (6%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS----YVSG 58
           +  S  TA+S + A +  V  V +N+AN++T G+K   + F  LV  S         V  
Sbjct: 1   MFTSFSTALSALSATATAVDVVGNNLANLNTPGFKTNVVYFRDLVTQSLGAGLGETQVGF 60

Query: 59  GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLEN 118
           G           QG++  +    D A+QG GFF+ K        TRAG+F +++ G L+ 
Sbjct: 61  GTGRPLTIRQFTQGAIQSSTGLLDAAVQGDGFFVAKNAQGNTVYTRAGNFQVDDAGNLKT 120

Query: 119 VAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPD 178
             G  + G+   +++  ++  +    + +    A    + +T   +  NL+ +A      
Sbjct: 121 NTGESVQGWTSLDSTTGVLDTNGAIGDIVVPVGAAKQPIASTGFTLDLNLNSSAAAED-- 178

Query: 179 KTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYN 238
                           +   YD+LG S +  V++ KT   +W  S+    +  +      
Sbjct: 179 ----------TSKFSDTIKVYDSLGESHILTVHFQKTDASQWSYSVSVPGEDLSGGTAGT 228

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTS----------GIDQQITIDISKTTQLA 288
              +           G L + +  ++   D T             + +      + TQ  
Sbjct: 229 PTDIGASGSLTFGADGQLTSPAAGSVIGLDITGLASGAADMHLDWNPRTDNGGGRITQFG 288

Query: 289 GGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDG 348
                  S  NG A  +     ++  G +   Y DG +V + ++A+A+V + ++L     
Sbjct: 289 QPSSASASSQNGSAAAQLIRVGLADGGKMLAQYSDGQQVVVGQVAMASVRNPESLIAVGN 348

Query: 349 NTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           N Y  +  +   +IG P     G+I  GA+E + VDIA E T LI  QR Y  NS+V  T
Sbjct: 349 NNYQASARTATPAIGLPNTGGRGDIVGGAIEASTVDIAKEFTNLIVLQRGYQANSRVITT 408

Query: 409 GSDFMDILISLKR 421
             +     I+LKR
Sbjct: 409 VDELSQETINLKR 421


>gi|74101658|gb|AAZ99748.1| FlgEL [Aeromonas hydrophila]
          Length = 397

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 99/414 (23%), Positives = 177/414 (42%), Gaps = 21/414 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    +SG+ A +  +S +S+N+AN  T G+K +   F+++          +GG+E++  
Sbjct: 2   SFSIGLSGLRAVNQELSVISNNVANASTAGFKSSRAEFAAIY-----GGGQAGGVEMNNV 56

Query: 66  DMISEQ-GSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
               ++ G +  T    DLAI G GFF++K  +     TRAG F  +   +L   +G  L
Sbjct: 57  SQNFDRNGDVTRTGRGLDLAISGSGFFVLKDSNGQTSYTRAGMFQRDPNNYLTTASGTRL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY   +A           +  I VK   L A  +       NL  +A++I     P   
Sbjct: 117 QGYTTNDAGEL----QSGVVGDIQVKAGSLPAKASDKLEFVANLKADASVIDQTAHPFDP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
            +   +++  S   YD+LG       Y+ KT D  W             ++ +N     +
Sbjct: 173 AKSDSFSYSQSSKVYDSLGVEHTVTQYFVKTADNTW-----------QVNYAFNGTKTGS 221

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L + +   +            +++D+++ +Q A  F   +++ NG+A G
Sbjct: 222 PVTMEFNTNGTLKSPTTSPVLNLTPPGAEKIALSVDVARVSQYASDFNATRNQSNGYAAG 281

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
                 V  DG V   + +G  +   ++ +A   + + L   +  T+  +  SG   +G 
Sbjct: 282 DLTGVKVDADGGVYATFTNGQSLLQGQVVMANFTNPNGLMQTNNTTWQQSFSSGQPVLGA 341

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           PG    G + +GA E++NVD+  EL  L+ +QRNY  N+K   +      +L +
Sbjct: 342 PGTGTMGSLTAGAYESSNVDLTGELVSLMTSQRNYQANAKTISSADKMTQVLFN 395


>gi|254464969|ref|ZP_05078380.1| flagellar hook protein FlgE [Rhodobacterales bacterium Y4I]
 gi|206685877|gb|EDZ46359.1| flagellar hook protein FlgE [Rhodobacterales bacterium Y4I]
          Length = 435

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 121/445 (27%), Positives = 200/445 (44%), Gaps = 34/445 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   +SG+ A ++R++++SDNIAN  T GYKR    F S+V   +  +Y +GG+
Sbjct: 1   MTISSSLNAGVSGLSANASRLASISDNIANSSTRGYKRVQTDFHSMVLSGSGGTYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGF-------FIVKGRDNVNCLTRAGDFHINNE 113
             +   +I E+G L+ T + TDLA++G+G         +  G      LT  G F  ++ 
Sbjct: 61  RTTNVRLIDERGPLVSTNNATDLAVRGRGMLPVASITEVEAGGSPSMMLTSTGSFRTDSS 120

Query: 114 GFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
           G+L   +G VL+G+P         +  ++   LE I +    LSA PTT   ++ NL   
Sbjct: 121 GYLSTESGLVLMGWPAQADGTLPDVARDTADALEPIRIDLNRLSAEPTTEISLTANLPAA 180

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST 231
            T       P           +     +D +G S    + YT +       S   +    
Sbjct: 181 ETDPGASGDPV----------EQVVQYFDNMGRSEELTITYTPSVATPPATSGTNEWTMQ 230

Query: 232 NNSFPYNVAPLNTVEVSFDPV-------------TGYLANSSHKAISFNDNTSG--IDQQ 276
                     +    ++FD               TG   +++  +++ N       I+  
Sbjct: 231 IVDSATGATVIGEYTLTFDDSAASAGTLQSVATLTGGAYDATAGSVTINVAGGPVEINIG 290

Query: 277 ITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIAT 336
           +  + +  +QL   F+P  +E +G A G      V+  G V   YD G    IY++ +A 
Sbjct: 291 VIGEQNGMSQLGDEFVPGTTEKDGTAVGSFVSVEVNASGEVIASYDSGDTKVIYKVPLAD 350

Query: 337 VPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQ 396
           V + + ++  D  TY PT DSG   +   G    GEI   A E + VD+A+ELT++I+ Q
Sbjct: 351 VSNINGMQALDSQTYKPTDDSGAFYLWDAGEGPTGEILGYAQEESAVDVATELTDMIKTQ 410

Query: 397 RNYAVNSKVFQTGSDFMDILISLKR 421
           R Y+ N+KV QT  + +    ++KR
Sbjct: 411 RAYSSNAKVIQTVDEMLQETTNIKR 435


>gi|78062976|ref|YP_372884.1| flagellar hook protein FlgE [Burkholderia sp. 383]
 gi|77970861|gb|ABB12240.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 414

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 109/418 (26%), Positives = 182/418 (43%), Gaps = 12/418 (2%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   +N +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  + +
Sbjct: 4   QQGLSGLAGAANHLDVIGNNIANANTVGFKQGRANFADMYANSVATSTNTQIGIGTRLVS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF     + V   +R G FH +  G + +      
Sbjct: 64  VQQQFGQGTINSTKSSLDIAINGNGFFQ-MSNNGVTTYSRDGVFHRDKSGAIVDA----Q 118

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
               +  A+ P    +      +    + +S   TT      NL+    +  P KTP + 
Sbjct: 119 NRNLMGYAAGPGGAINTAATVPLQAPTSNISPQATTKITGQFNLNSQDKV--PAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
           G +  Y + SS   YD+LG +    +Y+TK     W+     Q Q+  N           
Sbjct: 177 GDNTTYNYNSSIQVYDSLGGAQQVSMYFTKNAAGTWQAYAGVQGQTPTNLGTVTFDASGR 236

Query: 245 VEVSFDPVTGYLANSSHKAISFNDN--TSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +    TG    S  +      N       Q +T+D+  TTQ  G         +G A
Sbjct: 237 ISSTTSAATGQPTPSLGQFAFSIPNASGGANPQNLTLDLGGTTQFGGKSGVNNLAQDGFA 296

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G    FS+  DG +   Y +G    +  +A+A   + + L+   GN Y+ T  SG   I
Sbjct: 297 SGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLENIGGNQYVETAASGVPQI 356

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             PG   HG +   ALE +NVD+ +EL  LI+AQR+Y  N++  +T       L++++
Sbjct: 357 SAPGSTNHGTLQGSALENSNVDLTTELVNLIKAQRDYQANAQTIKTQQTVDQTLLNMR 414


>gi|188534170|ref|YP_001907967.1| flagellar hook protein FlgE [Erwinia tasmaniensis Et1/99]
 gi|188029212|emb|CAO97084.1| Flagellar biosynthesis, hook protein [Erwinia tasmaniensis Et1/99]
          Length = 402

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 91/415 (21%), Positives = 173/415 (41%), Gaps = 14/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NI+N  T G+K + +AF+ +       S V  G ++++ 
Sbjct: 2   GFSQAVSGLNAASSNLDVIGNNISNSATAGFKSSTVAFADMFA----GSKVGLGTKVASV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T+   D+AI   GFF +   +     +R G F ++ E  + N+ G  L 
Sbjct: 58  VQDFGDGTTTTTSRGLDVAISSAGFFRMADANGGVFYSRNGQFTLDAERNIVNMQGLKLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP       +      G   + +     +     T   +   + N+T  + D T  +  
Sbjct: 118 GYPATGTPPTVQ----AGANPVALSVPTTAMSARATTTAAMTANLNSTDSSKDLTKLNIN 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  KS+   +D+LG++   ++Y+ KT D  W V        T  +    V   N  
Sbjct: 174 DSTTYNAKSAMTTFDSLGNAHTVNLYFVKTADNNWTVHPVDSSTGTAGTNTNLVFDANGQ 233

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
             +              ++   + ++              Q  G         +G+ PG+
Sbjct: 234 LTT------PANGQVSYSMGALNGSTAQPGMTISLAGSLQQNNGKSTFGNPTQDGYKPGE 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG +   Y +     + ++ ++   + + LK    N +  T  SG    G  
Sbjct: 288 LTSYQINDDGTLVGSYSNEQTQVLGQIVLSNFANPEGLKSEGDNVWSATSSSGQALTGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G + +GALE++NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GTGNLGTLTAGALESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|163750570|ref|ZP_02157808.1| flagellar hook protein [Shewanella benthica KT99]
 gi|161329725|gb|EDQ00714.1| flagellar hook protein [Shewanella benthica KT99]
          Length = 455

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 101/457 (22%), Positives = 177/457 (38%), Gaps = 45/457 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+++G+K +   F+ +   S      + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNSIGFKESRAEFADVYANSIFANGKTAVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T +  DLAI G GFF+         +  TRAG F +N+  +L +  
Sbjct: 62  SQIAQQFHQGSLQFTNNALDLAINGGGFFVTSSELEAKDHSFTRAGAFKVNSADYLVDSQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S   T    I  NL+   + + P   
Sbjct: 122 GNYLQTFPVDKD-GNSTSVSLTTTKPVRIPDTAGSPQKTENIGIQMNLNAADSSLDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQ------- 227
                    Y + ++   YD+LG   +   Y+ +  +        W              
Sbjct: 179 LFDANDRDTYNNSTAVTMYDSLGEPHILTTYFVRPPNAAYIGESNWVAFYAVDGQRVDLA 238

Query: 228 ---DQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDN--------------- 269
                  +++        +T  V+     G +   +        N               
Sbjct: 239 EAGTYDQDDNGDGVANVRSTAAVTAGGWKGAVIKFNDTGAHIATNPDPILTVPLGVGVGS 298

Query: 270 ------TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDD 323
                  +   Q +TI  +  TQ A  F   +   +G   G+  +  V  DG ++  Y +
Sbjct: 299 ANVLGPGTDGSQTLTIAFNNPTQYASTFEVTELNQDGTTVGRLTNVEVGADGLINASYSN 358

Query: 324 GTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANV 383
           GT V + R+A+A   +E  L      ++  ++DSG    G       G I S ALE +NV
Sbjct: 359 GTTVALARVALARFANEQGLTQVGNTSWKASQDSGQALAGEANSGTFGSIRSSALEQSNV 418

Query: 384 DIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           D+ ++L  LI AQRN+  +S+  +  +     ++ ++
Sbjct: 419 DLTTQLVNLISAQRNFQASSRTLEVNNTLQQTILQIR 455


>gi|209963559|ref|YP_002296474.1| flagellar hook protein FlgE [Rhodospirillum centenum SW]
 gi|209957025|gb|ACI97661.1| flagellar hook protein FlgE [Rhodospirillum centenum SW]
          Length = 434

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 127/435 (29%), Positives = 192/435 (44%), Gaps = 15/435 (3%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLV-FPSTSNSYVSGG 59
           M I  +M + +SG+ AQS + +A+SDNI+N  TVGYKR+ + FS+LV   S+  SY +GG
Sbjct: 1   MSIYSAMYSGVSGLAAQSAKFAAISDNISNSSTVGYKRSGVQFSTLVTSASSPGSYSAGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-------CLTRAGDFHINN 112
           ++      +S  G +  T S TD+AI G+GFF+V  R            LTR+G F ++ 
Sbjct: 61  VQADLHTEVSRGGIVQATNSATDMAISGRGFFVVSNRSAAVNGEAPSYMLTRSGAFRVDE 120

Query: 113 EGFLENVAGGVLLGYPLKNAS----APLIVNSFQGLERINVKHAELSAMPTTTGFISNNL 168
            G L N AG  L G+ L              SF GLE +N+      A  TT    + NL
Sbjct: 121 NGNLHNTAGYFLQGWKLGPDGKVVGGEPSRTSFTGLETVNLSSITGLAKATTQIDFAANL 180

Query: 169 DKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQD 228
             + T  TP   P     D  YT            +       +  T             
Sbjct: 181 PASQTGKTPPAQPFSTSVDY-YTPLGGTGRLTLEWAPQSAANEWNLTIYDGTTSLGTANI 239

Query: 229 QSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI--DQQITIDISKTTQ 286
               N+                       +++  +I  + N   I  +          TQ
Sbjct: 240 VFNGNTATSGPPGSLNTMSEVGASPTLDVDAATGSIKLDVNGQPIVVNLGRPNQTGGLTQ 299

Query: 287 LAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLF 346
               ++P K   +G +    +   +  DG +  IY +G R  +Y++ +A V + D L+  
Sbjct: 300 WGDDYVPTKINKDGASYAPLERVEIGDDGVMTAIYKNGLRQAVYQIPVADVTNPDGLRRM 359

Query: 347 DGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVF 406
           DGN +  +R+SGD  +   G  + G +   ALE +NVDIA ELT +IE QR Y+ N+K+ 
Sbjct: 360 DGNAFQVSRESGDYYLWDAGSGKAGAVDGAALEASNVDIAEELTSIIETQRAYSSNAKII 419

Query: 407 QTGSDFMDILISLKR 421
           QT  + +D +  L R
Sbjct: 420 QTADEMLDEVSRLMR 434


>gi|146305250|ref|YP_001185715.1| flagellar basal body FlaE domain-containing protein [Pseudomonas
           mendocina ymp]
 gi|145573451|gb|ABP82983.1| flagellar basal body FlaE domain protein [Pseudomonas mendocina
           ymp]
          Length = 395

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 118/412 (28%), Positives = 183/412 (44%), Gaps = 23/412 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   AM+G+ A + +++ +S NIAN  T G+K +   F S+   S +      G+E+   
Sbjct: 2   SFNIAMTGLSAVNEQLNTISHNIANAGTTGFKSSRTEFGSIYADSQA-----MGVEVLAT 56

Query: 66  DMISEQG-SLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                QG SL+ T  + DLAI G GFF+ +G +     TRAG F  + + ++ N AG  L
Sbjct: 57  TQSISQGGSLVTTGRSLDLAISGGGFFVTRGSNGDVSYTRAGVFGADKDNYIVNAAGLKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+  A   L+      +  + +++A L A  T +     NLD N ++  P   P   
Sbjct: 117 QGYPVDAAGNLLV----GAMGDLQLQNANLPARATDSLAFVMNLDSNQSV--PTAAPFDP 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
                Y    +   +D+ G       Y+ KTGD  WE   +    +              
Sbjct: 171 ADVNTYNSTYTTKVFDSQGKEHTLTQYFVKTGDNAWEAHYYADGAAVGGPQALT------ 224

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
                    G L                    I ID S ++Q    F+   +  +G+A G
Sbjct: 225 -----FGTNGSLTAPVGPVAVGFPLPGVDPMNIAIDYSNSSQYGSDFVVTSNRASGYAAG 279

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
           +    SV KDG V   Y +G R+   ++A+AT  +   LK   G  ++ + +SG   IG 
Sbjct: 280 EQTGLSVEKDGMVYANYSNGQRMLQGQVALATFANAGGLKNVSGTAWVESAESGAALIGV 339

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDIL 416
           PG    GE+ +G+LE +NVD+  +L  L+E QRNY  N+KV  T  +   +L
Sbjct: 340 PGVGPFGELVAGSLENSNVDLTQQLVGLMEGQRNYQANTKVLTTNKELTQVL 391


>gi|320538206|ref|ZP_08038101.1| fagellar hook-basal body protein [Treponema phagedenis F0421]
 gi|320145023|gb|EFW36744.1| fagellar hook-basal body protein [Treponema phagedenis F0421]
          Length = 452

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 101/455 (22%), Positives = 186/455 (40%), Gaps = 50/455 (10%)

Query: 14  MDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSY-------------VSGGL 60
           M     R+  + +N+ANV+T G+KR  + F  L+    S +              V  G+
Sbjct: 1   MQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQLSGASRPNEEVGGVNPKEVGLGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENV- 119
            +++ D +  QG+L  T  NTD+AIQG GFFI+K  +     TRAG F ++ +G L N  
Sbjct: 61  MVASIDTVHTQGALQTTGINTDIAIQGNGFFILKDGEKS-FYTRAGAFGVDRDGTLVNPA 119

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  + G+  ++     I+N+    E + +   +      TT               P+ 
Sbjct: 120 NGMRVQGWMAEDIEGQQIINTSDQTEDLIIPIGQKIDAKATTDVAYACNLDKRLPELPEG 179

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
              +       T  + F  YDT G      + +++      +          N +     
Sbjct: 180 A--NQADILRSTWATDFNVYDTFGEQHKLQMVFSRVPGTNNQWLATVNVDPENQAGTETR 237

Query: 240 APLNTVEVSFDPVTGYLAN------------------------SSHKAISFNDNTSGIDQ 275
             + T + + +       N                        +S+  +  N +  G   
Sbjct: 238 VGIGTTDGTENTFIVSFDNYGHLASVTDTAGNVTAPAGQVLVQASYNVVGANPDEGGAPT 297

Query: 276 QITIDIS---------KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTR 326
           + T +I+           TQ A     +  + +G+A G  ++F + + G +  +Y +G  
Sbjct: 298 RHTFNINLGEIGTSRNTITQFAERSTTKAYQQDGYAMGYLENFKIDQSGIITGVYSNGAS 357

Query: 327 VPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIA 386
             I +LA+A   ++  L+    NTY+ + +SG  +I   G    G++ +G LE +NVD+ 
Sbjct: 358 REIGQLALAGFANQGGLEKAGENTYIQSNNSGIANITVSGVMGKGKLIAGTLEMSNVDLT 417

Query: 387 SELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            + T++I  QR +   +K  QT    ++ +++LKR
Sbjct: 418 DQFTDMIITQRGFQAGAKTIQTSDTMLETVLNLKR 452


>gi|239995125|ref|ZP_04715649.1| flagellar hook protein FlgE [Alteromonas macleodii ATCC 27126]
          Length = 461

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 108/463 (23%), Positives = 170/463 (36%), Gaps = 51/463 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    +   ++NIANV+TVG+K +   F  +   S      + V  G+  
Sbjct: 2   SFNIALSGVSAAQKDLDVTANNIANVNTVGFKESRAEFGDVYAASLLSGGKTKVGDGVLT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
                   QGSL  T ++ DLAI G GFF             TRAG F ++++ F+ N  
Sbjct: 62  QEVAQQFSQGSLQFTNTSLDLAITGNGFFATVPEITSRDFSFTRAGQFKLDSDNFVVNSN 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG+P+ +        +    E + +  +  S   TT   I  NL      + P   
Sbjct: 122 GDNLLGFPVNSD-GTSASVALSTTEPVRIPDSSGSPAQTTEVDIRMNLPAGDAALDPQD- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKT--GDKKWEVSIFRQDQSTNNSFPYN 238
                    Y   +S   YD+LG S V   Y+ K        E  +      T      +
Sbjct: 180 -FDPEDPLTYNAATSVTVYDSLGDSHVMTYYFIKDATPGVDNEWYVATAIDDTLVDMTDS 238

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID------------------ 280
                    + + V G   N+   +              T D                  
Sbjct: 239 AGNDTDPATAVNSVGGNTGNAVTASKLIFSQGGDFAGMETPDGLPTLDFKMQTEALGAGI 298

Query: 281 -----------------------ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYV 317
                                   ++ TQ A  F     E +G   G+     +  DG V
Sbjct: 299 LANGSDPTQQISIDFNLDVNNATPNEPTQFASAFEVTSLEQDGLPVGRLTGIDIGPDGLV 358

Query: 318 DIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGA 377
              + +GT  PI R+A+    +E  L       +  +  SG+   G       GEI S A
Sbjct: 359 RATFSNGTSEPIVRVALVRFSNEQGLTQESSTQWKESILSGEALAGEATTGTFGEINSSA 418

Query: 378 LETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           LE ANV++ +EL ++I AQRN+  NS+  +  +     +++++
Sbjct: 419 LEQANVNLTTELIDMIIAQRNFQANSRALEVNNSLNQTILNIR 461


>gi|22127327|ref|NP_670750.1| flagellar hook protein FlgE [Yersinia pestis KIM 10]
 gi|45442796|ref|NP_994335.1| flagellar hook protein FlgE [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809055|ref|YP_652971.1| flagellar hook protein FlgE [Yersinia pestis Antiqua]
 gi|108810748|ref|YP_646515.1| flagellar hook protein FlgE [Yersinia pestis Nepal516]
 gi|145597817|ref|YP_001161893.1| flagellar hook protein FlgE [Yersinia pestis Pestoides F]
 gi|150260249|ref|ZP_01916977.1| lateral flagellar hook protein [Yersinia pestis CA88-4125]
 gi|162421081|ref|YP_001604847.1| flagellar hook protein FlgE [Yersinia pestis Angola]
 gi|165924960|ref|ZP_02220792.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939066|ref|ZP_02227618.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008888|ref|ZP_02229786.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211930|ref|ZP_02237965.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399572|ref|ZP_02305096.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419268|ref|ZP_02311021.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425161|ref|ZP_02316914.1| flagellar hook protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167466340|ref|ZP_02331044.1| flagellar hook protein [Yersinia pestis FV-1]
 gi|218927912|ref|YP_002345787.1| flagellar hook protein FlgE [Yersinia pestis CO92]
 gi|229837408|ref|ZP_04457571.1| Flagellar hook protein flgE [Yersinia pestis Pestoides A]
 gi|229840621|ref|ZP_04460780.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842828|ref|ZP_04462980.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229900945|ref|ZP_04516069.1| Flagellar hook protein flgE [Yersinia pestis Nepal516]
 gi|270487673|ref|ZP_06204747.1| flagellar hook protein FlgE [Yersinia pestis KIM D27]
 gi|294502788|ref|YP_003566850.1| flagellar hook protein [Yersinia pestis Z176003]
 gi|21960408|gb|AAM87001.1|AE013948_9 putative flagellar hook protein [Yersinia pestis KIM 10]
 gi|45437662|gb|AAS63212.1| flagellar hook protein FlgE [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774396|gb|ABG16915.1| flagellar hook protein [Yersinia pestis Nepal516]
 gi|108780968|gb|ABG15026.1| putative flagellar hook protein [Yersinia pestis Antiqua]
 gi|115346523|emb|CAL19399.1| putative flagellar hook protein [Yersinia pestis CO92]
 gi|145209513|gb|ABP38920.1| flagellar hook protein [Yersinia pestis Pestoides F]
 gi|149289657|gb|EDM39734.1| lateral flagellar hook protein [Yersinia pestis CA88-4125]
 gi|162353896|gb|ABX87844.1| flagellar hook protein [Yersinia pestis Angola]
 gi|165913022|gb|EDR31647.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923160|gb|EDR40311.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992227|gb|EDR44528.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206676|gb|EDR51156.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963262|gb|EDR59283.1| flagellar hook protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052076|gb|EDR63484.1| flagellar hook protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055924|gb|EDR65705.1| flagellar hook protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229682284|gb|EEO78376.1| Flagellar hook protein flgE [Yersinia pestis Nepal516]
 gi|229690095|gb|EEO82152.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696987|gb|EEO87034.1| Flagellar hook protein flgE [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229705531|gb|EEO91541.1| Flagellar hook protein flgE [Yersinia pestis Pestoides A]
 gi|262360820|gb|ACY57541.1| flagellar hook protein [Yersinia pestis D106004]
 gi|270336177|gb|EFA46954.1| flagellar hook protein FlgE [Yersinia pestis KIM D27]
 gi|294353247|gb|ADE63588.1| flagellar hook protein [Yersinia pestis Z176003]
 gi|320016711|gb|ADW00283.1| Flagellar hook protein flgE [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 413

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 110/421 (26%), Positives = 178/421 (42%), Gaps = 19/421 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A + ++A + +++ +S+NIAN  T G+K +   FSS+   S        G+ +S  
Sbjct: 2   SFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFSSMYAQSQP-----LGVAVSGV 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              IS+ G    T    DLAI G GFF+V+        TRAG F  + +G+L N  G  L
Sbjct: 57  SQNISKDGQKEKTGMGLDLAISGGGFFVVRESSGDKAYTRAGMFRSDVDGYLVNGQGMKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP   A           +  + + +A + A  +       NL  NA++  P  +  + 
Sbjct: 117 QGYPADAAGNI----QAGIISDLKINNAGVPAKASEQLDFMANL--NASVTAPSVSVFNP 170

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD-------KKWEVSIFRQDQSTNNSFPY 237
             +  Y   ++   YD+LG       Y+ K+          +W V       +       
Sbjct: 171 TNEKSYNFTTTSTVYDSLGREHAVAHYFVKSTTPPAGSVASEWAVHHTVDGGTATPPLTL 230

Query: 238 NVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSE 297
                  +          +  S+       +     D  I ID + TTQL+ GF   +++
Sbjct: 231 QFTDTGALIPGIPAAGSGMKGSAINLHGTFNPAGAADYDIDIDYTGTTQLSQGFTTTRNK 290

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+  G      +  DG V   + +G RV   ++ +A   S   L   +G ++  +  S
Sbjct: 291 SDGYTSGVKNAERIESDGSVYATFSNGERVLQGKVVLANFASPSGLVTQNGTSWSESNKS 350

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G   +G PG    G + SGALE +NVDI +EL  L+ AQRNY  ++K+  T    M+ L 
Sbjct: 351 GAALLGTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKIISTNDSMMNALF 410

Query: 418 S 418
            
Sbjct: 411 Q 411


>gi|163845457|ref|YP_001623112.1| flagellar hook protein FlgE [Brucella suis ATCC 23445]
 gi|163676180|gb|ABY40290.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 396

 Score =  232 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 168/421 (39%), Positives = 238/421 (56%), Gaps = 25/421 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M + G M+T +SGM+AQ+NR+S V+DNIAN   VGYKR    FSSLV PST+  Y SG +
Sbjct: 1   MSLYGMMRTGVSGMNAQANRLSTVADNIANASMVGYKRAETQFSSLVLPSTAGQYNSGSV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
               +  IS+QG +  T+S TDLAI   G+F+V+G      LTRAG F  +  G L N A
Sbjct: 61  LTDVRYGISDQGGIRSTSSTTDLAIDDNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNSA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LLG     A+  L V    GL  +NV  A L A  +T G  + NL            
Sbjct: 121 GYYLLGAGADEAAGGLTV---AGLNVVNVNAAALPAEGSTAGDFTVNLPSTDQAPAAGG- 176

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y HK+S  +Y+  G  +  DVY+TKTG  +W VS+             +  
Sbjct: 177 ---------YNHKTSLISYNDKGEKITLDVYFTKTGADEWNVSVKN---------AADGV 218

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
            + T  ++FDP TG L +  + A++     +   Q + +++  +TQ AG +   ++ ING
Sbjct: 219 EIGTTVLNFDPTTGDLVSGGNVAVNL---GAYGGQTLNLNLGGSTQRAGDYTISQAVING 275

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
            AP   K   V  DG V  +Y++GT+  +YR+ +A V S + + +  GN +LP+ +SGD+
Sbjct: 276 QAPSSIKGVDVGNDGAVVAVYENGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDV 335

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +GFP  +  G+I SG LE +N DIA ELT++IEAQR+Y  NSKVFQTGS+ MD+L++LK
Sbjct: 336 RLGFPQGDGMGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELMDVLVNLK 395

Query: 421 R 421
           R
Sbjct: 396 R 396


>gi|126444045|ref|YP_001061246.1| flagellar hook protein FlgE [Burkholderia pseudomallei 668]
 gi|134280998|ref|ZP_01767708.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia pseudomallei 305]
 gi|167725930|ref|ZP_02409166.1| flagellar hook protein FlgE [Burkholderia pseudomallei DM98]
 gi|167905090|ref|ZP_02492295.1| flagellar hook protein FlgE [Burkholderia pseudomallei NCTC 13177]
 gi|254182894|ref|ZP_04889487.1| flagellar hook protein FlgE [Burkholderia pseudomallei 1655]
 gi|254299686|ref|ZP_04967135.1| flagellar hook protein FlgE [Burkholderia pseudomallei 406e]
 gi|125657218|gb|ABN48706.1| flagellar hook protein FlgE [Burkholderia pseudomallei]
 gi|126223536|gb|ABN87041.1| flagellar hook protein FlgE [Burkholderia pseudomallei 668]
 gi|134248020|gb|EBA48104.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia pseudomallei 305]
 gi|157809637|gb|EDO86807.1| flagellar hook protein FlgE [Burkholderia pseudomallei 406e]
 gi|184213428|gb|EDU10471.1| flagellar hook protein FlgE [Burkholderia pseudomallei 1655]
          Length = 395

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 104/414 (25%), Positives = 174/414 (42%), Gaps = 23/414 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +++++ +S NIAN +T G+K     F+++V  + +N     G  I + 
Sbjct: 2   SFNIALSGINAINSQLNTISHNIANANTYGFKAGRANFATMVAGTQAN-----GTYIGSI 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              +  +G  + T    D AI G GFF+ K  D     TR G F  + +G++ +  G   
Sbjct: 57  TQSVGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSMLFTRFGYFQRDADGYIVDGFGRRA 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GY    A   + V                 A  + +     NL  +     P       
Sbjct: 117 QGYGASGAYGDIRV-----------PTDTEPAKASDSLEYVGNLSADWAA--PKNPNFDK 163

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             D  + H  +   YD+LG   +   Y+ K      +V  +             V     
Sbjct: 164 DDDTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVIAYYAMDGEIVGGNTPVQ---- 219

Query: 245 VEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPG 304
             + FD      A +S   +            I ++ + TTQ+AG      +  NG+A G
Sbjct: 220 TVLQFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGETTTTVNRDNGYAAG 279

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
            P +  + +DG V + Y +G +  +  LA+AT  ++D L       +  +  SG+  IG 
Sbjct: 280 VPGEVMLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLSAVGDTAWRASAASGNPLIGS 339

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
            G    G++ +G+LE +N D+  EL +++ AQRNY  NSKV  T +  M  L+ 
Sbjct: 340 AGSGALGKVVAGSLELSNADVTQELVDMMSAQRNYQANSKVLSTENQMMQALMQ 393


>gi|289548122|ref|YP_003473110.1| fagellar hook-basal body protein [Thermocrinis albus DSM 14484]
 gi|289181739|gb|ADC88983.1| fagellar hook-basal body protein [Thermocrinis albus DSM 14484]
          Length = 454

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 112/465 (24%), Positives = 187/465 (40%), Gaps = 57/465 (12%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN--------- 53
           +L S   A++G++A    +   SDN+ANV+T+G+K +   F  ++   T           
Sbjct: 1   MLRSFFNAVTGLNAYRTWMDITSDNLANVNTIGFKASRPIFQDVISSVTVGLNTVTNTIK 60

Query: 54  -SYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR-DNVNCLTRAGDFHIN 111
            +    G+ I +   I   G+   T  NTDLAIQG+G FI+K      +  TR G+F ++
Sbjct: 61  TTTYGAGVLIDSTQKIWTIGNFKQTGINTDLAIQGRGLFILKDPISGAHYYTRDGEFRLS 120

Query: 112 NEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKN 171
            +GF+ N AG  L G+ +      +                +L   PT         + N
Sbjct: 121 RDGFMVNSAGLKLQGFRVDENGRTVGTGLED-----IKVVPQLEPKPTGVINFLQPSNLN 175

Query: 172 ATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTG-DKKWEVSIFRQDQS 230
           AT   P   P +    + Y ++ +   YD+LG+    D+Y+ KT    +WE+ +      
Sbjct: 176 ATATEP-PNPFNPLDPSSYNYRYTLTIYDSLGTPYQADMYFRKTNLPNQWEIHLRADIDP 234

Query: 231 TNNSFPYNVAPLNTVE--------------------------------VSFDPVTGYLAN 258
            +  +  +     T +                                 +  P  G   +
Sbjct: 235 NSPGYELSGDWTVTFDSYGKLIYDNATVLREPQGSNFAYYLNPANLSVPASTPSGGTFPS 294

Query: 259 SSHKAISFNDN--TSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGY 316
           +S   I    +  +   +    I  S  TQ A  F+   S+           + +S+DG 
Sbjct: 295 ASVWRIYVGTSLQSGAPNPGQPIPTSFVTQHASDFVVTASQNGYARGDLVDVYVLSEDGA 354

Query: 317 VDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSG 376
           V  +Y +G  +P+YR+A+A     + L     N Y         ++  PG     ++ SG
Sbjct: 355 VVGVYSNGKSLPLYRVAVAVFSDPEELIKKGANLYTSIS---TPTVMVPG--GAEKVRSG 409

Query: 377 ALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
            LE +NVDIA+E   LI AQR Y  N+K     +  +D  ++L R
Sbjct: 410 MLEMSNVDIATEFVNLISAQRAYQANAKTITATNAVLDETVNLVR 454


>gi|121601827|ref|YP_989383.1| flagellar hook protein FlgE [Bartonella bacilliformis KC583]
 gi|120614004|gb|ABM44605.1| flagellar hook protein FlgE [Bartonella bacilliformis KC583]
          Length = 404

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 129/421 (30%), Positives = 188/421 (44%), Gaps = 17/421 (4%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGI G M T++SGM+AQ  R+S +++N+AN  TVGYKRT + FS+ V PS   +YV GG+
Sbjct: 1   MGIYGMMHTSVSGMNAQGKRLSGIAENVANAGTVGYKRTNVQFSNYVTPSGDYAYVPGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           +      IS  G    T    D  I G GFF V+  +    LTRAG F  + +G+L N +
Sbjct: 61  KSHVGHDISIYGPARATGRPGDAMINGNGFFRVEDENGNEFLTRAGSFSRDKDGYLRNSS 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  LL                Q ++             TT      N D +A  +     
Sbjct: 121 GHYLLND------------EGQRIQIRGGPTDLFGPEVTTGIDFKANFDASAESLGEGV- 167

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
                    Y  K S   YD+ G  V  D Y  KT D KW  ++                
Sbjct: 168 -IDPEDPKSYNQKKSVTVYDSQGKKVQVDFYMRKTADNKW--TVDAYHGDNKVGTADFNF 224

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
                  +  P        +            I+     + S  TQ    +  +  E NG
Sbjct: 225 DKEGNLQAPLPDFTLTLPENDGGDPPGTFQVAINLGGLGEDSLVTQKGNSYAFEA-EANG 283

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
              G    F+  K+G V++ Y +     I  + +ATV S ++L +  G  +     +G  
Sbjct: 284 MEVGSFDGFTFGKNGEVEVKYTNQKTRVISYVGLATVTSPESLTVLSGTVFQTNTRTGAQ 343

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +G PG    G + +G LE +NV+++ ELT++IE+QRNY  NSKVFQTGS+ MD++++LK
Sbjct: 344 MVGRPGDGVFGSLTAGYLEDSNVEMSEELTDMIESQRNYTANSKVFQTGSELMDVIVNLK 403

Query: 421 R 421
           R
Sbjct: 404 R 404


>gi|126734127|ref|ZP_01749874.1| flagellar hook protein FlgE, putative [Roseobacter sp. CCS2]
 gi|126716993|gb|EBA13857.1| flagellar hook protein FlgE, putative [Roseobacter sp. CCS2]
          Length = 444

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 114/444 (25%), Positives = 188/444 (42%), Gaps = 23/444 (5%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+  +++G+ A + R++ +SDNI+N  T GYKR    F S+V  S   +Y +GG+
Sbjct: 1   MTISSSLNASVAGLAANATRLATISDNISNSSTYGYKRAVTDFQSMVIESGQGTYSAGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGF--------FIVKGRDNVNCLTRAGDFHINN 112
             +T  +I E+G+L+ T++ TDLA++G+G           V   DN   LT  G F  + 
Sbjct: 61  RTTTSRLIDERGALVSTSNPTDLAVRGRGMLPVTSETSVTVDNGDNPLFLTTTGSFRPDA 120

Query: 113 EGFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDK 170
           +G+L +  G VLLG P            +S  GL  + +   + +   TT   +S NL  
Sbjct: 121 QGYLRSPGGLVLLGVPAAADGTIPNYPRDSIDGLVPVQINANQFAGEATTRVDLSVNLPA 180

Query: 171 NATIITPDKT-------PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS 223
            +T                 N   +     +        G+S  + +    +        
Sbjct: 181 TSTREGASGESESLSVEYFDNLGASSNLSFTFTPTVPANGASNEWTMEIRDSESDVDADG 240

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS- 282
           I         +F        T+              ++  I+   + +     + I+I  
Sbjct: 241 IPDVVGEYTLTFDATRGGGGTLANVDFADPAAPVGGAYDPITGALSINVDGGPMEINIGE 300

Query: 283 -----KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
                  TQL+  F P     NG   G      V ++G+V   +D G    +Y++ +  V
Sbjct: 301 LGSSIGLTQLSDAFAPVSISKNGTPVGSLTSIEVDQNGFVRASFDIGINRVLYQIPLVDV 360

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
           P+ + L+  D  +Y  T DSG   +   G    G+I   A E +  D+A ELTELI+ QR
Sbjct: 361 PNVNGLETLDQQSYRVTPDSGSFFLWDAGDGPTGDIVGFAREESATDVAGELTELIQTQR 420

Query: 398 NYAVNSKVFQTGSDFMDILISLKR 421
            Y+ N+KV QT  + +    ++KR
Sbjct: 421 AYSSNAKVIQTVDEMLQETTNIKR 444


>gi|17548566|ref|NP_521906.1| flagellar hook protein FlgE [Ralstonia solanacearum GMI1000]
 gi|17430814|emb|CAD17496.1| probable flagellar hook protein flge [Ralstonia solanacearum
           GMI1000]
          Length = 401

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 105/419 (25%), Positives = 184/419 (43%), Gaps = 23/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S   +    +  G+++
Sbjct: 2   GFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  G++ +  G
Sbjct: 62  TKVSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY +              L  + +   +L+ + TT    S NLD   T+  P  TP
Sbjct: 122 QNLTGYGVDATGKINT----AVLTNLQIPVNDLAPLATTNTAFSINLDAAGTV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A + H  S   YD  G+S +   YY +T       S       T  +   ++  
Sbjct: 176 FSATNSATFNHSVSEQVYDGTGTSHMLTNYYVRTAAGWDVYSQVDGANPTGGNPVTSLTF 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            ++  ++  P    +A +                   +D + TTQ  GGF       +G+
Sbjct: 236 NSSGVLTSSPSKVAVAFAGMSIA-------------NMDFTGTTQYGGGFNDTTVSQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   
Sbjct: 283 ATGRLASYSVGTDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGAPQ 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 MGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDTILQTLVSMR 401


>gi|170725955|ref|YP_001759981.1| flagellar hook protein FlgE [Shewanella woodyi ATCC 51908]
 gi|169811302|gb|ACA85886.1| flagellar basal body FlaE domain protein [Shewanella woodyi ATCC
           51908]
          Length = 453

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 99/455 (21%), Positives = 172/455 (37%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+++G+K +   F+ +   S    S + V GG   
Sbjct: 2   SFNIALSGISAAQKDLNTTANNIANVNSIGFKESRAEFADVYANSIFANSKTAVGGGATT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGR--DNVNCLTRAGDFHINNEGFLENVA 120
           S       QGSL  T +  D+AI G GFF+         +  TRAG F +++  +L +  
Sbjct: 62  SQVAQQFHQGSLQFTNNALDMAINGGGFFVTSSSLDSQDHTFTRAGAFKVDSNNYLVDSQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  + +          S      + +     S   T    I  NL+     + P   
Sbjct: 122 GNFLQTFGVDKD-GNSTSVSLTTTSPVIIPDTAGSPKMTDEIGIQMNLNAGDDTLDPAA- 179

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + ++   YD+LG   +   Y+ +           W        +  + +
Sbjct: 180 -FDPNDRDTYNNSTAVTLYDSLGEPHIMTTYFVRPPQAAYTGASNWVAFYAVDGKQVDLA 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHKAISFND-------------------------- 268
            P      +T        +G    +     S                             
Sbjct: 239 GPAGTYQTDTTGDGNADSSGSATTAGGWKGSVLTYNDTGAYVGSDPAVVTTEELGVNGAG 298

Query: 269 ---NTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q + +  +  TQ A  F   +   +G   G+  +  V  DG ++  Y +G+
Sbjct: 299 VLGPGADGTQTLAVKYNNPTQYASTFEVTELTQDGTTVGRLTNVEVGADGLINASYSNGS 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            VP+ R+A+A   +E  L      ++  + DSG    G       G I S ALE +NVD+
Sbjct: 359 TVPLARVALARFANEQGLTQVGNTSWKASLDSGLALAGEANSGTFGSIRSSALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTVLQIR 453


>gi|299068732|emb|CBJ39971.1| flagellar hook protein FlgE [Ralstonia solanacearum CMR15]
          Length = 401

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 109/419 (26%), Positives = 188/419 (44%), Gaps = 23/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S   +    +  G+++
Sbjct: 2   GFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  G++ +  G
Sbjct: 62  TKVSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY                L  + +   +L+ + TT    S NLD   T+  P  TP
Sbjct: 122 QNLTGYAADATGKINT----AVLTNLQIPVNDLAPLATTNTAFSINLDAAGTV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A Y H  S   YD  G+S +   YY +T    W+V       +     P     
Sbjct: 176 FSATNSATYNHSVSEQVYDGTGTSHMLTNYYVRT-GTGWDVYSTVDGAAPTGGNPVTS-- 232

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
                ++F+      ++ S  A++F   +       ++D + TTQ  GGF       +G+
Sbjct: 233 -----LTFNSSGALTSSPSKVAVAFTGMSIA-----SMDFTGTTQYGGGFNDTSITQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   
Sbjct: 283 ATGRLASYSVGNDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQ 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 MGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDTILQTLVSMR 401


>gi|300693338|ref|YP_003749311.1| flagellar hook protein flge [Ralstonia solanacearum PSI07]
 gi|299075375|emb|CBJ34670.1| flagellar hook protein FlgE [Ralstonia solanacearum PSI07]
          Length = 401

 Score =  232 bits (590), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 105/419 (25%), Positives = 185/419 (44%), Gaps = 23/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +  +  N+AN +TVGYK++   F  +   S   +    +  G+++
Sbjct: 2   GFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYARSLVGASDNQIGQGVDV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  G++ +  G
Sbjct: 62  TKVSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTRNGQFQTDKNGYIISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY +              L  + +   +L+ + TT    + NLD  AT+  P  TP
Sbjct: 122 QNLTGYGVDATGKINT----AVLTNLQIPVNDLAPLATTNTAFTINLDAAATV--PTTTP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A + H  S   YD  G+S +   YY +T       S       T  +   ++  
Sbjct: 176 FSATNSATFNHSVSEQVYDGTGTSHMLTNYYVRTATGWDVYSQVDGANPTGGNPVTSLTF 235

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
            ++  ++  P    +A +                   +D + TTQ  GGF       +G+
Sbjct: 236 NSSGTLTSSPSKVAVAFAGMSIA-------------NMDFTGTTQYGGGFNDTTVSQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG +   Y +G    + ++A+    + D L+   GN ++ T +SG   
Sbjct: 283 ATGRLASYSVGTDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGSPQ 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD+++EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 MGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVSMR 401


>gi|225620340|ref|YP_002721597.1| flagellar hook protein FlgE [Brachyspira hyodysenteriae WA1]
 gi|225215159|gb|ACN83893.1| flagellar hook protein FlgE [Brachyspira hyodysenteriae WA1]
          Length = 423

 Score =  232 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 93/424 (21%), Positives = 166/424 (39%), Gaps = 24/424 (5%)

Query: 21  VSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS-------------YVSGGLEISTKDM 67
           +  V +NIANV+T G+KR  + F  ++  S S +              V  G+ ++T D 
Sbjct: 1   MDVVGNNIANVNTYGFKRGRVTFKDMISQSLSGAAKPQEDRGGINPQQVGLGMMVATIDT 60

Query: 68  ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGY 127
           I  QG+L  T  NTDLAIQG+GFFI K  +N    TR G F ++ +G+L N + G  +  
Sbjct: 61  IHTQGALQVTGVNTDLAIQGEGFFIEKRGNNS-YYTRNGAFSLDKDGYLVNPSNGYKVQG 119

Query: 128 PLKNASAPLIVNSFQGL----ERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKH 183
                +               + I    ++  A  T       NL K       D T   
Sbjct: 120 WNAVLNPETGEMELNTSAGVEDVIIPVGSKDPARATANTKYFCNLQKTGETHQSDLTIYD 179

Query: 184 NGRDAEYTHKSSFAAYDTLGSSVVYDVYYTK--TGDKKWEVSIFRQDQSTNNSFPYNVAP 241
           +         +           V+     T+        +      + +    F    + 
Sbjct: 180 STGIPRQLRATFTRTDVNRWDMVIDIPDATEGSVSVSAGDPVEGGGNNTFQLVFNDAGSL 239

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID----ISKTTQLAGGFIPQKSE 297
           ++  + +     G L  +        +        +T+      +  TQ       +  E
Sbjct: 240 ISVSDGTNTQTEGVLMPNVSFTYQGTEGEVNQTINLTLGEVGLFNGITQFESPSTTKAIE 299

Query: 298 INGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDS 357
            +G+  G  + FS    G +  ++ +G R  + ++A+A   +   L+      ++ + +S
Sbjct: 300 QDGYTMGMLEGFSFDDSGQITGVFTNGNRKTLGQVALAKFNNAGGLEKAGDTLFVQSNNS 359

Query: 358 GDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILI 417
           G  +IG       G I +G LE +NVD++ + T++I  QR +  N++   T    +  +I
Sbjct: 360 GAANIGTAAAEGRGSIKAGTLEMSNVDLSEQFTDMIVTQRGFQSNARTITTADQMLQEVI 419

Query: 418 SLKR 421
           +LKR
Sbjct: 420 ALKR 423


>gi|229189850|ref|ZP_04316861.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 10876]
 gi|228593658|gb|EEK51466.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 10876]
          Length = 437

 Score =  232 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 100/438 (22%), Positives = 182/438 (41%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GSL  T+   + AI+GKG F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSLTLTSDKMETAIEGKGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +     +      + +            + +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDESVQKNPVTGEITKGGTVKIPFGKGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMTYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD+++E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSAEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|262404540|ref|ZP_06081095.1| flagellar hook protein FlgE [Vibrio sp. RC586]
 gi|262349572|gb|EEY98710.1| flagellar hook protein FlgE [Vibrio sp. RC586]
          Length = 434

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 97/437 (22%), Positives = 166/437 (37%), Gaps = 29/437 (6%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
             ++SG+ A    ++  S+NIAN +T G+K +   F  +   S    + +    G++ + 
Sbjct: 3   YISLSGLSAAQMDLNTTSNNIANANTFGFKESRAEFGDVYSTSLFTNAKTTPGQGVQAAK 62

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFI---VKGRDNVNCLTRAGDFHINNEGFLENVAG 121
                 +GS ++T +  DL I G GFF     K     N LTR G FH++   ++     
Sbjct: 63  VAQQFHEGSSIYTNNPLDLRIAGTGFFAVAKDKMVPQQNELTRNGAFHLDKNSYMVTAND 122

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             LLGY +   S  ++       + IN+         T    ++ NL  N  +  P    
Sbjct: 123 EFLLGYEVNPDSGDVLSYE---PKPINIPPQFGKPKQTANIDLAANLPANGDLKDP--AL 177

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   Y   +S   YD++G       YY K   +      +          P NV  
Sbjct: 178 FDITDPETYNRTTSSTIYDSMGQPYKLTTYYLKDMTQANTWQTYYTVTDKTGEKPINVVG 237

Query: 242 LNTVEVSFDPVTGYLANS------------------SHKAISFNDNTSGIDQQITIDISK 283
            +              N+                     A   + N +   Q ++  +  
Sbjct: 238 GDATSPKGHVGHTMKFNNDGTLASLNNGQPIVSEALGAGANPVDLNGADATQTLSFSLDN 297

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQ A  F   K + +G   G        ++G V   Y +G    + R+A+  V +E  L
Sbjct: 298 ATQFAAPFELTKFDQDGATTGFLTKIDFDENGSVLATYSNGQNTTLGRVALVRVANEQGL 357

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               G  +  T+ SGD   G       G + +G+LE +N+D+  EL +LI AQRN+  NS
Sbjct: 358 DKKGGTQWDATQFSGDKIWGESNKGSFGSVSNGSLEQSNIDMTQELVDLISAQRNFQANS 417

Query: 404 KVFQTGSDFMDILISLK 420
           +  +  +     ++ ++
Sbjct: 418 RALEVHNQLQQNILQIR 434


>gi|206562843|ref|YP_002233606.1| flagellar hook protein FlgE [Burkholderia cenocepacia J2315]
 gi|198038883|emb|CAR54845.1| flagellar hook protein 2 FlgE2 [Burkholderia cenocepacia J2315]
          Length = 414

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 112/418 (26%), Positives = 176/418 (42%), Gaps = 12/418 (2%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYANSVATSVNTQIGIGTRLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF     + V   +R G FH +  G + +  G  L
Sbjct: 64  VQQNFGQGTINSTKSSLDVAINGNGFFQ-MSSNGVTTYSRDGTFHRDKNGAIVDAQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY            +       N      +  P  T  I+   + NA    P KTP + 
Sbjct: 123 MGYAAGAGGVINTAQTVPLQAPTN------NIAPRATSKITGQFNLNAQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + SS   YDTLG S    +Y+ K+    W      Q Q+  N           
Sbjct: 177 TDNTTYNYNSSIQVYDTLGGSQQVTMYFAKSAAGTWLAYAGVQGQTPTNLGTVTFDASGR 236

Query: 245 VEVSFDPVTGYLAN--SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +    TG              N       Q +T+D+  TTQ  G         +G A
Sbjct: 237 ISSTTSAATGQPTPSLGQFAFSIPNTTGGANPQNLTLDLGGTTQYGGKDGVTNLAQDGFA 296

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G    FS+  DG +   Y +G    +  +A+A   + + L    GN Y  T  SG   I
Sbjct: 297 SGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNIGGNQYAETAASGVPQI 356

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             PG   HG +   ALE +NV++ +EL  LI AQRNY  N++  +T       L++L+
Sbjct: 357 AAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQTIKTQQAVDQTLLNLR 414


>gi|258621049|ref|ZP_05716083.1| flagellar hook protein [Vibrio mimicus VM573]
 gi|258625277|ref|ZP_05720185.1| flagellar hook protein [Vibrio mimicus VM603]
 gi|262170825|ref|ZP_06038503.1| flagellar hook protein FlgE [Vibrio mimicus MB-451]
 gi|258582450|gb|EEW07291.1| flagellar hook protein [Vibrio mimicus VM603]
 gi|258586437|gb|EEW11152.1| flagellar hook protein [Vibrio mimicus VM573]
 gi|261891901|gb|EEY37887.1| flagellar hook protein FlgE [Vibrio mimicus MB-451]
          Length = 434

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/437 (22%), Positives = 167/437 (38%), Gaps = 29/437 (6%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEIST 64
             ++SG+ A    ++  S+NIAN +T G+K +   F  +   S    + +    G++ + 
Sbjct: 3   YISLSGLSAAQMDLNTTSNNIANANTFGFKESRAEFGDVYSTSLFTNAKTTPGQGVQAAK 62

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGR---DNVNCLTRAGDFHINNEGFLENVAG 121
                 +GS ++T +  DL I G GFF V         N LTR G FH++   ++     
Sbjct: 63  VAQQFHEGSSIYTNNPLDLRIAGTGFFAVAKDKIVPQQNELTRNGAFHLDKNSYMVTAND 122

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             LLGY +   S  ++       + IN+         T    +  NL  N  +  P  T 
Sbjct: 123 EFLLGYEVNPDSGDVLSYE---PKPINIPPQFGKPKQTANIDLGANLPANGELKDP--TL 177

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                   Y   +S   YD++G       YY K  ++      +          P NV  
Sbjct: 178 FDITDPETYNRTTSSTIYDSMGQPYKLTTYYLKDMNQPNTWQTYYTVTDKTGEKPINVVG 237

Query: 242 LNTVEVSFDPVTGYLANS------------------SHKAISFNDNTSGIDQQITIDISK 283
            +              N+                         + N + + Q ++  +  
Sbjct: 238 GDATSPGGHVGHTMRFNNDGTLASLNNGQPIVTEPLGGGTNPVDLNGADVSQTLSFSLDS 297

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            TQ A  F   K + +G   G        ++G V   Y +G    + R+A+  V +E  L
Sbjct: 298 ATQFAAPFELTKFDQDGATTGFLTKIDFDENGSVLATYSNGQNTTLGRVALVRVANEQGL 357

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
               G  +  T+ SGD   G       G I +G+LE +N+D+  EL +LI AQRN+  NS
Sbjct: 358 DKKGGTQWDATQFSGDKIWGESNKGSFGSISNGSLEQSNIDMTQELVDLISAQRNFQANS 417

Query: 404 KVFQTGSDFMDILISLK 420
           +  +  +     ++ ++
Sbjct: 418 RALEVHNGLQQNILQIR 434


>gi|228952133|ref|ZP_04114228.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228807665|gb|EEM54189.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 437

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/438 (22%), Positives = 181/438 (41%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GSL  T+   + AI+G G F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSLTLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +     +      + +            + +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDESVQKNPVTGEITKGGTVKIPFGKGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMTYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD+++E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSAEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|229144365|ref|ZP_04272771.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-ST24]
 gi|228639152|gb|EEK95576.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-ST24]
          Length = 437

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 179/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +            + +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKNPVTGEITKGGTVKIPFGKGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMRYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|241589579|ref|YP_002979604.1| protein of unknown function DUF1078 domain protein [Ralstonia
           pickettii 12D]
 gi|240868291|gb|ACS65950.1| protein of unknown function DUF1078 domain protein [Ralstonia
           pickettii 12D]
          Length = 401

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 111/419 (26%), Positives = 190/419 (45%), Gaps = 23/419 (5%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNS---YVSGGLEI 62
             +  +SG+DA S  +S++  N+ANV+TVGYK++ + F  +   S   +    +  G+ +
Sbjct: 2   GFQQGLSGLDAASKNLSSIGSNVANVNTVGYKKSTVQFGDVYARSLVGATDNQIGQGVSV 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFHINNEGFLENVAG 121
           +       QG++  T +  D+AI G GF+ +          TR G F  +  GF+ +  G
Sbjct: 62  TRVSQSFTQGNVTVTGNPLDIAINGMGFYRMVDSSSGQVSYTRNGQFQTDKNGFVISATG 121

Query: 122 GVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTP 181
             L GY +  +           L  + +   +L    T       NL+  A +  P  TP
Sbjct: 122 QNLTGYGVDASGKVNT----AALTNLRIPVNDLVPQATRNTAFGVNLNAAAAV--PGATP 175

Query: 182 KHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAP 241
                 A + H  S   YD  G+  +   YY +TG   W+V       S  +  P     
Sbjct: 176 FSPTNSATFNHSVSEQVYDGTGAPHMMTNYYVRTGAG-WKVYSQVDGTSPVSGNPVTT-- 232

Query: 242 LNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGH 301
                ++F+      + S+  A+SF           +ID + TTQ  GG+     + +G+
Sbjct: 233 -----LTFNSNGQLTSGSTKIAVSFP-----GMSINSIDFAGTTQYGGGYNDVMVKQDGY 282

Query: 302 APGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDIS 361
           A G+   +SV  DG V   Y +G      ++A+A   + + L+   GN ++ T +SG  +
Sbjct: 283 ATGRLASYSVGIDGTVTGQYSNGRSAVFGQIAMANFKAPEGLQNIGGNQWVETANSGSPN 342

Query: 362 IGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           +G PG    G + S A+E +NVD++ EL  +I AQR+Y  N++  +T    +  L+S++
Sbjct: 343 LGTPGMGSFGLLRSSAVEQSNVDLSVELVNMIVAQRSYQANAQTIKTEDSLLQTLVSIR 401


>gi|30261751|ref|NP_844128.1| flagellar hook protein FlgE [Bacillus anthracis str. Ames]
 gi|47526975|ref|YP_018324.1| flagellar hook protein FlgE [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184583|ref|YP_027835.1| flagellar hook protein FlgE [Bacillus anthracis str. Sterne]
 gi|65319023|ref|ZP_00391982.1| COG1749: Flagellar hook protein FlgE [Bacillus anthracis str.
           A2012]
 gi|165869249|ref|ZP_02213908.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0488]
 gi|167633465|ref|ZP_02391790.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0442]
 gi|167639152|ref|ZP_02397425.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0193]
 gi|170686150|ref|ZP_02877372.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0465]
 gi|170706520|ref|ZP_02896980.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0389]
 gi|177650602|ref|ZP_02933569.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0174]
 gi|190566422|ref|ZP_03019340.1| putative flagellar hook protein FlgE [Bacillus anthracis
           Tsiankovskii-I]
 gi|227815486|ref|YP_002815495.1| putative flagellar hook protein FlgE [Bacillus anthracis str. CDC
           684]
 gi|229600977|ref|YP_002866149.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0248]
 gi|254683244|ref|ZP_05147105.1| flagellar hook protein FlgE [Bacillus anthracis str. CNEVA-9066]
 gi|254723830|ref|ZP_05185616.1| flagellar hook protein FlgE [Bacillus anthracis str. A1055]
 gi|254734597|ref|ZP_05192309.1| flagellar hook protein FlgE [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741006|ref|ZP_05198694.1| flagellar hook protein FlgE [Bacillus anthracis str. Kruger B]
 gi|254755249|ref|ZP_05207283.1| flagellar hook protein FlgE [Bacillus anthracis str. Vollum]
 gi|254759785|ref|ZP_05211809.1| flagellar hook protein FlgE [Bacillus anthracis str. Australia 94]
 gi|30255979|gb|AAP25614.1| putative flagellar hook protein FlgE [Bacillus anthracis str. Ames]
 gi|47502123|gb|AAT30799.1| putative flagellar hook protein FlgE [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178510|gb|AAT53886.1| flagellar hook protein FlgE, putative [Bacillus anthracis str.
           Sterne]
 gi|164714689|gb|EDR20207.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0488]
 gi|167512942|gb|EDR88315.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0193]
 gi|167531503|gb|EDR94181.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0442]
 gi|170128618|gb|EDS97485.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0389]
 gi|170669847|gb|EDT20588.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0465]
 gi|172083746|gb|EDT68806.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0174]
 gi|190562557|gb|EDV16524.1| putative flagellar hook protein FlgE [Bacillus anthracis
           Tsiankovskii-I]
 gi|227006608|gb|ACP16351.1| putative flagellar hook protein FlgE [Bacillus anthracis str. CDC
           684]
 gi|229265385|gb|ACQ47022.1| putative flagellar hook protein FlgE [Bacillus anthracis str.
           A0248]
          Length = 437

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 177/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + + I            +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEIIKGGSVQIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|228933037|ref|ZP_04095900.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228826638|gb|EEM72409.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 437

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/438 (22%), Positives = 179/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K      +  G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKENVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +              +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|254511352|ref|ZP_05123419.1| flagellar hook protein FlgE [Rhodobacteraceae bacterium KLH11]
 gi|221535063|gb|EEE38051.1| flagellar hook protein FlgE [Rhodobacteraceae bacterium KLH11]
          Length = 439

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 118/431 (27%), Positives = 192/431 (44%), Gaps = 10/431 (2%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I  S+   ++ + A +NR++ +SDNIAN  T GYKR    F S+V      SY +GG+
Sbjct: 9   MTISSSLNAGVAALKANANRLATISDNIANSSTFGYKRVETDFHSMVTSGQGGSYSAGGV 68

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGF------FIVKGRDNVNCLTRAGDFHINNEG 114
             +++ +I ++GSL+ T ++TDLA++G+G         +    N   LT  G F  N EG
Sbjct: 69  RTTSQRLIDQRGSLVTTNNSTDLAVRGRGMLPVRPSSQIAAGSNEMMLTTTGSFRTNEEG 128

Query: 115 FLENVAGGVLLGY--PLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNA 172
           +L   +G VLLG+      +   +  ++   LE I +   +LS  PTT   +  NL   A
Sbjct: 129 YLVTQSGLVLLGWRAAADGSIPSVPRDTPAALEPIQLSVNQLSGAPTTEMNLRMNLPATA 188

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
           T        +    +       S +    L  +V       +      + +         
Sbjct: 189 TDAGAPGDAQPLSVEYFDNLGKSESVDIELVPTVPAVGSSNEWTMTLRDSASGGTVIGEY 248

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSG--IDQQITIDISKTTQLAGG 290
                +         S   VTG   + +  ++  N       I+     D    TQL+  
Sbjct: 249 TLTFTDSRTAGGTLASVTAVTGGAYDPATGSMVVNVAGGPMEINIGQLGDADGITQLSDT 308

Query: 291 FIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNT 350
           F P     +G A G      V ++GYV   YD G    ++++ +A VP+ + L   D  T
Sbjct: 309 FAPVSITRDGSAVGTMTSVQVDENGYVYAFYDTGVSRRMFQIPLADVPNPNGLTALDSQT 368

Query: 351 YLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGS 410
           Y P+RDSG   +   G    G++ S A E +  D+A+ELT +I+ QR Y+ ++KV QT  
Sbjct: 369 YAPSRDSGTFFLWNAGEGPTGDLVSFAREESTTDVATELTSMIQTQRAYSSSAKVIQTVD 428

Query: 411 DFMDILISLKR 421
           + +    ++KR
Sbjct: 429 EMLQETTNIKR 439


>gi|323137001|ref|ZP_08072081.1| fagellar hook-basal body protein [Methylocystis sp. ATCC 49242]
 gi|322397762|gb|EFY00284.1| fagellar hook-basal body protein [Methylocystis sp. ATCC 49242]
          Length = 417

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 153/420 (36%), Positives = 235/420 (55%), Gaps = 6/420 (1%)

Query: 2   GILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLE 61
              G   T++ GM AQS+ ++ +S+NIAN  TVGYKR    F +++     ++   GG+ 
Sbjct: 3   STFGLFNTSIMGMSAQSDALANISENIANSGTVGYKRATTHFLTVLSGFQGSNQFGGGVS 62

Query: 62  ISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAG 121
             ++  I+ QG+LMHT S+TD+AI+G GFF+V        LTRAG F  ++ G L N AG
Sbjct: 63  TRSRYDITGQGALMHTGSSTDMAIRGNGFFVVSDGAGGTFLTRAGSFVPDSSGRLVNAAG 122

Query: 122 GVLLGYPLKNASAPLIVNSF-QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
             L+G+P   A+      +    +  + +++  L A PTT+G +S NL  +AT++     
Sbjct: 123 YYLMGFPAGPAAPTTSATNALSSMSIVQIRNDRLYANPTTSGVLSANLPVSATVVPAANL 182

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           P  N   A+++ K+S   YD LG  VV DVYY KT D  WE++++    +T+  FPY   
Sbjct: 183 PSTNTAGAQFSAKTSLTVYDNLGKPVVLDVYYAKTADNTWEMTMYDASGATSGGFPYASG 242

Query: 241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEING 300
           P+ T  ++F+P  G +A+      +     S     +T+D+S TTQL   F+   + +NG
Sbjct: 243 PIATQTLTFNPANGSIASGGTLNFTVPGGAS-----VTLDMSNTTQLGAPFVVNNATVNG 297

Query: 301 HAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDI 360
           +A G  +   +S DG +    D+G  VP Y + IA V +   L  + GN Y  T  SG I
Sbjct: 298 NAAGAIRQVQISSDGTLSYQLDNGQMVPAYLIGIANVAAPTELASYTGNVYTATGASGPI 357

Query: 361 SIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           S+G PG    G+I S  LE +NVD+A+EL+ +I AQR+Y  N++ FQ  S+ + +L +LK
Sbjct: 358 SVGAPGKGGFGDIASATLEASNVDLATELSTMIIAQRSYTANTQSFQVASEILQVLNNLK 417


>gi|238758110|ref|ZP_04619290.1| Flagellar hook protein FlgE [Yersinia aldovae ATCC 35236]
 gi|238703648|gb|EEP96185.1| Flagellar hook protein FlgE [Yersinia aldovae ATCC 35236]
          Length = 428

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 93/436 (21%), Positives = 171/436 (39%), Gaps = 30/436 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
               A+SG++A S+ +  + +NIAN  T G+K  +++F+ +       S    G++++  
Sbjct: 2   GFSQAVSGLNAASSNLDVIGNNIANSATSGFKAGSVSFADMFA----GSQTGMGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+   T    DLAI   GFF ++         R G F ++    + N+ G  L 
Sbjct: 58  TQDFNDGTPTTTNRRLDLAISQNGFFRMQDSSGGVYFARNGQFKLDENRNIVNMQGLSLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  V        +++    ++A  TT+G +  NL     +IT         
Sbjct: 118 GYPA--TGTPPTVQQGANPVPLSIPQDMITAKATTSGNMVANLTSTHKVITDA---FDPQ 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
           +   Y+  ++   +D+LG+    +VY+ KT +     + +      +++   +V      
Sbjct: 173 KPDTYSFVNNMTTFDSLGNRHDINVYFVKTAEDSTGGNTWTVYTKDSSATLKDVTKPYDP 232

Query: 246 EVSFDPVTGYLA---------------------NSSHKAISFNDNTSGIDQQITIDISKT 284
                                            + +        N +             
Sbjct: 233 TDPAAASARGTMVFDTNGALKSVTPTGSTTSTTDFNMTIPMGVVNGAPAQTFDLNVAGSK 292

Query: 285 TQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLK 344
            Q  G          G+A G+   F V+KDG V   Y +     + ++ +    + + L 
Sbjct: 293 QQNTGTDSITAQNQTGYAAGEFTGFQVNKDGSVVGTYSNQQTQLLGQIVLVNFSNPEGLA 352

Query: 345 LFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK 404
               N +  T+ SG+  +G  G    G + SGALE++NVD++ EL  +I AQRNY  N++
Sbjct: 353 SQGDNVWKETQSSGNPILGTAGGGGFGSLTSGALESSNVDLSKELVNMIVAQRNYQSNAQ 412

Query: 405 VFQTGSDFMDILISLK 420
             +T    +  L++L+
Sbjct: 413 TIKTQDQILQTLVNLR 428


>gi|170735956|ref|YP_001777216.1| flagellar basal body FlaE domain-containing protein [Burkholderia
           cenocepacia MC0-3]
 gi|169818144|gb|ACA92726.1| flagellar basal body FlaE domain protein [Burkholderia cenocepacia
           MC0-3]
          Length = 414

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 111/418 (26%), Positives = 175/418 (41%), Gaps = 12/418 (2%)

Query: 8   KTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTS---NSYVSGGLEIST 64
           +  +SG+   S+ +  + +NIAN +TVG+K+    F+ +   S +   N+ +  G  +++
Sbjct: 4   QQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYANSVATSVNTQIGIGTRLAS 63

Query: 65  KDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
                 QG++  T S+ D+AI G GFF     + V   +R G FH +  G + +  G  L
Sbjct: 64  VQQNFGQGTINSTKSSLDVAINGNGFFQ-MSSNGVTTYSRDGTFHRDKNGAIVDAQGRNL 122

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
           +GY            +              +  P  T  I+   + NA    P KTP + 
Sbjct: 123 MGYAAGAGGVINTAQTVPLQAP------TSNIAPRATSKITGQFNLNAQDKVPAKTPFNA 176

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNT 244
             +  Y + SS   YDTLG S    +Y+ K     W+     Q Q+  N           
Sbjct: 177 TDNTTYNYNSSIQVYDTLGGSQQVTMYFAKNAAGTWQAYAGVQGQTPTNLGTVTFDASGR 236

Query: 245 VEVSFDPVTGYLAN--SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHA 302
           +  +    TG              N       Q +T+D+  TTQ  G         +G A
Sbjct: 237 LSSTTSAATGQPTPSLGQFAFSIPNTTGGANPQNLTLDLGGTTQYGGKDGVNNLAQDGFA 296

Query: 303 PGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISI 362
            G    FS+  DG +   Y +G    +  +A+A   + + L    GN Y  T  SG   I
Sbjct: 297 SGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNIGGNQYAETAASGVPQI 356

Query: 363 GFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
             PG   HG +   ALE +NV++ +EL  LI AQRNY  N++  +T       L++L+
Sbjct: 357 SAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQTIKTQQAVDQTLLNLR 414


>gi|320179224|gb|EFW54182.1| Flagellar hook protein FlgE [Shigella boydii ATCC 9905]
          Length = 389

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 96/403 (23%), Positives = 169/403 (41%), Gaps = 15/403 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           +   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 2   AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 58  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I++ +  ++A  TTT  +  NL+ +  +  P        
Sbjct: 118 GYPA--TGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPL--PSVNAFDAS 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K S   +D+ G++    VY+ KTGD  WEV           S          +
Sbjct: 174 NADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWEVYTQD-------SSDPTDTADRAM 226

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +N +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 227 TLVFNANGVLTSNPTENITTGAINGAEPATFSLSFLNSMQQNTGANNIVVTTQNGYKPGD 286

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 287 LVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTA 346

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQT 408
           G    G + +GALE +NVD++ EL  +I AQRNY  N++  +T
Sbjct: 347 GTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKT 389


>gi|30019797|ref|NP_831428.1| flagellar hook protein FlgE [Bacillus cereus ATCC 14579]
 gi|229043508|ref|ZP_04191218.1| Flagellar hook protein FlgE [Bacillus cereus AH676]
 gi|229127079|ref|ZP_04256078.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-Cer4]
 gi|229149956|ref|ZP_04278184.1| Flagellar hook protein FlgE [Bacillus cereus m1550]
 gi|296502353|ref|YP_003664053.1| flagellar hook protein FlgE [Bacillus thuringiensis BMB171]
 gi|29895342|gb|AAP08629.1| Flagellar hook protein flgE [Bacillus cereus ATCC 14579]
 gi|228633637|gb|EEK90238.1| Flagellar hook protein FlgE [Bacillus cereus m1550]
 gi|228656432|gb|EEL12271.1| Flagellar hook protein FlgE [Bacillus cereus BDRD-Cer4]
 gi|228725886|gb|EEL77133.1| Flagellar hook protein FlgE [Bacillus cereus AH676]
 gi|296323405|gb|ADH06333.1| flagellar hook protein FlgE [Bacillus thuringiensis BMB171]
          Length = 437

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 179/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNSGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N +G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTNTSGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDEEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +            + +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKNPVTGEITKGGTVKIPFGKGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMRYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYIATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|32490790|ref|NP_871044.1| hypothetical protein WGLp041 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25165996|dbj|BAC24187.1| flgE [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 410

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/417 (23%), Positives = 188/417 (45%), Gaps = 10/417 (2%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S    ++G+++ +  +  + +NIAN  T+G+K + ++FS +       S V  G ++S  
Sbjct: 2   SFIQGINGINSAAQALDVIGNNIANSQTIGFKSSYVSFSDIFS----GSMVGLGSQLSNV 57

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 GS++  + N D+AI G GFF +         TR G+F +N+   + N+    L 
Sbjct: 58  TQNFASGSMVTGSKNLDMAISGNGFFRLSDSGGKIYFTRNGEFKLNSHRQIVNLQNKFLT 117

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GY  +    P  ++S   +E I +    ++ + +T G I  NL  +  +  P  +  +  
Sbjct: 118 GYQARGN--PPSIDSGSSIENIIIPSTSMNPVVSTEGEIHGNLKSDVDV--PKNSIFNIK 173

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQST--NNSFPYNVAPLN 243
               Y   +   AYD+LG   V  +++ K   +   +     + S   ++S      P+ 
Sbjct: 174 NPKSYNFTTQLEAYDSLGKKHVIKIFFVKQEAQGNWMVHGYDETSPIVDDSKNIKTNPIL 233

Query: 244 TVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAP 303
                   +     ++ + +I  +        ++ I++ + TQ +        +INGH  
Sbjct: 234 ISFDENGNLKKSENSNKYISIDGSSLDGSDPLKVEINLEEMTQYSSDNQINYQKINGHGV 293

Query: 304 GKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIG 363
           GK  D++VS  G +   Y +G    I ++A+A   +   L     N +L + +SG   IG
Sbjct: 294 GKFNDYNVSDSGKIIANYSNGQTQLIAQIAMANFTNNLGLTPNGENCWLESAESGPAIIG 353

Query: 364 FPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
                  G I    LE++NVDI++EL +++  Q NY  N++  +T    + IL+++K
Sbjct: 354 LSETGSFGRISGQKLESSNVDISNELVKMMTQQSNYQSNAQTIKTQDQLLQILVNMK 410


>gi|229090715|ref|ZP_04221948.1| Flagellar hook protein FlgE [Bacillus cereus Rock3-42]
 gi|228692657|gb|EEL46383.1| Flagellar hook protein FlgE [Bacillus cereus Rock3-42]
          Length = 437

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 100/439 (22%), Positives = 184/439 (41%), Gaps = 22/439 (5%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVD-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
           +N   ++ + T          T + +        +     V   K G+  + VS+    +
Sbjct: 180 RNQNALSHEFTVFD-AEGNSLTLRVNIKQKTESETVDGKVVEKPKAGEYTYSVSVRNDSK 238

Query: 230 ST-------NNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDIS 282
           +               +   N   +            + +       T      +T+D+S
Sbjct: 239 NEKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITKGGTITIPFGDGLTLDLS 298

Query: 283 KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDN 342
             T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   
Sbjct: 299 GLTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGG 358

Query: 343 LKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
           L       Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N
Sbjct: 359 LMKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGN 418

Query: 403 SKVFQTGSDFMDILISLKR 421
           +KV +   + ++ +++L R
Sbjct: 419 AKVIKVSDEVLNEVVNLIR 437


>gi|222084885|ref|YP_002543414.1| flagellar hook protein [Agrobacterium radiobacter K84]
 gi|221722333|gb|ACM25489.1| flagellar hook protein [Agrobacterium radiobacter K84]
          Length = 425

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 173/426 (40%), Positives = 244/426 (57%), Gaps = 6/426 (1%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           M I GSMKTA+SGM+AQ+NR++ VSDNIAN  T GYK+ + +FSSLV PS+S +Y SGG+
Sbjct: 1   MSIFGSMKTAISGMNAQANRLATVSDNIANSSTTGYKQASTSFSSLVLPSSSGNYNSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E + +  IS+QG++  T S+TDLAIQG GFF+V+       LTR+GDF  +  G L N A
Sbjct: 61  ETTVRYAISQQGTVSATTSSTDLAIQGNGFFVVQSAAGQTFLTRSGDFSADASGNLVNAA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L+GY   + +  ++VN F G+  INV  +  S   TT G ++ NL+ NATI T   T
Sbjct: 121 GFTLMGYSSASGAPSVVVNGFSGMVPINVTPSGTSVAATTVGSMTGNLNSNATIATSSST 180

Query: 181 PKHNGRDA----EYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFP 236
                 +       T KSS   YD+ G++V +D+YYTKT D  W+V ++ Q     +   
Sbjct: 181 GYLPSENTYPVTTDTSKSSITGYDSQGNAVTFDIYYTKTADNTWDVQVYNQADLVASPTS 240

Query: 237 YNVAPLNTVEVSFDPVTGYLAN-SSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQK 295
                 +    S +          S      +  +    Q I +D++  TQ+A  F    
Sbjct: 241 GGPLYSSAAVGSTEMTFDDDGALVSGGTFDLSFTSGSTTQSIAMDMTGFTQVATDFSATG 300

Query: 296 SEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTR 355
              +G AP      +++KDG V  +Y D +   +YR+ +ATV S D+L L  GN Y    
Sbjct: 301 KM-DGQAPNPVTSVTIAKDGTVSAVYKDSSTKELYRIPLATVASPDSLTLESGNVYSANG 359

Query: 356 DSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDI 415
           DSG    G+P     G I SGALE +NVD+A+ELT +I AQ++Y  NSKVFQ GSD +D+
Sbjct: 360 DSGVTVTGWPQSGGLGYIQSGALEESNVDLATELTNMITAQKSYTANSKVFQAGSDLLDV 419

Query: 416 LISLKR 421
           L++L+R
Sbjct: 420 LVNLQR 425


>gi|118477189|ref|YP_894340.1| flagellar hook protein FlgE [Bacillus thuringiensis str. Al Hakam]
 gi|225863612|ref|YP_002748990.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB102]
 gi|229183945|ref|ZP_04311161.1| Flagellar hook protein FlgE [Bacillus cereus BGSC 6E1]
 gi|118416414|gb|ABK84833.1| flagellar hook protein [Bacillus thuringiensis str. Al Hakam]
 gi|225790448|gb|ACO30665.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB102]
 gi|228599597|gb|EEK57201.1| Flagellar hook protein FlgE [Bacillus cereus BGSC 6E1]
          Length = 437

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 176/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVV---YDVYYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V       Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKETVDGKVVEKPKAGEYTYSVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                          +   N   +            + +              +T+D+S 
Sbjct: 240 EKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITKGGSIKIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|238752866|ref|ZP_04614331.1| Lateral flagellar hook protein (FlgE-like) [Yersinia rohdei ATCC
           43380]
 gi|238708905|gb|EEQ01158.1| Lateral flagellar hook protein (FlgE-like) [Yersinia rohdei ATCC
           43380]
          Length = 411

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 113/420 (26%), Positives = 174/420 (41%), Gaps = 19/420 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A +G+ A + ++S +S+NIAN  T G+K +   F+S+   S        G+ +S  
Sbjct: 2   SFSIANTGLSAVTEQLSTISNNIANSATKGFKASRTEFASMYAQSQP-----LGVAVSGV 56

Query: 66  DM-ISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVL 124
              I++ GS+  T +  DLAI G GFF+VK  +     TRAG F  +  G L N +G  L
Sbjct: 57  SQSINKDGSIDRTGNAMDLAIAGNGFFVVKNSNGDEAYTRAGMFTSDKSGMLVNGSGMKL 116

Query: 125 LGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHN 184
            GYP+  A           +  + V  A L A  +T      NL   A +        + 
Sbjct: 117 QGYPVDAAGNIQT----GIISDLKVSTAGLPAKASTQIDFMANLPAGAAVPLAAFDKSNP 172

Query: 185 GRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVS------IFRQDQSTNNSFPYN 238
                Y + S    YD+LG       Y+ K               I  +           
Sbjct: 173 D---SYNNMSMSTVYDSLGREHAVAQYFVKNAPPPPPGPLAPPAPIVSEWTVYTAIDGVI 229

Query: 239 VAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEI 298
            A   +  + FD        ++        +       I +D + TTQ    F+P  ++ 
Sbjct: 230 PANNPSHTLVFDVSGVLTLGNNMAISGGYGSPGAAPYSIDVDYAGTTQFDSNFLPTTNKS 289

Query: 299 NGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSG 358
           +G+  G      +  DG V   + +G R+   RL +A   + + L   +G T+  T  SG
Sbjct: 290 DGYTSGSKNGERIENDGSVYATFSNGERMLQGRLVLANFANPNGLAAQNGTTWSATSKSG 349

Query: 359 DISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
              +G  G    G I +GALE +NVD+ +EL  L+ AQRNY  N+K+  T    M+ L  
Sbjct: 350 AALLGEAGSGMLGSIEAGALEASNVDLTAELVGLMTAQRNYQANTKIISTNDSMMNALFQ 409


>gi|228945356|ref|ZP_04107711.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228814328|gb|EEM60594.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 437

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 99/438 (22%), Positives = 178/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +KN +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKNGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   +  + T      N        K      +  G  V   V   Y      +    +
Sbjct: 180 RNQNALAHEFTVFDAEGNSLTLRVNIKQKTTKENVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +              +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTISTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|196039080|ref|ZP_03106387.1| putative flagellar hook protein FlgE [Bacillus cereus NVH0597-99]
 gi|196030225|gb|EDX68825.1| putative flagellar hook protein FlgE [Bacillus cereus NVH0597-99]
          Length = 437

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 177/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVD-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +              +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|228984838|ref|ZP_04145009.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229155324|ref|ZP_04283435.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 4342]
 gi|228628249|gb|EEK84965.1| Flagellar hook protein FlgE [Bacillus cereus ATCC 4342]
 gi|228774890|gb|EEM23285.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 437

 Score =  231 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 99/438 (22%), Positives = 176/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVV---YDVYYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V       Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKETVDGKVVEKPKAGEYTYSVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                          +   N   +            + +              +T+D+S 
Sbjct: 240 EKEFKPIEGMPDDKPLIFDNLGNLKQTDEPVQKDPVTGEITKGGSIKIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LAIAT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAIATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|228914332|ref|ZP_04077947.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228845326|gb|EEM90362.1| Flagellar hook protein FlgE [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 437

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 98/438 (22%), Positives = 178/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN-CLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+  N   TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNGGNVEYTRKGSFS 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++ N  G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDSYVTNTGGQYVLGYGVKTGTQEVD-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K         G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKETVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +              +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   +G  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGVGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|196044997|ref|ZP_03112230.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB108]
 gi|300117326|ref|ZP_07055116.1| flagellar hook protein FlgE [Bacillus cereus SJ1]
 gi|196023999|gb|EDX62673.1| putative flagellar hook protein FlgE [Bacillus cereus 03BB108]
 gi|298725161|gb|EFI65813.1| flagellar hook protein FlgE [Bacillus cereus SJ1]
          Length = 437

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 97/438 (22%), Positives = 177/438 (40%), Gaps = 20/438 (4%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFP------------S 50
           ++ ++ T+++GM+A  N +S  S+NIAN  TVGYK+    F  L++              
Sbjct: 1   MIKALYTSITGMNAAQNALSVTSNNIANAQTVGYKKQKAIFDDLLYNNTVGSRGDGAYAG 60

Query: 51  TSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRD-NVNCLTRAGDFH 109
           T+   +  G++ S        GS+  T+   + AI+G G F+V  R+      TR G F 
Sbjct: 61  TNPKSIGNGVKFSGTSTDFSDGSITLTSDKMETAIEGNGLFLVGDRNAGNVEYTRKGSFG 120

Query: 110 INNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
           ++ + ++    G  +LGY +K  +  +   S +         + +  + T    I  NL 
Sbjct: 121 VSKDNYVTTTGGQYVLGYGVKTGTQEID-FSSRPSPIHIPMGSAVGGIQTDKATIGGNLP 179

Query: 170 KNATIITPDKTPKH---NGRDAEYTHKSSFAAYDTLGSSVVYDV---YYTKTGDKKWEVS 223
           +N   ++ + T      N        K      +  G  V   V   Y      +    +
Sbjct: 180 RNQNALSHEFTVFDAEGNSLTLRVNIKQKTTKENVDGKEVEKPVPGEYTYTVSVRNDSKN 239

Query: 224 IFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISK 283
                     +   N+       +            + +              +T+D+S 
Sbjct: 240 EKEFKPVEGMTGEKNLKFDTLGNLKETDEAVQKDPVTGEITKGGSVQIPFGSGLTLDLSG 299

Query: 284 TTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNL 343
            T    G     +E+ G       D+S+S  G+V + Y DG+   + +LA+AT P+   L
Sbjct: 300 LTNYPTGKTLSTTEVTGRPAAIANDYSISDGGFVMMKYSDGSMKVVGQLAVATFPNSGGL 359

Query: 344 KLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNS 403
                  Y+ T  +G   IG  G N  G +   A E++NVD++ E  +L+  QR +  N+
Sbjct: 360 MKTGNGNYVATPSAGIPGIGVAGENGAGNVRGSAKESSNVDLSVEFVDLMLYQRGFQGNA 419

Query: 404 KVFQTGSDFMDILISLKR 421
           KV +   + ++ +++L R
Sbjct: 420 KVIKVSDEVLNEVVNLIR 437


>gi|294140185|ref|YP_003556163.1| flagellar hook protein FlgE [Shewanella violacea DSS12]
 gi|293326654|dbj|BAJ01385.1| flagellar hook protein FlgE [Shewanella violacea DSS12]
          Length = 453

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 102/455 (22%), Positives = 175/455 (38%), Gaps = 43/455 (9%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
           S   A+SG+ A    ++  ++NIANV+++G+K +   FS +   S    S + V GG+  
Sbjct: 2   SFNIALSGIAAAQKDLNTTANNIANVNSIGFKESRAEFSDVYANSIFSNSKTAVGGGVTT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG--RDNVNCLTRAGDFHINNEGFLENVA 120
           S       QGS+  T +  D+AI G GFF+            TRAG F +++  +L +  
Sbjct: 62  SQVAQQFHQGSMQFTNNALDMAINGGGFFVTSSDLSGKEQSFTRAGAFKVDSSNYLVDSQ 121

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G  L  +P+          S    + + +     S   T    I  NL+   + + P   
Sbjct: 122 GNFLQTFPVDKD-GNSTSVSLTTTKPVTIPDTAGSPQKTENIGIQMNLNAADSTLDP--A 178

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGD------KKWEVSIFRQDQSTNNS 234
                    Y + ++   YD+LG   +   Y+ +  +        W        +  +  
Sbjct: 179 LFDPNDRDTYNNSTAVTMYDSLGEPHIMTTYFVRPPNAAYTGESNWVAFYAVDGKQVDLD 238

Query: 235 FPYNVAPLNTVEVSFDPVTGYLANSSHK-----------------------------AIS 265
                   +T        TG    +                                   
Sbjct: 239 GAAGSYQTDTNADGAPDGTGTAVTAGGWKGAVIKFNDIGSYTTSDPATIKTQALGVGGAG 298

Query: 266 FNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
                +   Q +TID +  TQ A  F   +   +G   G+  +  V  DG ++  Y +GT
Sbjct: 299 VLGPGTDGTQTLTIDFNNPTQYASTFEVTELNQDGTTVGRLTNVEVGADGLINASYSNGT 358

Query: 326 RVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDI 385
            V + R+A+A   +E  L      ++  ++DSG    G       G I S ALE +NVD+
Sbjct: 359 TVALARVALARFANEQGLTQVGNTSWKASQDSGLALAGEANTGTFGSIRSSALEQSNVDL 418

Query: 386 ASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            +EL +LI AQRN+  NS+  +  +     ++ ++
Sbjct: 419 TTELVDLISAQRNFQANSRTLEVNNTLQQTILQIR 453


>gi|159045919|ref|YP_001534713.1| flagellar hook protein FlgE [Dinoroseobacter shibae DFL 12]
 gi|157913679|gb|ABV95112.1| flagellar hook protein FlgE [Dinoroseobacter shibae DFL 12]
          Length = 434

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 121/444 (27%), Positives = 184/444 (41%), Gaps = 33/444 (7%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS-TSNSYVSGG 59
           M I  S+   +SG++A + R++ +SDNIAN  T GYKR    F SLV    +S +Y +GG
Sbjct: 1   MTISSSLNAGVSGLNANATRLATISDNIANSSTYGYKRAEADFQSLVINGNSSGTYSAGG 60

Query: 60  LEISTKDMISEQGSLMHTASNTDLAIQGKGFFI--------VKGRDNVNCLTRAGDFHIN 111
           + ++T  +I EQG L+ T++ TDLA+ G G                    L   G F  N
Sbjct: 61  VRVTTTRVIDEQGPLVTTSNPTDLAVGGSGMLPVTTLSALDENTGGYPLSLMTTGSFSPN 120

Query: 112 NEGFLENVAGGVLLGYPL--KNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLD 169
            +G L    G VL+G+P            ++  GLE I V   + +  PTT   +  NL 
Sbjct: 121 ADGVLTTETGMVLMGWPAAPDGTVPEFPRDTVDGLEPITVNLNQFAGDPTTRIDLGVNLP 180

Query: 170 KNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQ 229
            + T                     S   +  LG+S    V YT         + +    
Sbjct: 181 ASETEAGSSGDSID----------LSIEYFGNLGTSETLGVTYTPQVPASGASNTWTMTI 230

Query: 230 STNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGI------------DQQI 277
           + + S    V              G LA+ +  +    D   G                 
Sbjct: 231 TDSASGGAVVGEYELTFDDSRGAGGTLASVTAVSGGPFDPVQGTVEITADGGPVTVKIGS 290

Query: 278 TIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATV 337
             D +  TQL+  F P     NG   G      V  +G+V  +YD G    IY++ +A V
Sbjct: 291 VGDENGMTQLSDTFAPVSISKNGSPVGNLSTVEVDPNGFVVAVYDTGFTRTIYQVPLADV 350

Query: 338 PSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQR 397
           P+ + L   D  +Y+ + +SG   +   G    G++   ALE +  D+A ELT LI  QR
Sbjct: 351 PNPNGLLSRDNQSYMISPESGPFFLWNAGEGPTGDVIGFALEESAADVAGELTRLITTQR 410

Query: 398 NYAVNSKVFQTGSDFMDILISLKR 421
            Y+ N+K+ QT  + +    ++KR
Sbjct: 411 AYSSNAKIIQTVDEMLQETTNIKR 434


>gi|146277708|ref|YP_001167867.1| flagellar basal body FlaE domain-containing protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555949|gb|ABP70562.1| flagellar basal body FlaE domain protein [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 423

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 102/428 (23%), Positives = 174/428 (40%), Gaps = 20/428 (4%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST---SNSYVSGGLEI 62
           S+ TA+SG+ A  + ++A S NIANV T+G++ +   F+ +   S    + + V  G++ 
Sbjct: 2   SINTALSGLSAAQHDIAATSHNIANVGTIGFRGSRAEFADVFNSSPYSIARTAVGSGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVN------CLTRAGDFHINNEGFL 116
               M   QGS++ T +  DLAI+G+GFF  +     N        TRAG F +N++G  
Sbjct: 62  LRTAMQFSQGSVVATGNTLDLAIEGQGFFATEPAVGPNSAKPEPIYTRAGAFGLNDKGVA 121

Query: 117 ENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELS----AMPTTTGFISNNLDKNA 172
            N +G  LL +P+      L       +               A+  T    +++     
Sbjct: 122 VNASGQKLLAWPVSVEGDALSQVPGTAVPLTIPLTMGSPVGTKAVRMTVDLPTDDAMLGQ 181

Query: 173 TIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTN 232
               P            Y   ++   +D  G++V    Y+ KT +            +  
Sbjct: 182 QAAVPPAAAFDAADPTTYAAVTAIPVFDAKGNAVEAAAYFIKTENPAAGS--PDTGWAVR 239

Query: 233 NSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFI 292
                        +++FD        +   +      T+GI    T+D++ T      F 
Sbjct: 240 LVVAGETLTPAEGDLAFDATGALAGGTGSLSF-----TTGIGTPYTLDLTGTALTNRSFE 294

Query: 293 PQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYL 352
                 +G +        V   G V   Y  G  V + ++ + T  +   L+    + + 
Sbjct: 295 VNTVNQDGKSAAALTSLEVDASGTVWAAYGAGDSVAMGQVVLVTFANPQALRQLGASGFA 354

Query: 353 PTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDF 412
            T DSG    G  G +  G I +GALE ANVD+  EL  LI AQRNY  ++K  +T +  
Sbjct: 355 ATADSGQPVAGTAGDSGFGIIRAGALEHANVDLTEELVHLITAQRNYQASAKAMETSNSL 414

Query: 413 MDILISLK 420
           M  +++++
Sbjct: 415 MQTIMNIR 422


>gi|90411005|ref|ZP_01219019.1| flagellar hook protein [Photobacterium profundum 3TCK]
 gi|90328218|gb|EAS44529.1| flagellar hook protein [Photobacterium profundum 3TCK]
          Length = 435

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 105/439 (23%), Positives = 170/439 (38%), Gaps = 29/439 (6%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPS---TSNSYVSGGLEI 62
               ++SG+ A    ++  S+NIAN +T G+K +   F  +   S    + +   GG++ 
Sbjct: 2   GFNISLSGIGASQKDLNTTSNNIANANTYGFKESRAEFGDVYSSSIFSNAKTTTGGGVQT 61

Query: 63  STKDMISEQGSLMHTASNTDLAIQGKGFFIVKG---RDNVNCLTRAGDFHINNEGFLENV 119
           S       +GS ++T +  DL I G GFF V     +   N LTR G FH+N +  + N 
Sbjct: 62  SVVAQQFHEGSSIYTNNPMDLRISGSGFFAVADDKLQPQNNNLTRNGAFHLNKDNQVVNS 121

Query: 120 AGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDK 179
            G  LLGY +   +  +     Q ++  +          +T   I  NL  +A     D 
Sbjct: 122 EGQFLLGYGVDQETDQVTSYEPQAMKVPDQF---GQPRASTNIDIGVNLPASAEAK--DA 176

Query: 180 TPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNV 239
           T         Y   +S   YD+LG       YY K        S++          P N+
Sbjct: 177 TLFDFNDSNSYDKSTSVTMYDSLGQPYKLSTYYVKDNSAPNRWSVYYTGTDATGEKPINI 236

Query: 240 APLNTVEVSFDPVTGYLANSSHKAISFND------------------NTSGIDQQITIDI 281
               T   +    +    N+       N+                  N +   Q +T+  
Sbjct: 237 TNGGTTAANGHQGSTLDFNTDGSVAQINNGQPIISEALGAGGAGLDLNGADEAQTLTMQF 296

Query: 282 SKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSED 341
              TQ A  F  +K   NG   G      +   G +   Y +G  V + R+ +  V +E 
Sbjct: 297 DSPTQYAAPFEIRKFSENGATTGYLAKVDIDAKGSIVATYSNGENVTLGRVGMVRVANEQ 356

Query: 342 NLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAV 401