RPSBLAST alignment for GI: 254780525 and conserved domain: TIGR02488

>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG, Gram-negative bacteria. This family consists of the FlgG protein of the flagellar apparatus in the Proteobacteria and spirochetes. Length = 259
 Score = 87.4 bits (217), Expect = 6e-18
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 15/135 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--------PSTSNSY-- 55
           ++ TA +GM+AQ   +  +S+N+ANV+T G+K+    F  L++         S+      
Sbjct: 1   ALWTAATGMNAQQTNMDVISNNLANVNTTGFKKDRAEFEDLLYQTERQPGAQSSEQQTIL 60

Query: 56  -----VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHI 110
                V  G+ +     +  QGSL +T ++ DLAI+G+GFF V   D     TR G F I
Sbjct: 61  PVGVQVGLGVRVVATQKLFTQGSLQNTGNDLDLAIEGEGFFQVLMPDGTTAYTRDGAFKI 120

Query: 111 NNEGFLENVAGGVLL 125
           N EG L    G  L 
Sbjct: 121 NAEGQLVTSNGYPLQ 135