RPSBLAST alignment for GI: 254780525 and conserved domain: pfam06429

>gnl|CDD|148188 pfam06429, DUF1078, Domain of unknown function (DUF1078). This family consists of a number of C-terminal domains of unknown function. This domain seems to be specific to flagellar basal-body rod and flagellar hook proteins in which pfam00460 is often present at the extreme N terminus. Length = 39
 Score = 49.4 bits (119), Expect = 1e-06
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           +NVD+  E+  LIEAQR Y  N+KV QT  + +  L++L
Sbjct: 1   SNVDLVEEMVNLIEAQRAYEANAKVIQTADEMLGTLLNL 39