RPSBLAST alignment for GI: 254780525 and conserved domain: TIGR02490

>gnl|CDD|162884 TIGR02490, flgF, flagellar basal-body rod protein FlgF. Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria. Length = 89
 Score = 49.6 bits (119), Expect = 2e-06
 Identities = 23/93 (24%), Positives = 37/93 (39%), Gaps = 11/93 (11%)

Query: 307 KDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPG 366
              ++  DG    I  DG  V   RL +    + + L+      +  T      +     
Sbjct: 7   GPITIGADG---TISQDGQEVG--RLGLVNFDNPNQLQREGDGLFRATGAGPAPADSNVR 61

Query: 367 HNQHGEIFSGALETANVDIASELTELIEAQRNY 399
                 +  G LE +NV+  SE+ ++IEAQR Y
Sbjct: 62  ------VVQGYLEGSNVNAVSEMVDMIEAQRAY 88