RPSBLAST alignment for GI: 254780525 and conserved domain: TIGR03506

>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins. This model encompasses three closely related flagellar proteins usually denoted FlgE, FlgF and FlgG. The names have often been mis-assigned, however. Three equivalog models, TIGR02489, TIGR02490 and TIGR00488, respectively, separate the individual forms into three genome-context consistent groups. The major differences between these genes are architectural, with variable central sections between relatively conserved N- and C-terminal domains. More distantly related are two other flagellar apparatus familis, FlgC (TIGR01395) which consists of little else but the N-and C-terminal domains and FlgK (TIGR02492) with a substantial but different central domain. Length = 231
 Score =  100 bits (250), Expect = 1e-21
 Identities = 41/95 (43%), Positives = 55/95 (57%)

Query: 308 DFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGH 367
             S+  DG V   Y +G  V + ++A+A  P+ D L+   GN Y  TRDSG   +G  G 
Sbjct: 137 SVSIGSDGTVSATYSNGQTVTLGQIALANFPNPDGLRKEGGNLYSATRDSGAALVGAAGT 196

Query: 368 NQHGEIFSGALETANVDIASELTELIEAQRNYAVN 402
              G I SGALE++NVD+A+EL  +I AQR Y  N
Sbjct: 197 GGFGSIQSGALESSNVDLAAELVNMIVAQRAYQAN 231