RPSBLAST alignment for GI: 254780525 and conserved domain: PRK08425

>gnl|CDD|181421 PRK08425, flgE, flagellar hook protein FlgE; Validated. Length = 731
 Score = 69.3 bits (170), Expect = 2e-12
 Identities = 46/137 (33%), Positives = 66/137 (48%), Gaps = 16/137 (11%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPST-------------S 52
           S+ + +SG+ A    +    +NIANV+T G+K +  +F  +    T              
Sbjct: 4   SLWSGVSGLQAHQIAMDVEGNNIANVNTTGFKYSRASFVDM-LSQTKLIATAPKGGLGGQ 62

Query: 53  NSYVSG-GLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKG-RDNVNCLTRAGDFHI 110
           N    G G+ +S+   I  QGS+ +T  NTDLAIQG GFFIV          TR GDF  
Sbjct: 63  NDMQIGLGVGVSSTTKIFSQGSIQNTDKNTDLAIQGDGFFIVSPDGGTTRNYTRDGDFKF 122

Query: 111 NNEGFLENVAGGVLLGY 127
           + +G   N  G V+ G+
Sbjct: 123 DAQGNFVNNGGYVVQGW 139