RPSBLAST alignment for GI: 254780525 and conserved domain: PRK12623

>gnl|CDD|183630 PRK12623, flgB, flagellar basal body rod protein FlgB; Provisional. Length = 131
 Score = 38.2 bits (89), Expect = 0.004
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 13 GMDAQSNRVSAVSDNIANVDTVGYKRTAIAF 43
          G+DA S R   +S+NIANV+T GYKR  + F
Sbjct: 19 GLDASSYRGKVISNNIANVNTKGYKRHYVTF 49