RPSBLAST alignment for GI: 254780525 and conserved domain: PRK12689

>gnl|CDD|183684 PRK12689, flgF, flagellar basal body rod protein FlgF; Reviewed. Length = 253
 Score = 45.5 bits (108), Expect = 3e-05
 Identities = 34/113 (30%), Positives = 48/113 (42%), Gaps = 15/113 (13%)

Query: 24  VSDNIANVDTVGYKRTAIAFSSLVFPSTSN----------SYVSGGLEISTKDMISEQGS 73
           V++N+ANV+T G+K  +  F   + P              SYV      +  D+   QG 
Sbjct: 22  VANNVANVNTNGFKARSSLFQEYLMPGAHEDNFQRPDRRVSYVQD--RGTPLDL--SQGP 77

Query: 74  LMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLG 126
           L  T +  D+AI G  F  V+        TR G   IN +G L    G  +LG
Sbjct: 78  LEQTKNPLDVAIDGDAFLAVQ-TPQGERYTRDGALEINAQGQLVTSDGYPVLG 129