RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE
[Candidatus Liberibacter asiaticus str. psy62]
         (421 letters)



>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella
           typhimurium [TaxId: 90371]}
          Length = 293

 Score =  149 bits (376), Expect = 5e-37
 Identities = 71/299 (23%), Positives = 116/299 (38%), Gaps = 11/299 (3%)

Query: 82  DLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSF 141
           D+AI   GFF +   +     +R G F ++    L N+ G  L GYP      P  +   
Sbjct: 3   DVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPAT--GTPPTIQQG 60

Query: 142 QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDT 201
                I + +  ++A  TTT  +  N   N+T   P KTP        Y  K +   YD+
Sbjct: 61  ANPAPITIPNTLMAAKSTTTASMQIN--LNSTDPVPSKTPFSVSDADSYNKKGTVTVYDS 118

Query: 202 LGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSH 261
            G++   +VY+ KT D +W V         ++S P   AP            G L +   
Sbjct: 119 QGNAHDMNVYFVKTKDNEWAVYTH------DSSDPAATAPTTASTTLKFNENGILESGGT 172

Query: 262 KAISFNDNTSGIDQQITIDIS-KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDII 320
             I+            ++       Q  G      +  NG+ PG    + ++ DG V   
Sbjct: 173 VNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGN 232

Query: 321 YDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALE 379
           Y +     + ++ +A   + + L     N +  T+ SG   +G  G    G++ +GALE
Sbjct: 233 YSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALE 291


>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens)
           [TaxId: 9606]}
          Length = 237

 Score = 28.1 bits (62), Expect = 1.5
 Identities = 7/41 (17%), Positives = 17/41 (41%), Gaps = 6/41 (14%)

Query: 378 LETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILIS 418
           L   +++  S+L+ L++AQ  Y       +     +  +  
Sbjct: 198 LLEMDIEQVSQLSALVQAQLEY------HKQAVQILQQVTV 232


>d2iqha1 e.75.1.1 (A:21-489) Nucleocapsid protein {Influenza A virus
           [TaxId: 11320]}
          Length = 469

 Score = 27.2 bits (60), Expect = 2.3
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 17  QSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMH 76
            +N+  A S  I+   T   +R  + F       T  +  +G  E  T DM +E   LM 
Sbjct: 375 NTNQQRASSGQISIQPTFSVQRN-LPFDR----PTIMAAFTGNTEGRTSDMRTEIIRLME 429

Query: 77  TASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEG 114
           +A   D++ QG+G F +      + +  +  F ++NEG
Sbjct: 430 SARPEDVSFQGRGVFELSDEKATSPIVPS--FDMSNEG 465


>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate
          dehydrogenase (IMPDH) {Chinese hamster (Cricetulus
          griseus) [TaxId: 10029]}
          Length = 378

 Score = 26.2 bits (57), Expect = 5.7
 Identities = 9/43 (20%), Positives = 14/43 (32%), Gaps = 11/43 (25%)

Query: 29 ANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQ 71
          + +DTV     AIA +             GG+     +   E 
Sbjct: 52 SPMDTVTEAGMAIAMALT-----------GGIGFIHHNCTPEF 83


>d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase
           {Azotobacter vinelandii [TaxId: 354]}
          Length = 740

 Score = 25.9 bits (57), Expect = 5.9
 Identities = 11/36 (30%), Positives = 16/36 (44%), Gaps = 3/36 (8%)

Query: 290 GFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGT 325
           G + QK+E  G      K F +  DG V +  + G 
Sbjct: 410 GLMAQKAEEYG---SHDKTFQIPADGVVRVTDESGK 442


>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate
          dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId:
          1314]}
          Length = 365

 Score = 25.8 bits (56), Expect = 7.3
 Identities = 12/43 (27%), Positives = 18/43 (41%), Gaps = 11/43 (25%)

Query: 29 ANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQ 71
          A +DTV   + AIA +             GGL +  K+M   +
Sbjct: 50 AAMDTVTGSKMAIAIARA-----------GGLGVIHKNMSITE 81


>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus
           aureus [TaxId: 1280]}
          Length = 413

 Score = 25.4 bits (55), Expect = 9.2
 Identities = 5/20 (25%), Positives = 12/20 (60%)

Query: 312 SKDGYVDIIYDDGTRVPIYR 331
           S D  +  I++DG++  ++ 
Sbjct: 386 SSDLTIYGIFEDGSKELVFE 405


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0689    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,434,676
Number of extensions: 64205
Number of successful extensions: 118
Number of sequences better than 10.0: 1
Number of HSP's gapped: 116
Number of HSP's successfully gapped: 14
Length of query: 421
Length of database: 2,407,596
Length adjustment: 88
Effective length of query: 333
Effective length of database: 1,199,356
Effective search space: 399385548
Effective search space used: 399385548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (24.7 bits)