RPSBLAST alignment of GI: 254780526 and protein with PDBid: 3cfy

>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137
 Score = 46.6 bits (110), Expect = 5e-06
 Identities = 20/121 (16%), Positives = 46/121 (38%), Gaps = 3/121 (2%)

Query: 4   LIDDRALVKDGYIALFGDDGVSLEGFNSLEFEEWLQSSAREDVSAIEAFLIGK-GEKVLE 62
           L++D   +   Y     D+   +    +          ++  +  ++  L    GE VL+
Sbjct: 9   LVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLD 68

Query: 63  LPRIIRAHSQVPLIGISDYPSLQTTLDFFDSGVDDVVNKPIHHREILARVAAIYRRLKVS 122
                +      +I  + + S+   ++    G +D + KPI+   +   VA   +R K+ 
Sbjct: 69  WIN--QNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLE 126

Query: 123 N 123
           +
Sbjct: 127 D 127