RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62] (396 letters) >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} (A:) Length = 209 Score = 28.7 bits (63), Expect = 1.4 Identities = 9/76 (11%), Positives = 18/76 (23%), Gaps = 1/76 (1%) Query: 177 PGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKL 236 G +E++A R +E V V Sbjct: 101 EGESVEDVARREAIEEAGLIVKRTKPVLSFLASPGGTSERSSIMVGEVDATTASGIHGLA 160 Query: 237 PDEDIVFTISFFSLEE 252 + + + + S E+ Sbjct: 161 DENEDI-RVHVVSREQ 175 >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} (A:) Length = 145 Score = 28.5 bits (63), Expect = 1.7 Identities = 11/76 (14%), Positives = 15/76 (19%), Gaps = 5/76 (6%) Query: 177 PGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKL 236 G L A R LLE + LL + Sbjct: 43 KGEDLGAAAARELLEEVGGAA-----SEWVPLPGFYPQPSISGVVFYPLLALGVTLGAAQ 97 Query: 237 PDEDIVFTISFFSLEE 252 ++ L E Sbjct: 98 LEDTETIERVVLPLAE 113 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 26.3 bits (58), Expect = 7.4 Identities = 8/48 (16%), Positives = 12/48 (25%), Gaps = 21/48 (43%) Query: 153 IGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGER 200 + +M S V F+ R + Q V R Sbjct: 2 LAD-VMSIESLVEVVFY-----------------RGMT--MQVAV-PR 28 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.140 0.392 Gapped Lambda K H 0.267 0.0610 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,991,110 Number of extensions: 139911 Number of successful extensions: 415 Number of sequences better than 10.0: 1 Number of HSP's gapped: 415 Number of HSP's successfully gapped: 8 Length of query: 396 Length of database: 4,956,049 Length adjustment: 90 Effective length of query: 306 Effective length of database: 1,913,599 Effective search space: 585561294 Effective search space used: 585561294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 56 (25.6 bits)