RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus str. psy62] (343 letters) >gnl|CDD|31551 COG1360, MotB, Flagellar motor protein [Cell motility and secretion]. Length = 244 Score = 95.8 bits (238), Expect = 1e-20 Identities = 50/168 (29%), Positives = 80/168 (47%), Gaps = 11/168 (6%) Query: 179 SKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKG-VLFETTRTGILISIIDQRNTPMF 237 E I + ++L DLAK++ S D ++ + + G++ISI D MF Sbjct: 84 VGEAIEKKELSEKLGDLAKELES----KPKDIELEHQLGVDDVEEGLVISISDSL---MF 136 Query: 238 DKSSSIPLPETIVVLQKIGEVLA-HSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAY 296 S++ PE +L KI ++LA I I GHTD P + NW LS RA S Sbjct: 137 ASGSAVVQPEFRDLLLKIAKLLADIPNGNIRIEGHTDNVPIKGSFYSNWELSAARAQSVV 196 Query: 297 QVLMKSGVSEDRISKISGFAHHRLKI--ASDPMNSANRRIDILVEDRQ 342 +VL+ G+ E + + G+A R + + NRR++IL+ ++ Sbjct: 197 RVLINGGLVEAKRLSVVGYADTRPLADNDTAEGRAKNRRVEILILTKK 244 Score = 61.6 bits (149), Expect = 3e-10 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Query: 27 PNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNP-FGKNLMTASKGIFD 85 + G+WKI YADFMT+L+AFF+V+W +++ + + I YF F +AS+G Sbjct: 10 QHGGGAWKIAYADFMTLLLAFFIVLWAMSSISPEKFQQIAAYFRIAFSGAPGSASEGGKS 69 Query: 86 EQNPPERSSQNKID 99 Q E+ +++ Sbjct: 70 MQQVKEKELAEELN 83 >gnl|CDD|143586 cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane. Length = 106 Score = 73.0 bits (180), Expect = 1e-13 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 5/104 (4%) Query: 237 FDKSSSIPLPETIVVLQKIGEVL-AHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSA 295 FD S+ PE +L K+ EVL + I I GHTD+ R N LS RA + Sbjct: 6 FDFGSAELTPEAKPLLDKLAEVLKKNPDAKIRIEGHTDS---RGSDAYNQELSERRAEAV 62 Query: 296 YQVLMKSGVSEDRISKIS-GFAHHRLKIASDPMNSANRRIDILV 338 L+ GV RI+ + G + ++ + NRR++I++ Sbjct: 63 ADYLVSKGVDASRITAVGYGESRPIASNDTEEGRAKNRRVEIVI 106 >gnl|CDD|144333 pfam00691, OmpA, OmpA family. The Pfam entry also includes MotB and related proteins which are not included in the Prosite family. Length = 97 Score = 57.1 bits (138), Expect = 6e-09 Identities = 29/100 (29%), Positives = 38/100 (38%), Gaps = 5/100 (5%) Query: 236 MFDKSSSIPLPETIVVLQKIGEVLAHS--TEVISIRGHTDASPFRNIARDNWRLSLDRAY 293 +FD S+ E L ++ EVL I I GHTD+ A+ NW LS RA Sbjct: 1 LFDPGSAELTAEARETLDRLAEVLKAPELKIAIKIEGHTDSRG---SAKYNWELSARRAQ 57 Query: 294 SAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRR 333 + L+ G+ RIS L A R Sbjct: 58 AVANYLVNHGIPPSRISVEGYGESQPLASNDSDEGRAKNR 97 >gnl|CDD|32711 COG2885, OmpA, Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane]. Length = 190 Score = 52.1 bits (124), Expect = 2e-07 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 9/116 (7%) Query: 227 SIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVL-AHSTEVISIRGHTDA--SPFRNIARD 283 I++ N +FD SS+ P+ L ++ + L + I + GHTD+ S N A Sbjct: 77 IILNLPNDVLFDFDSSVLKPKAQATLDELAKYLKKNPITRILVEGHTDSTGSDEYNQA-- 134 Query: 284 NWRLSLDRAYSAYQVLMKSGVSEDRISKIS-GFAHHRLKIASDPMNSANRRIDILV 338 LS RA + L+ GV DRIS + G A++ + NRR++I + Sbjct: 135 ---LSERRAEAVADYLVSQGVVADRISTVGYGEEKPIASNATEEGRAKNRRVEIKI 187 >gnl|CDD|36433 KOG1219, KOG1219, KOG1219, Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]. Length = 4289 Score = 31.5 bits (71), Expect = 0.29 Identities = 45/210 (21%), Positives = 70/210 (33%), Gaps = 44/210 (20%) Query: 74 KNLMTASKGIFDEQNPPERSSQNKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFY 133 KN ++D + R + N + E +V L++ + ++ R EN I Y Sbjct: 1448 KNFAMTLINVYDSNDHSPRFTTNNYLALVSESHAVGTVLLQVTAEDK----DRGENAIVY 1503 Query: 134 LSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQ 193 S G E + + E ILA KRL Sbjct: 1504 YS---------------IGSGN--------------IELFKIDADLGEIILA----KRL- 1529 Query: 194 DLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSS-SIPLPETIVVL 252 D L+ D + + + T + I D P FD+S + LPE+ Sbjct: 1530 DELNHAERNLNVKAIDAGSPKGIDKASVT--IEVIEDDLILPKFDQSEYFVELPESFNSG 1587 Query: 253 QKIGEVLAHSTEVISIR---GHTDASPFRN 279 IG+V A S ++ G+T F N Sbjct: 1588 SPIGKVPADSDSDVTYELIDGNTYVRFFEN 1617 >gnl|CDD|132855 cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like phospholipase. Patatin is a storage protein of the potato tuber that shows Phospholipase A2 activity (PLA2; EC 3.1.1.4). Patatin catalyzes the nonspecific hydrolysis of phospholipids, glycolipids, sulfolipids, and mono- and diacylglycerols, thereby showing lipid acyl hydrolase activity. The active site includes an oxyanion hole with a conserved GGxR motif; it is found in almost all the members of this family. The catalytic dyad is formed by a serine and an aspartate. Patatin belongs to the alpha-beta hydrolase family which is identified by a characteristic nucleophile elbow with a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). Members of this family have been found also in vertebrates. This family includes subfamily of PNPLA8 (iPLA2-gamma) and PNPLA9 (iPLA2-beta) like phospholipases from human as well as the Pat17 isozyme from Solanum cardiophyllum. Length = 309 Score = 27.3 bits (61), Expect = 7.1 Identities = 13/49 (26%), Positives = 20/49 (40%) Query: 286 RLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRI 334 R+++D AY L K S R+ I G + S + A + I Sbjct: 63 RMTVDECIDAYTRLAKKIFSRKRLRLIIGDLRTGARFDSKKLAEAIKVI 111 >gnl|CDD|36277 KOG1059, KOG1059, KOG1059, Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport]. Length = 877 Score = 26.8 bits (59), Expect = 8.1 Identities = 19/88 (21%), Positives = 31/88 (35%), Gaps = 3/88 (3%) Query: 125 QRLENNIFYLSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSIN-KEENYFLPPLSKEKI 183 Q NN +YL +S +++ LT + + L S L + K Sbjct: 686 QEQMNNPYYLKSSPEAQ--TKLLTLSEYENVNKIPEIQLPLSDPSFNPLSLSQTLIERKK 743 Query: 184 LAMKRKKRLQDLAKKISSTLSGLVADNI 211 K+KK++Q K + DN Sbjct: 744 KKGKKKKKVQKKDDKKVIKKAPKRKDNF 771 >gnl|CDD|146916 pfam04515, Choline_transpo, Plasma-membrane choline transporter. This family represents a high-affinity plasma-membrane choline transporter in C.elegans which is thought to be rate-limiting for ACh synthesis in colinergic nerve terminals. Length = 327 Score = 26.8 bits (60), Expect = 8.4 Identities = 8/38 (21%), Positives = 13/38 (34%), Gaps = 2/38 (5%) Query: 20 KVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINAT 57 K A N + + +A F +WI+ A Sbjct: 32 KTASKAVSKNPSL--FLVPIITFLALAAFWALWIVVAV 67 >gnl|CDD|109724 pfam00680, RdRP_1, RNA dependent RNA polymerase. Length = 479 Score = 26.9 bits (60), Expect = 9.7 Identities = 10/39 (25%), Positives = 20/39 (51%) Query: 148 TRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAM 186 T ++ + L + T L+++ ++E P L KE I + Sbjct: 374 TSETIPIRPLEELTFLKRTFKRDEGGVRPKLDKESIFSQ 412 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.131 0.366 Gapped Lambda K H 0.267 0.0786 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,927,692 Number of extensions: 198694 Number of successful extensions: 544 Number of sequences better than 10.0: 1 Number of HSP's gapped: 539 Number of HSP's successfully gapped: 22 Length of query: 343 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 248 Effective length of database: 4,210,882 Effective search space: 1044298736 Effective search space used: 1044298736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.0 bits)