BLAST/PSIBLAST alignment of GI: 254780530 and GI: 86356324 at iteration 1
>gi|86356324|ref|YP_468216.1| hypothetical protein RHE_CH00673 [Rhizobium etli CFN 42] Length = 209
>gi|86280426|gb|ABC89489.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 209
 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 85/180 (47%), Gaps = 32/180 (17%)

Query: 43  DFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVR 102
           D + E+ +AY +G+  A  D    ++ +   +  +H   + +L+  +E   +  IA  VR
Sbjct: 42  DVEAERREAYAQGHAAATADLTEKYEGEARALAEAHARALEELKIRYEVEAAAVIASRVR 101

Query: 103 DSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDF----------------LKK 146
           D        +  EV +++        S  AAI  A VV D                 + +
Sbjct: 102 D--------IAEEVAQLV--------SAGAAIAIAPVVTDALAAKAAESLAALLREAILE 145

Query: 147 GDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVK 206
           G  G IV+ GP  L  +++  LGE+++AV +  AD V+ + +I  SVI TR+ +W++ +K
Sbjct: 146 GAAGPIVVRGPTGLFDILKAELGEHAAAVRHIEADDVDLAVEIGESVIVTRMSAWVASLK 205