HHsearch alignment for GI: 254780531 and conserved domain: PRK12717

>PRK12717 flgL flagellar hook-associated protein FlgL; Provisional.
Probab=100.00  E-value=0  Score=459.84  Aligned_cols=146  Identities=19%  Similarity=0.242  Sum_probs=140.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             40457999999999999999999999998512236883138999999999999999999999989999999999999999
Q gi|254780531|r    3 SILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMS   82 (452)
Q Consensus         3 ~i~tn~~~~~al~~l~~~~~~l~~~~~qlstGkri~~~sDdp~~~~~~~~l~~~~~~~~q~~~n~~~a~~~l~~ae~~l~   82 (452)
T Consensus         2 RIs~~~~~~~~~~nl~~~~~~l~~~~eqLSSGkrIn~asDDpag~a~~~~l~~~i~~l~Q~~~N~~~a~s~lq~aE~aL~   81 (523)
T PRK12717          2 RISTAQFYESSAANYQRNYSNLVKTQEEISSGIRINTAADDPVGAARLLQLEQQQAMLDQYKGNITTIKNSLGQEETTLN   81 (523)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             16369999999999999999999999987326866881139999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             99999999999875303776---3035678899999999999863001211001356665432233433
Q gi|254780531|r   83 KAIDVMSTIKNKITAGVERG---TDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKS  148 (452)
Q Consensus        83 ~~~~~l~r~relavqa~n~~---~dr~a~~~e~~~l~~~i~~ian~t~~nG~~l~~g~~~~~~~~~~~~  148 (452)
T Consensus        82 ~v~~iLqr~reLavQaaNgt~s~~DR~ai~~Ei~ql~~el~~iaNtt~~nG~~lf~G~~~~~~pf~~~~  150 (523)
T PRK12717         82 SINDVLQRARELAVSAGNGGLTDADRKAIASELKQIEAQLLGLMNSRDANGQYLFAGSKSDTPPYVRNA  150 (523)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCEEECC
T ss_conf             999999999999998716899988999999999999999998860455576267457666766404458