HHsearch alignment of GI: 254780531 and MMDB domain: 2d4x_A_

>2d4x_A (A:) Flagellar HOOK-associated protein 3; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 1.90A {Salmonella typhimurium}
Probab=100.00  E-value=3.7e-34  Score=226.07  Aligned_cols=244  Identities=12%  Similarity=0.043  Sum_probs=163.5

Q ss_pred             HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHH
Q ss_conf             13899999999999999999999998999999999999999999999999999875303776---303567889999999
Q gi|254780531|r   41 ADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERG---TDSKSIQSEITQLQS  117 (452)
Q Consensus        41 sDdp~~~~~~~~l~~~~~~~~q~~~n~~~a~~~l~~ae~~l~~~~~~l~r~relavqa~n~~---~dr~a~~~e~~~l~~  117 (452)
                      ||||++++++++|+.++.+++||++|+..+++||+++|++|.++.++|+|+|||+||++|++   .||.+|+.|+++|++
T Consensus         2 SDDp~~~~~a~~l~~~~~~~~q~~~Ni~~a~~~l~~ae~aL~~i~~~l~~~k~l~vqa~ngt~s~~dr~~i~~ei~~l~~   81 (248)
T 2d4x_A            2 SDDPIAASQAVVLSQAQAQNSQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIRD   81 (248)
T ss_dssp             ----------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCTTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             96889999999999999999999999999999999999999999999999999999751477652228999889999889


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998630012110013566654322334332221112333332222222221354333332211111111122333223
Q gi|254780531|r  118 QLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIK  197 (452)
Q Consensus       118 ~i~~ian~t~~nG~~l~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (452)
                      +|.+++|+++|+|+|||.|......++...........................                   .......
T Consensus        82 ~i~~~an~t~~~g~~lf~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------~~~~~~~  142 (248)
T 2d4x_A           82 QLMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVIG-------------------HTGAQIF  142 (248)
T ss_dssp             HHHHHHTCBCTTSCBTTSTTCTTSCSBCTTTCCBCSCSSCEEEECSSSCEEEES-------------------CCHHHHH
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCC-------------------CCCCHHH
T ss_conf             999998621024531125755466530046754435332111123544322224-------------------3320110


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCC
Q ss_conf             45443322211112222112222222221111111111110100112221012333344332222233222221000001
Q gi|254780531|r  198 VEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASA  277 (452)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  277 (452)
                      ........             ..     .                                   ......... .     
T Consensus       143 ~~~~~~~~-------------~~-----~-----------------------------------~~~~~~~~~-~-----  163 (248)
T 2d4x_A          143 NSITSNAV-------------PE-----P-----------------------------------DGSDSEKNL-F-----  163 (248)
T ss_dssp             SCCCTTCC-------------CC-----T-----------------------------------TSCCCCCCH-H-----
T ss_pred             CCCCCCCC-------------CC-----C-----------------------------------CCCCCCHHH-H-----
T ss_conf             13331222-------------22-----2-----------------------------------322100023-4-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22344443211001233211100000000111111112234444332232223332222210000012233444321000
Q gi|254780531|r  278 TYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNE  357 (452)
Q Consensus       278 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (452)
                                                                              ........................
T Consensus       164 --------------------------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~  187 (248)
T 2d4x_A          164 --------------------------------------------------------VMLDTAIAALKTPVEGNNVEKEKA  187 (248)
T ss_dssp             --------------------------------------------------------HHHHHHHHHHTSCCTTCHHHHHHH
T ss_pred             --------------------------------------------------------HHHHCCCCCHHCCCCCCCCCCCCH
T ss_conf             --------------------------------------------------------442000001000000000011100


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCHHHH
Q ss_conf             0005789999999999999999998789999999999999999999973062220258999
Q gi|254780531|r  358 KLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASE  418 (452)
Q Consensus       358 ~~~~~~al~~id~a~~~v~~~ra~iGa~~nrle~~~~~~~~~~~~~~~~~s~i~D~D~A~e  418 (452)
                      ......++..+|.+++.+...|+.+|+++||++...+++....+++++.+|+|+|+|||+.
T Consensus       188 ~~~~~~~~~~~~~a~~~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~s~i~d~D~a~v  248 (248)
T 2d4x_A          188 AAAIDKTNRGLKNSLNNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNLVDVDWNSV  248 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             0111223467899999999999998299999999999899999999999888763283259