HHsearch alignment for GI: 254780532 and conserved domain: pfam02618

>pfam02618 YceG YceG-like family. This family of proteins is found in bacteria. Proteins in this family are typically between 332 and 389 amino acids in length. This family was previously incorrectly annotated and names as aminodeoxychorismate lyase. The structure of YceG was solved by X-ray crystallography.
Probab=100.00  E-value=0  Score=668.89  Aligned_cols=276  Identities=42%  Similarity=0.700  Sum_probs=262.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             89998888999999999998798069899999999538667625720440678758999998610243332101111034
Q gi|254780532|r   36 TIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFT  115 (325)
Q Consensus        36 ~~i~I~~G~s~~~I~~~L~~~gvI~s~~~F~~~~~~~~~~~~ikaG~Y~i~~~~s~~~il~~L~~G~~~~~~iTI~EG~t  115 (325)
T Consensus         1 V~v~I~~G~s~~~I~~~L~~~gvI~s~~~F~~~~~~~~~~~~ik~G~Y~l~~~~s~~~il~~L~~g~~~~~~vTI~EG~t   80 (287)
T pfam02618         1 VVVTIPPGSSLSQIADILEEAGVIKSALAFRLYARLKGKDGNLKAGEYELKPGMSPAEILEKLVSGKVVQYKVTIPEGLT   80 (287)
T ss_pred             CEEEECCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCHHHHHHHHHCCCEEEEEEEECCCCC
T ss_conf             98998999999999999998859178999999998779868540179897999999999998635975789999869860


Q ss_pred             HHHHHHHHHCCCCCCCCCC-----------CCCCCCCCCCHHHEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8999998620731113443-----------66881000030112101468978999999999999875565545310667
Q gi|254780532|r  116 VKQMARRLKDNPLLVGELP-----------LELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPI  184 (325)
Q Consensus       116 ~~ei~~~L~~~~~l~~~~~-----------~~~~lEG~l~PdTY~~~~~~s~~~il~~m~~~~~~~~~~~~~~~~~~~~~  184 (325)
T Consensus        81 ~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~lEG~l~PdTY~~~~~~s~~~il~~m~~~~~~~~~~~~~~~~~~~~~  160 (287)
T pfam02618        81 LEQIAERLAKAGGLKKEEFLAFLEELGGELPSLPLEGYLFPDTYEFDKGTSAEEILKRMVKRFEKVLAEAWQARAKGLPL  160 (287)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCEEEECCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999856599989999869987512688983448728768878999999999999999999998988765441367


Q ss_pred             CCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCHHHCCCCCCHHCCCCC
Q ss_conf             65999999887777652672578899999999740587024422210101556677542000000101568301102388
Q gi|254780532|r  185 KSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNG  264 (325)
Q Consensus       185 ~s~~evlilASIVEkEa~~~~e~~~IA~V~~NRL~~~M~Lq~D~Tv~Y~l~~~~~~~~~~~~~~~dl~~~spYNTY~~~G  264 (325)
T Consensus       161 ~s~~evltLASIVEkEa~~~~e~~~IA~V~~NRL~~gm~LQ~D~Tv~Y~~~~~-----~~~~~~~dl~~~spYNTY~~~G  235 (287)
T pfam02618       161 KTPYEALILASIVEKETGVAEERPKIAGVFYNRLKKGMRLQSDPTVIYGLGEG-----DGRLTRKDLRTDSPYNTYKIKG  235 (287)
T ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCC-----CCCCCHHHHCCCCCHHHCCCCC
T ss_conf             78789767878888873274036789999998644799777584203537788-----8866589863688213214169


Q ss_pred             CCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCEEECCCHHHHHHHHHHH
Q ss_conf             8999866432798999608788987999983898766529999999999999
Q gi|254780532|r  265 LPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKW  316 (325)
Q Consensus       265 LPP~PI~~pg~~ai~A~l~p~~~dylyfv~~~~g~h~Fs~t~~eH~~nv~~y  316 (325)
T Consensus       236 LPPgPI~~P~~~ai~Aal~p~~~~ylyfv~~~~g~~~Fs~t~~eH~~~v~~y  287 (287)
T pfam02618       236 LPPGPIANPGKAAIEAALNPAKTDYLYFVADGDGTHYFSKTLAEHNRAVRKY  287 (287)
T ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCEEEEEECCCCCEEECCCHHHHHHHHHHC
T ss_conf             9998768879999999868888874899985998478078999999999739