PSIBLAST alignment of GI: 254780532 and protein with PDB id: 2r1f

>gi|158430555|pdb|2R1F|A Chain A, Crystal Structure Of Predicted Aminodeoxychorismate Lyase From Escherichia Coli Length = 270
>gi|158430556|pdb|2R1F|B Chain B, Crystal Structure Of Predicted Aminodeoxychorismate Lyase From Escherichia Coli Length = 270
 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 97/270 (35%), Positives = 131/270 (48%), Gaps = 18/270 (6%)

Query: 68  VTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNP 127
           + +        K G Y      ++ +  + +  GK     +   EG  +    ++L++ P
Sbjct: 2   LLRIEPDLSHFKAGTYRFTPQXTVREXLKLLESGKEAQFPLRLVEGXRLSDYLKQLREAP 61

Query: 128 LLVGELPLELP--------------LEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDE 173
            +   L  +                +EG   P T+ +   T    +L +A  K  + VD 
Sbjct: 62  YIKHTLSDDKYATVAQALELENPEWIEGWFWPDTWXYTANTTDVALLKRAHKKXVKAVDS 121

Query: 174 VWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYG 233
            WE R    P K K  LV  ASI+EKET+ A ER  VASVFINR     RLQ+D TVIYG
Sbjct: 122 AWEGRADGLPYKDKNQLVTXASIIEKETAVASERDQVASVFINRLRIGXRLQTDPTVIYG 181

Query: 234 ILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFV 293
             E      N K+SR+D    T YN+Y + GLPP AI+ PG  SL+A A P  T  LYFV
Sbjct: 182 XGE----RYNGKLSRADLETPTAYNTYTITGLPPGAIATPGADSLKAAAHPAKTPYLYFV 237

Query: 294 GDGKGGHFFSTNFKDHTINVQKWRKMSLES 323
            DGKGGH F+TN   H  +VQ + K+  E 
Sbjct: 238 ADGKGGHTFNTNLASHNKSVQDYLKVLKEK 267