RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780534|ref|YP_003064947.1| acyl carrier protein [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated. Length = 82 Score = 67.7 bits (166), Expect = 6e-13 Identities = 38/73 (52%), Positives = 54/73 (73%), Gaps = 1/73 (1%) Query: 6 DDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESA 65 +D+FE V+ ++ QL +++ ++ A F +LGADSLDVVELVM EEKF +EIP+E A Sbjct: 4 NDIFEKVQSIVAEQL-GIEKSEVTLDANFTRDLGADSLDVVELVMAIEEKFDIEIPDEDA 62 Query: 66 NKILTVKDAVDFI 78 KI T+++AVDFI Sbjct: 63 EKISTLQEAVDFI 75 >gnl|CDD|36959 KOG1748, KOG1748, KOG1748, Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion, Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]. Length = 131 Score = 62.6 bits (152), Expect = 2e-11 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 1/82 (1%) Query: 4 ANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEE 63 A +V + V +V+ + ++ + F ++LG DSLD VE+VM EE+F +EIP+E Sbjct: 50 AKKEVVDRVLDVVKKFD-KIDPSKLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIEIPDE 108 Query: 64 SANKILTVKDAVDFIRKAKQTN 85 A+KI TV+DA D+I Sbjct: 109 DADKIKTVRDAADYIADKPDVK 130 >gnl|CDD|30585 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]. Length = 80 Score = 46.8 bits (111), Expect = 1e-06 Identities = 37/77 (48%), Positives = 50/77 (64%), Gaps = 1/77 (1%) Query: 7 DVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESAN 66 + E VK++I QL V E++I A F+E+LG DSLD+VELVM EE+F +EIP+E Sbjct: 5 AIEERVKDIIAEQL-GVDEEEITTEASFVEDLGLDSLDLVELVMALEEEFGIEIPDEELE 63 Query: 67 KILTVKDAVDFIRKAKQ 83 I TV D VD+I + Sbjct: 64 NIKTVGDLVDYIEELLA 80 >gnl|CDD|144221 pfam00550, PP-binding, Phosphopantetheine attachment site. A 4'-phosphopantetheine prosthetic group is attached through a serine. This prosthetic group acts as a a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups. This domain forms a four helix bundle. This family includes members not included in Prosite. The inclusion of these members is supported by sequence analysis and functional evidence. The related domain of Listonella anguillarum angR has the attachment serine replaced by an alanine. Length = 67 Score = 37.9 bits (89), Expect = 6e-04 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query: 16 ILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAV 75 I++++ + D+I +LG DSL VEL+ EE+F +EIP + T+ + Sbjct: 6 IVAEVLGIPPDEIDPDDDL-FDLGLDSLLAVELLARLEEEFGVEIPPSDLFEHPTLGELA 64 Query: 76 DFI 78 ++ Sbjct: 65 AYL 67 >gnl|CDD|73401 cd04739, DHOD_like, Dihydroorotate dehydrogenase (DHOD) like proteins. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. This subgroup has the conserved FMN binding site, but lacks some catalytic residues and may therefore be inactive.. Length = 325 Score = 27.1 bits (60), Expect = 1.3 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Query: 10 EAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKIL 69 AV +++ L V V+ AR IEE GAD+L++ + + S E+ IL Sbjct: 96 RAVSIPVIASLNGVSAGGWVDYARQIEEAGADALELNIYALPTDPDISGAEVEQRYLDIL 155 Query: 70 T-VKDAV 75 VK AV Sbjct: 156 RAVKSAV 162 >gnl|CDD|73380 cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis. Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent. The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.. Length = 336 Score = 26.6 bits (59), Expect = 1.6 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 13/52 (25%) Query: 7 DVFEAVKEVILSQLT-----SVKE--------DQIVESARFIEELGADSLDV 45 +V +AV+ V S + + VE A+ ++ELG D +DV Sbjct: 209 EVVDAVRAVWPEDKPLFVRISATDWVEGGWDLEDSVELAKALKELGVDLIDV 260 >gnl|CDD|73368 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS. The enzymatic mechanism of 1VHN is not known at the present.. Length = 231 Score = 25.5 bits (56), Expect = 3.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Query: 19 QLTSVKEDQIVESARFIEELGADSLDV 45 QL + + E+A+ +EELGAD +D+ Sbjct: 60 QLGGSDPETLAEAAKIVEELGADGIDL 86 >gnl|CDD|73402 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.. Length = 296 Score = 25.1 bits (55), Expect = 4.2 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Query: 2 PNANDDVFEAVKEV----ILSQLTSVKEDQIVESARFIEELGADSLDVVELVM 50 P A ++ +AVK+ ++ +LT D IVE AR EE GAD L ++ + Sbjct: 139 PEAVAEIVKAVKKATDVPVIVKLTPNVTD-IVEIARAAEEAGADGLTLINTLK 190 >gnl|CDD|113131 pfam04348, LppC, LppC putative lipoprotein. This family includes several bacterial outer membrane antigens, whose molecular function is unknown. Length = 535 Score = 24.8 bits (54), Expect = 6.0 Identities = 11/25 (44%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Query: 4 ANDDVFEAVKEVI-LSQLTSVKEDQ 27 A D EA K I + QL S K Q Sbjct: 110 ARGDAIEAAKARIQMDQLLSGKRKQ 134 >gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 326 Score = 24.1 bits (53), Expect = 10.0 Identities = 11/26 (42%), Positives = 12/26 (46%), Gaps = 5/26 (19%) Query: 30 ESARFIEELGADSLD-----VVELVM 50 E A F LGAD + VVE V Sbjct: 179 EKAAFARSLGADPIIYYRETVVEYVA 204 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.131 0.330 Gapped Lambda K H 0.267 0.0826 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 883,202 Number of extensions: 37833 Number of successful extensions: 130 Number of sequences better than 10.0: 1 Number of HSP's gapped: 130 Number of HSP's successfully gapped: 24 Length of query: 85 Length of database: 6,263,737 Length adjustment: 54 Effective length of query: 31 Effective length of database: 5,096,851 Effective search space: 158002381 Effective search space used: 158002381 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.2 bits)