BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780534|ref|YP_003064947.1| acyl carrier protein [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780534|ref|YP_003064947.1| acyl carrier protein [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 165 bits (418), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEI 60 MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEI Sbjct: 1 MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEI 60 Query: 61 PEESANKILTVKDAVDFIRKAKQTN 85 PEESANKILTVKDAVDFIRKAKQTN Sbjct: 61 PEESANKILTVKDAVDFIRKAKQTN 85 >gi|254780276|ref|YP_003064689.1| dihydrodipicolinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 292 Score = 21.2 bits (43), Expect = 3.8, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 16 ILSQLTSVKEDQIVESARFIEELGADSLDVV 46 +++ + S + VE A++ +GAD+L VV Sbjct: 73 VMAGIGSNNTRESVELAQYAHSIGADALLVV 103 >gi|255764493|ref|YP_003065056.2| hypothetical protein CLIBASIA_02650 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 20.8 bits (42), Expect = 4.6, Method: Compositional matrix adjust. Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 62 EESANKILTVKDAVDFI 78 + S+ K+ VKDA+D++ Sbjct: 23 QNSSKKLKIVKDAIDYV 39 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 20.4 bits (41), Expect = 5.6, Method: Compositional matrix adjust. Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 34 FIEELGADSLDV 45 F+E +G D LDV Sbjct: 512 FVESMGGDILDV 523 >gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62] Length = 219 Score = 20.0 bits (40), Expect = 7.6, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 53 EEKFSLEIPEESANKILTVKD 73 EEK + IPEES N+ +D Sbjct: 25 EEKSEINIPEESLNQSEEFRD 45 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.131 0.330 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,912 Number of Sequences: 1233 Number of extensions: 1348 Number of successful extensions: 8 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 85 length of database: 328,796 effective HSP length: 54 effective length of query: 31 effective length of database: 262,214 effective search space: 8128634 effective search space used: 8128634 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 31 (16.5 bits)